Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7559
Gene name
LocationContig_446:11900..12455
Strand+
Gene length (bp)555
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18785 Inv-AAD Invertebrate-AID/APOBEC-deaminase 5.2E-52 61 178
PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region 2.0E-09 9 139

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12362|RIB2_YEAST Bifunctional protein RIB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIB2 PE=1 SV=1 7 181 8.0E-30
sp|P87241|RIB2_SCHPO Diaminohydroxyphosphoribosylamino-pyrimidine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rib2 PE=3 SV=1 8 181 1.0E-19

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7559
MGSDTADDHRATMLQALELAKKSPPRPSNFRVGAILVRLDGGDGHGGGGDRGRDSGGGPGVAAQGYTLEWPGNTH
AEECCLLKLAEQHSTTEEGLAAVMSSPHALYTTMEPCSRRLSGKLPCVERLLRQRSWIRKVFVGVQEPQTFVGSN
PGRRLLEEGGIQVHHVPGLEQEILAVATAGHVSH*
Coding >Hirsu2|7559
ATGGGCTCCGACACAGCCGATGATCACAGGGCGACGATGCTGCAGGCTCTAGAGCTGGCCAAGAAATCGCCCCCG
CGGCCGAGCAACTTCCGTGTCGGGGCAATCTTGGTCAGGCTCGATGGCGGCGACGGCCATGGTGGTGGCGGAGAC
AGAGGCAGAGACAGCGGCGGCGGCCCTGGCGTCGCCGCGCAGGGATACACGCTCGAGTGGCCCGGCAACACCCAC
GCCGAGGAATGCTGCTTGCTCAAGCTGGCCGAGCAACACTCGACGACCGAGGAGGGCCTTGCCGCCGTCATGAGC
AGCCCGCATGCCCTTTATACAACCATGGAACCCTGCTCCCGGCGTCTGAGCGGCAAGCTCCCCTGCGTCGAGAGG
CTGCTCCGCCAAAGGTCTTGGATCAGAAAGGTGTTCGTGGGGGTCCAGGAGCCCCAGACCTTTGTTGGCAGCAAC
CCCGGTCGTCGGCTGCTGGAGGAGGGCGGCATCCAAGTTCATCACGTTCCAGGCCTCGAGCAAGAGATTCTAGCG
GTCGCGACCGCCGGTCACGTCTCCCATTGA
Transcript >Hirsu2|7559
ATGGGCTCCGACACAGCCGATGATCACAGGGCGACGATGCTGCAGGCTCTAGAGCTGGCCAAGAAATCGCCCCCG
CGGCCGAGCAACTTCCGTGTCGGGGCAATCTTGGTCAGGCTCGATGGCGGCGACGGCCATGGTGGTGGCGGAGAC
AGAGGCAGAGACAGCGGCGGCGGCCCTGGCGTCGCCGCGCAGGGATACACGCTCGAGTGGCCCGGCAACACCCAC
GCCGAGGAATGCTGCTTGCTCAAGCTGGCCGAGCAACACTCGACGACCGAGGAGGGCCTTGCCGCCGTCATGAGC
AGCCCGCATGCCCTTTATACAACCATGGAACCCTGCTCCCGGCGTCTGAGCGGCAAGCTCCCCTGCGTCGAGAGG
CTGCTCCGCCAAAGGTCTTGGATCAGAAAGGTGTTCGTGGGGGTCCAGGAGCCCCAGACCTTTGTTGGCAGCAAC
CCCGGTCGTCGGCTGCTGGAGGAGGGCGGCATCCAAGTTCATCACGTTCCAGGCCTCGAGCAAGAGATTCTAGCG
GTCGCGACCGCCGGTCACGTCTCCCATTGA
Gene >Hirsu2|7559
ATGGGCTCCGACACAGCCGATGATCACAGGGCGACGATGCTGCAGGCTCTAGAGCTGGCCAAGAAATCGCCCCCG
CGGCCGAGCAACTTCCGTGTCGGGGCAATCTTGGTCAGGCTCGATGGCGGCGACGGCCATGGTGGTGGCGGAGAC
AGAGGCAGAGACAGCGGCGGCGGCCCTGGCGTCGCCGCGCAGGGATACACGCTCGAGTGGCCCGGCAACACCCAC
GCCGAGGAATGCTGCTTGCTCAAGCTGGCCGAGCAACACTCGACGACCGAGGAGGGCCTTGCCGCCGTCATGAGC
AGCCCGCATGCCCTTTATACAACCATGGAACCCTGCTCCCGGCGTCTGAGCGGCAAGCTCCCCTGCGTCGAGAGG
CTGCTCCGCCAAAGGTCTTGGATCAGAAAGGTGTTCGTGGGGGTCCAGGAGCCCCAGACCTTTGTTGGCAGCAAC
CCCGGTCGTCGGCTGCTGGAGGAGGGCGGCATCCAAGTTCATCACGTTCCAGGCCTCGAGCAAGAGATTCTAGCG
GTCGCGACCGCCGGTCACGTCTCCCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail