Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7551
Gene name
LocationContig_445:12602..13408
Strand+
Gene length (bp)806
Transcript length (bp)723
Coding sequence length (bp)723
Protein length (aa) 241

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13668 Ferritin_2 Ferritin-like domain 2.0E-11 87 213

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53693|RDS1_SCHPO Protein rds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rds1 PE=2 SV=2 22 216 4.0E-48

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7551
MLHSIFGFGLRLPLVLTLLSRARAVPFHDGNALGLGYERADSVSASSGRLVRLPGRRRGPRPAAGALHGGIGTDG
AAPVYRVQSDFDYQSLALALYQEWIELDLFHWGLAAYSVDEFEFDGLNAEHRFLLQHMAEQEVGCATVLTNMLGP
QAPRQCSYSCPVSNEREFLDINLQLTRWGEAGVYGFLLHLDSPPATQLLLQSITIEARQQMILCQLNVAGWYGRS
GIKLRDARGQRFGVT*
Coding >Hirsu2|7551
ATGCTCCACTCCATATTCGGTTTCGGGCTTCGGCTCCCGCTCGTGCTCACGCTGCTGAGCCGTGCTCGTGCCGTT
CCGTTTCACGACGGGAACGCTCTCGGTCTCGGTTACGAGCGCGCCGACTCCGTCTCGGCCTCCTCCGGCCGGCTC
GTTCGACTACCCGGCCGACGGCGAGGTCCACGGCCAGCAGCCGGCGCCCTTCACGGCGGCATCGGGACCGACGGC
GCGGCGCCGGTCTACCGCGTGCAGAGCGACTTCGACTACCAGTCCCTCGCCCTGGCCCTCTATCAGGAGTGGATC
GAGCTGGACCTCTTCCACTGGGGGCTGGCCGCGTACAGCGTCGACGAGTTCGAGTTCGACGGGCTCAACGCCGAG
CACCGCTTCCTGCTGCAGCACATGGCAGAACAGGAGGTCGGCTGCGCGACCGTCCTGACCAACATGCTCGGGCCG
CAGGCGCCGAGGCAGTGCTCCTATAGCTGCCCCGTGTCCAACGAGCGCGAGTTCCTCGACATCAACCTGCAGCTG
ACGCGATGGGGCGAAGCGGGCGTCTACGGCTTCTTGCTCCATCTCGACTCGCCCCCGGCCACACAGCTGCTCCTG
CAGAGCATCACCATCGAGGCCCGCCAGCAGATGATCTTGTGCCAACTTAATGTGGCCGGCTGGTACGGGAGGTCT
GGAATAAAACTCCGGGACGCAAGAGGGCAGCGCTTCGGCGTCACCTGA
Transcript >Hirsu2|7551
ATGCTCCACTCCATATTCGGTTTCGGGCTTCGGCTCCCGCTCGTGCTCACGCTGCTGAGCCGTGCTCGTGCCGTT
CCGTTTCACGACGGGAACGCTCTCGGTCTCGGTTACGAGCGCGCCGACTCCGTCTCGGCCTCCTCCGGCCGGCTC
GTTCGACTACCCGGCCGACGGCGAGGTCCACGGCCAGCAGCCGGCGCCCTTCACGGCGGCATCGGGACCGACGGC
GCGGCGCCGGTCTACCGCGTGCAGAGCGACTTCGACTACCAGTCCCTCGCCCTGGCCCTCTATCAGGAGTGGATC
GAGCTGGACCTCTTCCACTGGGGGCTGGCCGCGTACAGCGTCGACGAGTTCGAGTTCGACGGGCTCAACGCCGAG
CACCGCTTCCTGCTGCAGCACATGGCAGAACAGGAGGTCGGCTGCGCGACCGTCCTGACCAACATGCTCGGGCCG
CAGGCGCCGAGGCAGTGCTCCTATAGCTGCCCCGTGTCCAACGAGCGCGAGTTCCTCGACATCAACCTGCAGCTG
ACGCGATGGGGCGAAGCGGGCGTCTACGGCTTCTTGCTCCATCTCGACTCGCCCCCGGCCACACAGCTGCTCCTG
CAGAGCATCACCATCGAGGCCCGCCAGCAGATGATCTTGTGCCAACTTAATGTGGCCGGCTGGTACGGGAGGTCT
GGAATAAAACTCCGGGACGCAAGAGGGCAGCGCTTCGGCGTCACCTGA
Gene >Hirsu2|7551
ATGCTCCACTCCATATTCGGTTTCGGGCTTCGGCTCCCGCTCGTGCTCACGCTGCTGAGCCGTGCTCGTGCCGTT
CCGTTTGTGCCTTCATCTCCGGCTCCGCCAGCCTTCGTGCCTCCGGCAAGCGTCATGTGCCACGGCCCCTACGCC
GGGCCCCTTAACAGCACGACGGGAACGCTCTCGGTCTCGGTTACGAGCGCGCCGACTCCGTCTCGGCCTCCTCCG
GCCGGCTCGTTCGACTACCCGGCCGACGGCGAGGTCCACGGCCAGCAGCCGGCGCCCTTCACGGCGGCATCGGGA
CCGACGGCGCGGCGCCGGTCTACCGCGTGCAGAGCGACTTCGACTACCAGTCCCTCGCCCTGGCCCTCTATCAGG
AGTGGATCGAGCTGGACCTCTTCCACTGGGGGCTGGCCGCGTACAGCGTCGACGAGTTCGAGTTCGACGGGCTCA
ACGCCGAGCACCGCTTCCTGCTGCAGCACATGGCAGAACAGGAGGTCGGCTGCGCGACCGTCCTGACCAACATGC
TCGGGCCGCAGGCGCCGAGGCAGTGCTCCTATAGCTGCCCCGTGTCCAACGAGCGCGAGTTCCTCGACATCAACC
TGCAGCTGACGCGATGGGGCGAAGCGGGCGTCTACGGCTTCTTGCTCCATCTCGACTCGCCCCCGGCCACACAGC
TGCTCCTGCAGAGCATCACCATCGAGGCCCGCCAGCAGATGATCTTGTGCCAACTTAATGTGGCCGGCTGGTACG
GGAGGTCTGGAATAAAACTCCGGGACGCAAGAGGGCAGCGCTTCGGCGTCACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail