Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|755
Gene name
LocationContig_1155:1418..2879
Strand-
Gene length (bp)1461
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02434 Fringe Fringe-like 1.8E-05 186 235

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016757 transferase activity, transferring glycosyl groups Yes
GO:0016020 membrane Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 13 30 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|755
MTISVPRRMRRRIAPVALALALALSIWYVAQPLDSPARLALRFNLGRLAAKAVGGDGWLRGPARHRLDLRSDVGY
IIKTGYGTRDRLPEQLEALGHGILGDEGRGFLVVGDWTTVNETDGRRLGVDVHDAVRMVMETKIDDEFAEHPRFS
KYRSLQGTVAAGDEDKAKLLGQTYGWELDALKFIMGLELAYRRLPLKKWYMILDDDTYLVRPSLELLLSHLDPSK
PRYIGNAVGDYKGRFAHGGSAVLLSGAAMKVLFERPDVVARAYVDSLDETWGDRLVATTLQKVGIYMEERYGHHF
NGESPEMSRIRADRVCSPVVSFHGLRRPGAMASVGRKLGWVAEPVLWGQLWELFGEQPMERYGRRPSLPGDHVGP
RDEHTKSWKGVSGDEACRTRCEGSGGGWCLAWTFERETNECHGSPWVMVGQPGGGGGRPATVSGVNWKRMERLLQ
QCLPPR*
Coding >Hirsu2|755
ATGACGATATCGGTGCCACGTCGGATGCGCCGACGGATCGCGCCCGTGGCGCTGGCGCTGGCGCTGGCGCTCAGC
ATCTGGTACGTGGCACAGCCGTTGGACTCGCCGGCGCGGCTGGCGCTGCGCTTCAACCTGGGCCGGCTGGCGGCG
AAGGCGGTGGGGGGCGACGGGTGGCTGCGCGGGCCGGCGCGGCACCGGCTGGACCTGCGCAGCGACGTCGGCTAC
ATCATCAAGACGGGCTACGGGACGCGCGACCGGCTGCCGGAGCAACTCGAGGCCCTGGGCCACGGCATCTTGGGC
GACGAGGGCCGGGGGTTCCTCGTCGTCGGCGACTGGACGACGGTCAACGAGACGGACGGGCGGAGGCTGGGCGTC
GACGTGCACGACGCCGTCCGGATGGTCATGGAGACCAAGATCGACGACGAGTTCGCCGAGCACCCGCGCTTCTCC
AAGTACCGGAGCCTGCAGGGGACGGTGGCGGCCGGCGACGAGGACAAGGCGAAGCTGCTCGGGCAGACGTATGGA
TGGGAGCTGGACGCCCTCAAGTTCATCATGGGCCTGGAGCTCGCATATCGGCGGCTCCCTCTTAAGAAGTGGTAC
ATGATCCTCGACGACGACACGTATCTGGTGCGGCCGTCGCTGGAGCTGCTGCTGAGCCACCTGGACCCGAGCAAG
CCGCGGTACATCGGCAATGCGGTAGGCGACTACAAGGGCCGGTTTGCGCACGGCGGCTCGGCGGTGCTGCTGTCG
GGGGCGGCCATGAAGGTGCTGTTCGAGCGGCCGGACGTGGTGGCCAGGGCCTACGTCGACTCGCTCGACGAGACG
TGGGGGGACCGGCTGGTGGCGACGACGCTGCAGAAGGTGGGCATCTACATGGAGGAGCGCTACGGGCACCACTTT
AACGGCGAGTCGCCCGAGATGAGCCGGATCCGGGCCGACCGCGTCTGCTCGCCCGTCGTCTCCTTCCACGGCCTG
CGGCGGCCCGGGGCGATGGCGAGCGTGGGCCGCAAGCTGGGCTGGGTCGCGGAGCCGGTGCTCTGGGGCCAGCTG
TGGGAGCTGTTCGGCGAGCAGCCGATGGAGCGCTACGGCAGGAGGCCGTCGCTGCCGGGCGACCACGTCGGGCCG
AGAGACGAGCACACCAAGAGCTGGAAGGGCGTGAGCGGCGACGAGGCGTGCCGGACGCGCTGCGAGGGGAGCGGC
GGCGGCTGGTGCCTGGCCTGGACGTTTGAGCGCGAGACCAACGAGTGCCACGGGAGTCCGTGGGTCATGGTCGGG
CAGCCAGGAGGAGGAGGAGGACGGCCGGCGACGGTGTCGGGGGTCAACTGGAAGCGGATGGAGCGGCTGCTGCAG
CAGTGTCTGCCGCCGCGGTGA
Transcript >Hirsu2|755
ATGACGATATCGGTGCCACGTCGGATGCGCCGACGGATCGCGCCCGTGGCGCTGGCGCTGGCGCTGGCGCTCAGC
ATCTGGTACGTGGCACAGCCGTTGGACTCGCCGGCGCGGCTGGCGCTGCGCTTCAACCTGGGCCGGCTGGCGGCG
AAGGCGGTGGGGGGCGACGGGTGGCTGCGCGGGCCGGCGCGGCACCGGCTGGACCTGCGCAGCGACGTCGGCTAC
ATCATCAAGACGGGCTACGGGACGCGCGACCGGCTGCCGGAGCAACTCGAGGCCCTGGGCCACGGCATCTTGGGC
GACGAGGGCCGGGGGTTCCTCGTCGTCGGCGACTGGACGACGGTCAACGAGACGGACGGGCGGAGGCTGGGCGTC
GACGTGCACGACGCCGTCCGGATGGTCATGGAGACCAAGATCGACGACGAGTTCGCCGAGCACCCGCGCTTCTCC
AAGTACCGGAGCCTGCAGGGGACGGTGGCGGCCGGCGACGAGGACAAGGCGAAGCTGCTCGGGCAGACGTATGGA
TGGGAGCTGGACGCCCTCAAGTTCATCATGGGCCTGGAGCTCGCATATCGGCGGCTCCCTCTTAAGAAGTGGTAC
ATGATCCTCGACGACGACACGTATCTGGTGCGGCCGTCGCTGGAGCTGCTGCTGAGCCACCTGGACCCGAGCAAG
CCGCGGTACATCGGCAATGCGGTAGGCGACTACAAGGGCCGGTTTGCGCACGGCGGCTCGGCGGTGCTGCTGTCG
GGGGCGGCCATGAAGGTGCTGTTCGAGCGGCCGGACGTGGTGGCCAGGGCCTACGTCGACTCGCTCGACGAGACG
TGGGGGGACCGGCTGGTGGCGACGACGCTGCAGAAGGTGGGCATCTACATGGAGGAGCGCTACGGGCACCACTTT
AACGGCGAGTCGCCCGAGATGAGCCGGATCCGGGCCGACCGCGTCTGCTCGCCCGTCGTCTCCTTCCACGGCCTG
CGGCGGCCCGGGGCGATGGCGAGCGTGGGCCGCAAGCTGGGCTGGGTCGCGGAGCCGGTGCTCTGGGGCCAGCTG
TGGGAGCTGTTCGGCGAGCAGCCGATGGAGCGCTACGGCAGGAGGCCGTCGCTGCCGGGCGACCACGTCGGGCCG
AGAGACGAGCACACCAAGAGCTGGAAGGGCGTGAGCGGCGACGAGGCGTGCCGGACGCGCTGCGAGGGGAGCGGC
GGCGGCTGGTGCCTGGCCTGGACGTTTGAGCGCGAGACCAACGAGTGCCACGGGAGTCCGTGGGTCATGGTCGGG
CAGCCAGGAGGAGGAGGAGGACGGCCGGCGACGGTGTCGGGGGTCAACTGGAAGCGGATGGAGCGGCTGCTGCAG
CAGTGTCTGCCGCCGCGGTGA
Gene >Hirsu2|755
ATGACGATATCGGTGCCACGTCGGATGCGCCGACGGATCGCGCCCGTGGCGCTGGCGCTGGCGCTGGCGCTCAGC
ATCTGGTACGTGGCACAGCCGTTGGACTCGCCGGCGCGGCTGGCGCTGCGCTTCAACCTGGGCCGGCTGGCGGCG
AAGGCGGTGGGGGGCGACGGGTGGCTGCGCGGGCCGGCGCGGCACCGGCTGGACCTGCGCAGCGACGTCGGCTAC
ATCATCAAGACGGGCTACGGGACGCGCGACCGGCTGCCGGAGCAACTCGAGGCCCTGGGCCACGGCATCTTGGGC
GACGAGGGCCGGGGGTTCCTCGTCGTCGGCGACTGGACGACGGTCAACGAGACGGACGGGCGGAGGCTGGGCGTC
GACGTGCACGACGCCGTCCGGATGGTCATGGAGACCAAGATCGACGACGAGTTCGCCGAGCACCCGCGCTTCTCC
AAGTACCGGAGCCTGCAGGGGACGGTGGCGGCCGGCGACGAGGACAAGGCGAAGCTGCTCGGGCAGACGTATGGA
TGGGAGCTGGACGCCCTCAAGGTGAGCCAGCCCCCCCTCCCTCCTCCTTTTTTTTTTTTGCTTGCCTTTCATTAT
CCAGGCCCGCGCTGACCTGGTGGGGGGCCAAAACAGTTCATCATGGGCCTGGAGCTCGCATATCGGCGGCTCCCT
CTTAAGAAGTGGTACATGATCCTCGACGACGACACGTATCTGGTGCGGCCGTCGCTGGAGCTGCTGCTGAGCCAC
CTGGACCCGAGCAAGCCGCGGTACATCGGCAATGCGGTAGGCGACTACAAGGGCCGGTTTGCGCACGGCGGCTCG
GCGGTGCTGCTGTCGGGGGCGGCCATGAAGGTGCTGTTCGAGCGGCCGGACGTGGTGGCCAGGGCCTACGTCGAC
TCGCTCGACGAGACGTGGGGGGACCGGCTGGTGGCGACGACGCTGCAGAAGGTGGGCATCTACATGGAGGAGCGC
TACGGGCACCACTTTAACGGCGAGTCGCCCGAGATGAGCCGGATCCGGGCCGACCGCGTCTGCTCGCCCGTCGTC
TCCTTCCACGGCCTGCGGCGGCCCGGGGCGATGGCGAGCGTGGGCCGCAAGCTGGGCTGGGTCGCGGAGCCGGTG
CTCTGGGGCCAGCTGTGGGAGCTGTTCGGCGAGCAGCCGATGGAGCGCTACGGCAGGAGGCCGTCGCTGCCGGGC
GACCACGTCGGGCCGAGAGACGAGCACACCAAGAGCTGGAAGGGCGTGAGCGGCGACGAGGCGTGCCGGACGCGC
TGCGAGGGGAGCGGCGGCGGCTGGTGCCTGGCCTGGACGTTTGAGCGCGAGACCAACGAGTGCCACGGGAGTCCG
TGGGTCATGGTCGGGCAGCCAGGAGGAGGAGGAGGACGGCCGGCGACGGTGTCGGGGGTCAACTGGAAGCGGATG
GAGCGGCTGCTGCAGCAGTGTCTGCCGCCGCGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail