Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7548
Gene name
LocationContig_445:31..1431
Strand-
Gene length (bp)1400
Transcript length (bp)1263
Coding sequence length (bp)1263
Protein length (aa) 421

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.2E-23 268 410
PF07714 Pkinase_Tyr Protein tyrosine kinase 5.3E-17 300 411

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 248 406 2.0E-12
sp|Q9UIK4|DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens GN=DAPK2 PE=1 SV=1 268 410 2.0E-12
sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 268 410 3.0E-12
sp|Q6XHB2|ROCO4_DICDI Probable serine/threonine-protein kinase roco4 OS=Dictyostelium discoideum GN=roco4 PE=1 SV=1 300 408 3.0E-12
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 286 411 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 248 406 2.0E-12
sp|Q9UIK4|DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens GN=DAPK2 PE=1 SV=1 268 410 2.0E-12
sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 268 410 3.0E-12
sp|Q6XHB2|ROCO4_DICDI Probable serine/threonine-protein kinase roco4 OS=Dictyostelium discoideum GN=roco4 PE=1 SV=1 300 408 3.0E-12
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 286 411 3.0E-12
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 268 410 4.0E-12
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 268 411 4.0E-12
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 268 410 5.0E-12
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 268 411 5.0E-12
sp|Q9LPQ3|M2K7_ARATH Mitogen-activated protein kinase kinase 7 OS=Arabidopsis thaliana GN=MKK7 PE=1 SV=1 269 406 6.0E-12
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 268 406 9.0E-12
sp|Q13546|RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens GN=RIPK1 PE=1 SV=3 263 405 2.0E-11
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 268 411 2.0E-11
sp|O80963|ACCR2_ARATH Serine/threonine-protein kinase-like protein CCR2 OS=Arabidopsis thaliana GN=CCR2 PE=1 SV=1 268 411 3.0E-11
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 303 407 6.0E-11
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 268 406 9.0E-11
sp|Q9FIL7|CRCK1_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 1 OS=Arabidopsis thaliana GN=CRCK1 PE=1 SV=1 267 412 1.0E-10
sp|Q55CW3|SAMKA_DICDI Probable serine/threonine-protein kinase samkA OS=Dictyostelium discoideum GN=samkA PE=3 SV=1 302 420 2.0E-10
sp|Q55EI8|Y9956_DICDI Probable serine/threonine-protein kinase DDB_G0268876 OS=Dictyostelium discoideum GN=DDB_G0268876 PE=3 SV=1 268 420 2.0E-10
sp|C0LGU1|Y5374_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g37450 OS=Arabidopsis thaliana GN=At5g37450 PE=2 SV=1 243 418 2.0E-10
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 268 411 3.0E-10
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 268 411 3.0E-10
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 268 411 3.0E-10
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 268 411 3.0E-10
sp|O64556|Y2923_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230 OS=Arabidopsis thaliana GN=At2g19230 PE=3 SV=3 300 406 3.0E-10
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 268 411 4.0E-10
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 268 411 4.0E-10
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 268 411 4.0E-10
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 268 411 5.0E-10
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 268 411 5.0E-10
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 268 411 5.0E-10
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 265 406 5.0E-10
sp|O81069|Y2899_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g28990 OS=Arabidopsis thaliana GN=At2g28990 PE=2 SV=1 300 406 5.0E-10
sp|C0LGL4|Y2289_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g28960 OS=Arabidopsis thaliana GN=At2g28960 PE=2 SV=1 224 406 5.0E-10
sp|Q5UQG7|YR818_MIMIV Putative serine/threonine-protein kinase/receptor R818 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R818 PE=3 SV=1 282 411 7.0E-10
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 268 411 8.0E-10
sp|Q9LT96|Y5977_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Arabidopsis thaliana GN=At5g49770 PE=2 SV=1 297 406 1.0E-09
sp|Q8GXQ3|WAKLF_ARATH Wall-associated receptor kinase-like 6 OS=Arabidopsis thaliana GN=WAKL6 PE=2 SV=2 309 406 1.0E-09
sp|Q9LZM4|WAKLQ_ARATH Wall-associated receptor kinase-like 20 OS=Arabidopsis thaliana GN=WAKL20 PE=2 SV=1 306 417 1.0E-09
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 271 405 1.0E-09
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 268 411 1.0E-09
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 268 411 2.0E-09
sp|Q9S9M2|WAKLD_ARATH Wall-associated receptor kinase-like 4 OS=Arabidopsis thaliana GN=WAKL4 PE=2 SV=2 309 406 2.0E-09
sp|Q9LSV3|WAKLS_ARATH Putative wall-associated receptor kinase-like 16 OS=Arabidopsis thaliana GN=WAKL16 PE=3 SV=1 309 417 2.0E-09
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 268 407 2.0E-09
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 268 407 2.0E-09
sp|Q9FNE1|CRK42_ARATH Cysteine-rich receptor-like protein kinase 42 OS=Arabidopsis thaliana GN=CRK42 PE=2 SV=1 306 416 2.0E-09
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 268 407 2.0E-09
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 268 407 2.0E-09
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 268 405 2.0E-09
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 301 405 2.0E-09
sp|P46573|APK1B_ARATH Protein kinase APK1B, chloroplastic OS=Arabidopsis thaliana GN=APK1B PE=2 SV=2 285 407 2.0E-09
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 266 411 2.0E-09
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 268 405 2.0E-09
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 268 405 3.0E-09
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 301 405 3.0E-09
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 292 407 3.0E-09
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 285 416 3.0E-09
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 265 405 4.0E-09
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 268 412 4.0E-09
sp|Q9S9M1|WAKLE_ARATH Wall-associated receptor kinase-like 5 OS=Arabidopsis thaliana GN=WAKL5 PE=2 SV=2 309 406 4.0E-09
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 267 406 4.0E-09
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 269 420 4.0E-09
sp|O64483|SIRK_ARATH Senescence-induced receptor-like serine/threonine-protein kinase OS=Arabidopsis thaliana GN=SIRK PE=2 SV=1 300 406 4.0E-09
sp|Q9FID8|Y5900_ARATH Putative receptor-like protein kinase At5g39000 OS=Arabidopsis thaliana GN=At5g39000 PE=3 SV=1 267 406 4.0E-09
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 255 407 4.0E-09
sp|Q9S9M3|WAKLC_ARATH Wall-associated receptor kinase-like 3 OS=Arabidopsis thaliana GN=WAKL3 PE=2 SV=2 309 411 4.0E-09
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 301 405 4.0E-09
sp|Q22146|FRK1_CAEEL Fer-related kinase 1 OS=Caenorhabditis elegans GN=frk-1 PE=1 SV=1 302 413 4.0E-09
sp|Q8GXZ3|Y5102_ARATH Serine/threonine-protein kinase At5g01020 OS=Arabidopsis thaliana GN=At5g01020 PE=1 SV=1 306 406 4.0E-09
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 301 405 5.0E-09
sp|Q6XHA5|ROC11_DICDI Probable serine/threonine-protein kinase roco11 OS=Dictyostelium discoideum GN=roco11 PE=3 SV=1 263 407 5.0E-09
sp|C0LGG6|Y5189_ARATH Probable LRR receptor-like protein kinase At1g51890 OS=Arabidopsis thaliana GN=At1g51890 PE=2 SV=2 300 406 5.0E-09
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 301 405 5.0E-09
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 250 406 6.0E-09
sp|Q06548|APK1A_ARATH Protein kinase APK1A, chloroplastic OS=Arabidopsis thaliana GN=APK1A PE=2 SV=1 285 408 6.0E-09
sp|Q8GYF5|WAKLR_ARATH Wall-associated receptor kinase-like 21 OS=Arabidopsis thaliana GN=WAKL21 PE=2 SV=2 306 406 6.0E-09
sp|Q39202|RLK1_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 OS=Arabidopsis thaliana GN=RLK1 PE=2 SV=2 268 406 7.0E-09
sp|Q8BG48|ST17B_MOUSE Serine/threonine-protein kinase 17B OS=Mus musculus GN=Stk17b PE=1 SV=1 268 407 7.0E-09
sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2 OS=Arabidopsis thaliana GN=WAKL2 PE=2 SV=1 309 406 7.0E-09
sp|Q9S9M5|WAKLA_ARATH Wall-associated receptor kinase-like 1 OS=Arabidopsis thaliana GN=WAKL1 PE=2 SV=1 309 406 8.0E-09
sp|Q9LMN6|WAK4_ARATH Wall-associated receptor kinase 4 OS=Arabidopsis thaliana GN=WAK4 PE=2 SV=1 309 417 9.0E-09
sp|O01798|SPE8_CAEEL Spermatocyte protein spe-8 OS=Caenorhabditis elegans GN=spe-8 PE=1 SV=2 267 405 9.0E-09
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 301 405 9.0E-09
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 269 420 1.0E-08
sp|C0LGI2|Y1677_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g67720 OS=Arabidopsis thaliana GN=At1g67720 PE=2 SV=1 306 412 1.0E-08
sp|Q54TA1|DRKC_DICDI Probable serine/threonine-protein kinase drkC OS=Dictyostelium discoideum GN=drkC PE=3 SV=1 269 412 1.0E-08
sp|C0LGW2|PAM74_ARATH Probable LRR receptor-like serine/threonine-protein kinase PAM74 OS=Arabidopsis thaliana GN=PAM74 PE=2 SV=1 300 406 1.0E-08
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 268 411 1.0E-08
sp|O65924|Y2921_ARATH Putative leucine-rich repeat receptor-like protein kinase At2g19210 OS=Arabidopsis thaliana GN=At2g19210 PE=3 SV=1 300 406 1.0E-08
sp|A8R7E6|CERK1_ARATH Chitin elicitor receptor kinase 1 OS=Arabidopsis thaliana GN=CERK1 PE=1 SV=1 288 406 1.0E-08
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 285 405 1.0E-08
sp|Q54H45|DRKB_DICDI Probable serine/threonine-protein kinase drkB OS=Dictyostelium discoideum GN=drkB PE=3 SV=1 297 409 1.0E-08
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 268 411 1.0E-08
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 268 411 1.0E-08
sp|P43293|NAK_ARATH Probable serine/threonine-protein kinase NAK OS=Arabidopsis thaliana GN=NAK PE=1 SV=2 306 407 2.0E-08
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 306 420 2.0E-08
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 303 406 2.0E-08
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 269 409 2.0E-08
sp|Q39191|WAK1_ARATH Wall-associated receptor kinase 1 OS=Arabidopsis thaliana GN=WAK1 PE=1 SV=2 309 417 2.0E-08
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 250 406 2.0E-08
sp|Q9S7D9|ACCR1_ARATH Serine/threonine-protein kinase-like protein CCR1 OS=Arabidopsis thaliana GN=CCR1 PE=1 SV=1 268 413 2.0E-08
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 257 413 2.0E-08
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 302 406 2.0E-08
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 301 405 2.0E-08
sp|Q54P26|SAMKB_DICDI Probable serine/threonine-protein kinase samkB OS=Dictyostelium discoideum GN=samkB PE=3 SV=1 244 415 2.0E-08
sp|P27450|CX32_ARATH Probable serine/threonine-protein kinase Cx32, chloroplastic OS=Arabidopsis thaliana GN=At4g35600 PE=1 SV=2 304 416 2.0E-08
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 303 406 2.0E-08
sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 269 406 2.0E-08
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 269 405 2.0E-08
sp|Q9LMN8|WAK3_ARATH Wall-associated receptor kinase 3 OS=Arabidopsis thaliana GN=WAK3 PE=2 SV=2 309 417 2.0E-08
sp|C0LGQ7|Y4245_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20450 OS=Arabidopsis thaliana GN=At4g20450 PE=2 SV=1 300 406 3.0E-08
sp|A8X0C4|PAR4_CAEBR Serine/threonine-protein kinase par-4 OS=Caenorhabditis briggsae GN=par-4 PE=3 SV=2 264 407 3.0E-08
sp|A6ZU08|TOS3_YEAS7 Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOS3 PE=3 SV=1 270 405 3.0E-08
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 257 404 3.0E-08
sp|P43637|TOS3_YEAST Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS3 PE=1 SV=1 270 405 3.0E-08
sp|Q55DU7|GDT4_DICDI Probable serine/threonine-protein kinase gdt4 OS=Dictyostelium discoideum GN=gdt4 PE=3 SV=2 303 407 4.0E-08
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 266 406 4.0E-08
sp|Q54BF0|FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum GN=fhkA PE=3 SV=1 298 406 4.0E-08
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 268 405 4.0E-08
sp|Q9LFP7|Y5158_ARATH Probable receptor-like protein kinase At5g15080 OS=Arabidopsis thaliana GN=At5g15080 PE=2 SV=1 306 416 4.0E-08
sp|P83104|M3K7L_DROME Putative mitogen-activated protein kinase kinase kinase 7-like OS=Drosophila melanogaster GN=Takl1 PE=2 SV=1 304 417 4.0E-08
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 285 406 4.0E-08
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 302 406 5.0E-08
sp|Q95YD4|KIN32_CAEEL Inactive tyrosine-protein kinase kin-32 OS=Caenorhabditis elegans GN=kin-32 PE=1 SV=1 305 419 5.0E-08
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 264 407 5.0E-08
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 295 416 5.0E-08
sp|Q8QGV6|NLK2_XENLA Serine/threonine-protein kinase NLK2 OS=Xenopus laevis GN=nlk.2 PE=1 SV=1 272 411 5.0E-08
sp|Q9FN92|Y5597_ARATH Probable receptor-like protein kinase At5g59700 OS=Arabidopsis thaliana GN=At5g59700 PE=3 SV=1 267 406 5.0E-08
sp|Q54H46|DRKA_DICDI Probable serine/threonine-protein kinase drkA OS=Dictyostelium discoideum GN=drkA PE=3 SV=1 297 409 6.0E-08
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 285 404 6.0E-08
sp|Q9M342|WAKLP_ARATH Wall-associated receptor kinase-like 15 OS=Arabidopsis thaliana GN=WAKL15 PE=2 SV=2 267 412 6.0E-08
sp|Q9FII5|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR OS=Arabidopsis thaliana GN=TDR PE=1 SV=1 284 419 7.0E-08
sp|Q9U9Y8|NLK_CAEEL Serine/threonine kinase NLK OS=Caenorhabditis elegans GN=lit-1 PE=1 SV=1 272 406 7.0E-08
sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 265 411 7.0E-08
sp|B1H3E1|NLK2_XENTR Serine/threonine-protein kinase NLK2 OS=Xenopus tropicalis GN=nlk.2 PE=2 SV=1 272 411 7.0E-08
sp|O49840|APK2B_ARATH Protein kinase 2B, chloroplastic OS=Arabidopsis thaliana GN=APK2B PE=2 SV=1 306 416 8.0E-08
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 264 407 8.0E-08
sp|Q3SZJ2|RIPK2_BOVIN Receptor-interacting serine/threonine-protein kinase 2 OS=Bos taurus GN=RIPK2 PE=2 SV=1 263 406 8.0E-08
sp|Q9SRH7|Y3130_ARATH Receptor-like serine/threonine-protein kinase At3g01300 OS=Arabidopsis thaliana GN=At3g01300 PE=2 SV=1 306 416 8.0E-08
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 267 410 9.0E-08
sp|D3ZSZ3|NLK_RAT Serine/threonine-protein kinase NLK OS=Rattus norvegicus GN=Nlk PE=3 SV=1 272 411 9.0E-08
sp|O54949|NLK_MOUSE Serine/threonine-protein kinase NLK OS=Mus musculus GN=Nlk PE=1 SV=2 272 411 9.0E-08
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 303 408 9.0E-08
sp|Q9UBE8|NLK_HUMAN Serine/threonine-protein kinase NLK OS=Homo sapiens GN=NLK PE=1 SV=2 272 411 9.0E-08
sp|E2QWQ2|NLK_CANLF Serine/threonine-protein kinase NLK OS=Canis lupus familiaris GN=NLK PE=3 SV=1 272 411 9.0E-08
sp|E1BMN8|NLK_BOVIN Serine/threonine-protein kinase NLK OS=Bos taurus GN=NLK PE=3 SV=2 272 411 9.0E-08
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 267 407 1.0E-07
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 302 420 1.0E-07
sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 282 406 1.0E-07
sp|Q9CAH1|Y1725_ARATH Putative receptor-like protein kinase At1g72540 OS=Arabidopsis thaliana GN=At1g72540 PE=2 SV=1 309 411 1.0E-07
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 257 406 1.0E-07
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 303 408 1.0E-07
sp|Q90336|MK14A_CYPCA Mitogen-activated protein kinase 14A OS=Cyprinus carpio GN=mapk14a PE=1 SV=1 272 412 1.0E-07
sp|Q6EU49|WNK4_ORYSJ Probable serine/threonine-protein kinase WNK4 OS=Oryza sativa subsp. japonica GN=WNK4 PE=2 SV=1 266 405 1.0E-07
sp|Q8BZ03|KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus GN=Prkd2 PE=1 SV=1 302 406 1.0E-07
sp|Q5XIS9|KPCD2_RAT Serine/threonine-protein kinase D2 OS=Rattus norvegicus GN=Prkd2 PE=1 SV=1 302 406 1.0E-07
sp|Q9BZL6|KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens GN=PRKD2 PE=1 SV=2 302 406 1.0E-07
sp|Q8RY67|WAKLO_ARATH Wall-associated receptor kinase-like 14 OS=Arabidopsis thaliana GN=WAKL14 PE=2 SV=2 302 406 1.0E-07
sp|Q9UEE5|ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens GN=STK17A PE=1 SV=2 257 413 1.0E-07
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 269 405 1.0E-07
sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 258 410 2.0E-07
sp|P34314|TLK1_CAEEL Serine/threonine-protein kinase tousled-like 1 OS=Caenorhabditis elegans GN=tlk-1 PE=1 SV=3 269 417 2.0E-07
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 302 405 2.0E-07
sp|O80623|Y2393_ARATH Probable receptor-like protein kinase At2g39360 OS=Arabidopsis thaliana GN=At2g39360 PE=2 SV=1 303 410 2.0E-07
sp|Q9ASQ5|CRCK3_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 3 OS=Arabidopsis thaliana GN=CRCK3 PE=2 SV=1 303 411 2.0E-07
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 269 405 2.0E-07
sp|O43353|RIPK2_HUMAN Receptor-interacting serine/threonine-protein kinase 2 OS=Homo sapiens GN=RIPK2 PE=1 SV=2 263 406 2.0E-07
sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 301 410 2.0E-07
sp|Q9NLA1|FLR4_CAEEL Serine/threonine-protein kinase flr-4 OS=Caenorhabditis elegans GN=flr-4 PE=1 SV=1 310 407 2.0E-07
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 303 406 2.0E-07
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 272 406 2.0E-07
sp|P50526|SSP1_SCHPO Serine/threonine-protein kinase ssp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp1 PE=1 SV=1 302 405 2.0E-07
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 302 405 2.0E-07
sp|Q944Q0|WNK8_ARATH Serine/threonine-protein kinase WNK8 OS=Arabidopsis thaliana GN=WNK8 PE=1 SV=1 238 405 2.0E-07
sp|Q8H186|Y3545_ARATH Probable receptor-like protein kinase At3g55450 OS=Arabidopsis thaliana GN=At3g55450 PE=1 SV=1 306 407 2.0E-07
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 269 413 2.0E-07
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 251 406 2.0E-07
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 303 406 2.0E-07
sp|P18160|SPLA_DICDI Dual specificity protein kinase splA OS=Dictyostelium discoideum GN=splA PE=1 SV=3 267 406 2.0E-07
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 267 412 2.0E-07
sp|Q9SJT0|Y2214_ARATH Probable receptor-like protein kinase At2g21480 OS=Arabidopsis thaliana GN=At2g21480 PE=3 SV=1 306 417 2.0E-07
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 295 409 2.0E-07
sp|Q54HC6|ARKA_DICDI Ankyrin repeat-containing protein kinase A OS=Dictyostelium discoideum GN=arkA PE=1 SV=1 305 410 2.0E-07
sp|Q9LSL5|LRK92_ARATH L-type lectin-domain containing receptor kinase IX.2 OS=Arabidopsis thaliana GN=LECRK92 PE=2 SV=1 306 406 2.0E-07
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 268 406 3.0E-07
sp|Q55CZ1|GDT2_DICDI Probable serine/threonine-protein kinase gdt2 OS=Dictyostelium discoideum GN=gdt2 PE=2 SV=1 303 419 3.0E-07
sp|Q86HG9|Y9871_DICDI Probable serine/threonine-protein kinase DDB_G0271682 OS=Dictyostelium discoideum GN=DDB_G0271682 PE=3 SV=2 309 406 3.0E-07
sp|Q9GN62|PAR4_CAEEL Serine/threonine-protein kinase par-4 OS=Caenorhabditis elegans GN=par-4 PE=1 SV=2 267 407 3.0E-07
sp|O02812|MK14_CANLF Mitogen-activated protein kinase 14 OS=Canis lupus familiaris GN=MAPK14 PE=2 SV=3 272 412 3.0E-07
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 267 412 3.0E-07
sp|Q16539|MK14_HUMAN Mitogen-activated protein kinase 14 OS=Homo sapiens GN=MAPK14 PE=1 SV=3 272 412 3.0E-07
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 285 405 3.0E-07
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 301 405 3.0E-07
sp|Q95NE7|MK14_PANTR Mitogen-activated protein kinase 14 OS=Pan troglodytes GN=MAPK14 PE=2 SV=3 272 412 3.0E-07
sp|Q8RXE5|WNK10_ARATH Probable serine/threonine-protein kinase WNK10 OS=Arabidopsis thaliana GN=WNK10 PE=2 SV=1 266 405 3.0E-07
sp|Q09892|HOG1_SCHPO Mitogen-activated protein kinase sty1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sty1 PE=1 SV=1 272 415 3.0E-07
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 250 406 3.0E-07
sp|Q9DGE2|MK14A_DANRE Mitogen-activated protein kinase 14A OS=Danio rerio GN=mapk14a PE=1 SV=1 272 412 3.0E-07
sp|Q9UHD2|TBK1_HUMAN Serine/threonine-protein kinase TBK1 OS=Homo sapiens GN=TBK1 PE=1 SV=1 269 411 4.0E-07
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 296 407 4.0E-07
sp|P0C5E2|Y1839_ARATH Probable serine/threonine-protein kinase At1g18390 OS=Arabidopsis thaliana GN=At1g18390 PE=2 SV=2 267 406 4.0E-07
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 284 406 4.0E-07
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 286 410 4.0E-07
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 257 405 4.0E-07
sp|O94647|PPK24_SCHPO Serine/threonine-protein kinase ppk24, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk24 PE=1 SV=1 297 406 4.0E-07
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 272 409 4.0E-07
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 301 405 4.0E-07
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 269 405 4.0E-07
sp|Q9SJG9|MPK20_ARATH Mitogen-activated protein kinase 20 OS=Arabidopsis thaliana GN=MPK20 PE=1 SV=2 269 416 4.0E-07
sp|P24348|LET23_CAEEL Receptor tyrosine-protein kinase let-23 OS=Caenorhabditis elegans GN=let-23 PE=1 SV=3 305 406 5.0E-07
sp|Q9C5C0|MPK18_ARATH Mitogen-activated protein kinase 18 OS=Arabidopsis thaliana GN=MPK18 PE=1 SV=4 269 416 5.0E-07
sp|Q80XP9|WNK3_MOUSE Serine/threonine-protein kinase WNK3 OS=Mus musculus GN=Wnk3 PE=1 SV=3 268 405 5.0E-07
sp|Q9BYP7|WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens GN=WNK3 PE=1 SV=3 268 405 5.0E-07
sp|F1N9Y5|KSYK_CHICK Tyrosine-protein kinase SYK OS=Gallus gallus GN=SYK PE=1 SV=2 259 406 5.0E-07
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 303 406 5.0E-07
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 269 409 5.0E-07
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 301 405 5.0E-07
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 305 406 5.0E-07
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 296 407 6.0E-07
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 273 407 6.0E-07
sp|O02827|MYLK_SHEEP Myosin light chain kinase, smooth muscle (Fragment) OS=Ovis aries GN=MYLK PE=2 SV=1 279 414 6.0E-07
sp|Q8VYA3|WAKLJ_ARATH Wall-associated receptor kinase-like 10 OS=Arabidopsis thaliana GN=WAKL10 PE=2 SV=1 309 406 6.0E-07
sp|P23458|JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens GN=JAK1 PE=1 SV=2 303 411 6.0E-07
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 256 405 6.0E-07
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 301 405 6.0E-07
sp|Q9FX99|Y1497_ARATH Probable receptor-like protein kinase At1g49730 OS=Arabidopsis thaliana GN=At1g49730 PE=2 SV=1 305 410 6.0E-07
sp|P52332|JAK1_MOUSE Tyrosine-protein kinase JAK1 OS=Mus musculus GN=Jak1 PE=1 SV=1 303 411 6.0E-07
sp|Q9C9L5|WAKLH_ARATH Wall-associated receptor kinase-like 9 OS=Arabidopsis thaliana GN=WAKL9 PE=2 SV=1 245 406 6.0E-07
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 301 405 7.0E-07
sp|Q9T020|Y4391_ARATH Probable receptor-like protein kinase At4g39110 OS=Arabidopsis thaliana GN=At4g39110 PE=3 SV=1 303 417 7.0E-07
sp|Q9GM70|ST17A_RABIT Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus GN=STK17A PE=2 SV=1 257 413 7.0E-07
sp|Q62101|KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus GN=Prkd1 PE=1 SV=2 302 406 7.0E-07
sp|Q9WTQ1|KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus GN=Prkd1 PE=1 SV=2 302 406 7.0E-07
sp|Q9FN94|RLK7_ARATH Receptor-like protein kinase At5g59670 OS=Arabidopsis thaliana GN=At5g59670 PE=1 SV=1 303 411 7.0E-07
sp|Q15139|KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens GN=PRKD1 PE=1 SV=2 302 406 7.0E-07
sp|X5M5N0|WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans GN=wnk-1 PE=1 SV=1 268 405 7.0E-07
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 301 405 8.0E-07
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 301 405 8.0E-07
sp|Q5VP69|MPK16_ORYSJ Mitogen-activated protein kinase 16 OS=Oryza sativa subsp. japonica GN=MPK16 PE=2 SV=1 271 416 8.0E-07
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 286 410 8.0E-07
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 286 410 8.0E-07
sp|Q9HG11|MPKC_EMENI Mitogen-activated protein kinase mpkC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpkC PE=2 SV=2 272 406 8.0E-07
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 303 405 8.0E-07
sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 269 406 9.0E-07
sp|Q5SN53|MPK8_ORYSJ Mitogen-activated protein kinase 8 OS=Oryza sativa subsp. japonica GN=MPK8 PE=2 SV=2 269 416 9.0E-07
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 301 405 9.0E-07
sp|Q67C40|MPK7_ORYSJ Mitogen-activated protein kinase 7 OS=Oryza sativa subsp. japonica GN=MPK7 PE=2 SV=1 271 416 9.0E-07
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 267 410 9.0E-07
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 303 415 1.0E-06
sp|Q5VN19|MPK11_ORYSJ Mitogen-activated protein kinase 11 OS=Oryza sativa subsp. japonica GN=MPK11 PE=2 SV=2 269 416 1.0E-06
sp|Q621J7|ZYG1_CAEBR Probable serine/threonine-protein kinase zyg-1 OS=Caenorhabditis briggsae GN=zyg-1 PE=3 SV=1 286 405 1.0E-06
sp|Q8W4J2|MPK16_ARATH Mitogen-activated protein kinase 16 OS=Arabidopsis thaliana GN=MPK16 PE=2 SV=2 269 416 1.0E-06
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 286 410 1.0E-06
sp|Q9URT9|GSK31_SCHPO Protein kinase gsk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk31 PE=1 SV=1 269 406 1.0E-06
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 301 405 1.0E-06
sp|Q9N3Z3|CHK1_CAEEL Serine/threonine-protein kinase chk-1 OS=Caenorhabditis elegans GN=chk-1 PE=2 SV=2 310 405 1.0E-06
sp|A2QRF6|HOG1_ASPNC Mitogen-activated protein kinase hog1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hog1 PE=3 SV=2 272 415 1.0E-06
sp|A1CPG7|HOG1_ASPCL Mitogen-activated protein kinase hog1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hog1 PE=3 SV=1 272 415 1.0E-06
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 303 405 1.0E-06
sp|A1D2C9|HOG1_NEOFI Mitogen-activated protein kinase hog1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hog1 PE=3 SV=1 272 415 1.0E-06
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 257 410 1.0E-06
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 269 405 1.0E-06
sp|Q9LQQ8|RLCK7_ARATH Probable serine/threonine-protein kinase RLCKVII OS=Arabidopsis thaliana GN=At1g07870 PE=2 SV=1 315 406 1.0E-06
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 302 411 1.0E-06
sp|Q0D0P5|HOG1_ASPTN Mitogen-activated protein kinase hog1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hog1 PE=3 SV=2 272 415 1.0E-06
sp|Q9LM33|MPK8_ARATH Mitogen-activated protein kinase 8 OS=Arabidopsis thaliana GN=MPK8 PE=1 SV=2 271 416 1.0E-06
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 250 410 1.0E-06
sp|Q4WSF6|HOG1_ASPFU Mitogen-activated protein kinase hog1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hog1 PE=1 SV=1 272 415 1.0E-06
sp|Q1KTF2|HOG1_ZYMTI Mitogen-activated protein kinase Hog1 OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) GN=Hog1 PE=3 SV=2 272 415 1.0E-06
sp|Q9FN93|Y5596_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g59680 OS=Arabidopsis thaliana GN=At5g59680 PE=2 SV=1 300 406 1.0E-06
sp|A1IVT7|HOG1_BOTFB Mitogen-activated protein kinase hog1 OS=Botryotinia fuckeliana (strain B05.10) GN=hog1 PE=1 SV=1 272 415 1.0E-06
sp|Q9SKB2|SBIR1_ARATH Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR1 OS=Arabidopsis thaliana GN=SOBIR1 PE=1 SV=1 298 410 1.0E-06
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 286 410 1.0E-06
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 303 405 1.0E-06
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 269 411 1.0E-06
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 303 405 1.0E-06
sp|Q9DGE1|MK14B_DANRE Mitogen-activated protein kinase 14B OS=Danio rerio GN=mapk14b PE=1 SV=1 272 412 1.0E-06
sp|Q9I958|MK14B_CYPCA Mitogen-activated protein kinase 14B OS=Cyprinus carpio GN=mapk14b PE=1 SV=1 272 412 1.0E-06
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 290 410 1.0E-06
sp|O22187|Y2232_ARATH Probable receptor-like protein kinase At2g23200 OS=Arabidopsis thaliana GN=At2g23200 PE=3 SV=1 303 417 1.0E-06
sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 269 404 1.0E-06
sp|Q9ZQR3|Y2451_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14510 OS=Arabidopsis thaliana GN=At2g14510 PE=2 SV=1 300 406 1.0E-06
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 306 410 1.0E-06
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 302 407 2.0E-06
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 301 405 2.0E-06
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 269 405 2.0E-06
sp|Q9R0T8|IKKE_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Mus musculus GN=Ikbke PE=1 SV=2 269 413 2.0E-06
sp|P70600|FAK2_RAT Protein-tyrosine kinase 2-beta OS=Rattus norvegicus GN=Ptk2b PE=1 SV=1 302 418 2.0E-06
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 272 406 2.0E-06
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 298 405 2.0E-06
sp|P0CP68|HOG1_CRYNJ Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HOG1 PE=1 SV=1 272 415 2.0E-06
sp|Q56R42|HOG1_CRYNH Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=HOG1 PE=1 SV=1 272 415 2.0E-06
sp|P0CP69|HOG1_CRYNB Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HOG1 PE=3 SV=1 272 415 2.0E-06
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 302 407 2.0E-06
sp|Q9U6D2|JNK1_ANCCA Stress-activated protein kinase JNK-1 OS=Ancylostoma caninum GN=JNK-1 PE=2 SV=2 272 406 2.0E-06
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 250 410 2.0E-06
sp|Q6K5F8|CDKG1_ORYSJ Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. japonica GN=CDKG-1 PE=2 SV=1 229 417 2.0E-06
sp|Q52WX2|SBK1_HUMAN Serine/threonine-protein kinase SBK1 OS=Homo sapiens GN=SBK1 PE=2 SV=1 268 406 2.0E-06
sp|Q9FKG6|PUB52_ARATH U-box domain-containing protein 52 OS=Arabidopsis thaliana GN=PUB52 PE=2 SV=1 305 414 2.0E-06
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 269 407 2.0E-06
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 272 412 2.0E-06
sp|Q14289|FAK2_HUMAN Protein-tyrosine kinase 2-beta OS=Homo sapiens GN=PTK2B PE=1 SV=2 302 418 2.0E-06
sp|Q9FLJ8|Y5613_ARATH Probable receptor-like protein kinase At5g61350 OS=Arabidopsis thaliana GN=At5g61350 PE=2 SV=1 267 411 2.0E-06
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 272 412 2.0E-06
sp|Q9LMB9|CRK1_ARATH Cysteine-rich receptor-like protein kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=2 SV=2 306 411 2.0E-06
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 269 405 2.0E-06
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 269 407 2.0E-06
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 269 407 2.0E-06
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 305 407 2.0E-06
sp|C0LGG3|Y5182_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51820 OS=Arabidopsis thaliana GN=At1g51820 PE=2 SV=1 300 406 2.0E-06
sp|Q9LK43|TMK4_ARATH Receptor-like kinase TMK4 OS=Arabidopsis thaliana GN=TMK4 PE=1 SV=1 267 410 2.0E-06
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 269 414 2.0E-06
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 302 405 2.0E-06
sp|Q9QVP9|FAK2_MOUSE Protein-tyrosine kinase 2-beta OS=Mus musculus GN=Ptk2b PE=1 SV=2 302 418 2.0E-06
sp|Q15772|SPEG_HUMAN Striated muscle preferentially expressed protein kinase OS=Homo sapiens GN=SPEG PE=1 SV=4 268 407 2.0E-06
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 272 406 2.0E-06
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 301 405 2.0E-06
sp|Q2WFL5|HOG1_COCMI Mitogen-activated protein kinase HOG1 OS=Cochliobolus miyabeanus GN=HOG1 PE=3 SV=1 302 415 2.0E-06
sp|O08911|MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus GN=Mapk12 PE=1 SV=1 236 412 2.0E-06
sp|Q63638|SPEG_RAT Striated muscle-specific serine/threonine-protein kinase OS=Rattus norvegicus GN=Speg PE=1 SV=2 268 407 2.0E-06
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 259 406 2.0E-06
sp|Q14164|IKKE_HUMAN Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Homo sapiens GN=IKBKE PE=1 SV=1 269 413 2.0E-06
sp|C0LGD9|Y1756_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07560 OS=Arabidopsis thaliana GN=At1g07560 PE=2 SV=1 294 406 2.0E-06
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 301 405 2.0E-06
sp|Q0U4L8|HOG1_PHANO Mitogen-activated protein kinase HOG1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HOG1 PE=3 SV=2 302 415 2.0E-06
sp|A2X6X1|CDKG1_ORYSI Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. indica GN=CDKG-1 PE=3 SV=1 269 417 2.0E-06
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 302 415 2.0E-06
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 250 410 2.0E-06
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 269 405 2.0E-06
sp|Q4W6D3|HOG1_COCHE Mitogen-activated protein kinase HOG1 OS=Cochliobolus heterostrophus GN=HOG1 PE=1 SV=1 302 415 2.0E-06
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 272 412 2.0E-06
sp|Q0GGW5|STK11_CHICK Serine/threonine-protein kinase STK11 OS=Gallus gallus GN=STK11 PE=2 SV=1 303 406 2.0E-06
sp|Q63538|MK12_RAT Mitogen-activated protein kinase 12 OS=Rattus norvegicus GN=Mapk12 PE=1 SV=1 236 412 2.0E-06
sp|Q6PWX2|HOG1_BEABA Mitogen-activated protein kinase HOG1 OS=Beauveria bassiana GN=HOG1 PE=3 SV=1 302 415 2.0E-06
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 268 405 2.0E-06
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 254 406 3.0E-06
sp|P70618|MK14_RAT Mitogen-activated protein kinase 14 OS=Rattus norvegicus GN=Mapk14 PE=1 SV=3 272 412 3.0E-06
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 269 407 3.0E-06
sp|Q52PH6|HOG1_ALTBR Mitogen-activated protein kinase HOG1 OS=Alternaria brassicicola GN=HOG1 PE=3 SV=1 302 415 3.0E-06
sp|P47811|MK14_MOUSE Mitogen-activated protein kinase 14 OS=Mus musculus GN=Mapk14 PE=1 SV=3 272 412 3.0E-06
sp|Q32PP3|PDK1L_DANRE Serine/threonine-protein kinase pdik1l OS=Danio rerio GN=pdik1l PE=2 SV=1 332 406 3.0E-06
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 302 413 3.0E-06
sp|Q9SV05|CCR35_ARATH Serine/threonine-protein kinase-like protein At3g51990 OS=Arabidopsis thaliana GN=At3g51990 PE=2 SV=1 266 414 3.0E-06
sp|Q9SV83|Y4103_ARATH Probable receptor-like protein kinase At4g10390 OS=Arabidopsis thaliana GN=At4g10390 PE=2 SV=1 298 406 3.0E-06
sp|Q75Q66|HOG1_COLOR Mitogen-activated protein kinase HOG1 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=HOG1 PE=3 SV=1 302 415 3.0E-06
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 303 405 3.0E-06
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 269 407 3.0E-06
sp|Q96TL5|HOG1_NEUCR Mitogen-activated protein kinase hog-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hog-1 PE=1 SV=1 302 415 3.0E-06
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 272 412 3.0E-06
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 302 406 3.0E-06
sp|Q5I6M2|HOG1_SETTU Mitogen-activated protein kinase HOG1 OS=Setosphaeria turcica GN=HOG1 PE=2 SV=2 302 415 3.0E-06
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 269 407 3.0E-06
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 268 405 3.0E-06
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 268 405 3.0E-06
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 303 420 3.0E-06
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 269 413 3.0E-06
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 269 407 3.0E-06
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 267 404 3.0E-06
sp|Q2WGK3|HOG1_TRIHA Mitogen-activated protein kinase hog1 OS=Trichoderma harzianum GN=hog1 PE=1 SV=1 302 415 3.0E-06
sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus GN=Mylk PE=1 SV=2 269 406 3.0E-06
sp|Q9Z2P5|RIPK3_RAT Receptor-interacting serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Ripk3 PE=1 SV=3 267 405 3.0E-06
sp|Q875L0|HOG1_CRYPA Mitogen-activated protein kinase HOG1 OS=Cryphonectria parasitica GN=HOG1 PE=1 SV=1 302 415 3.0E-06
sp|Q4PNJ1|HOG1_FUSCU Mitogen-activated protein kinase HOG1 (Fragment) OS=Fusarium culmorum GN=HOG1 PE=3 SV=1 302 415 3.0E-06
sp|Q9Y572|RIPK3_HUMAN Receptor-interacting serine/threonine-protein kinase 3 OS=Homo sapiens GN=RIPK3 PE=1 SV=2 252 405 3.0E-06
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 269 405 3.0E-06
sp|Q9SCU5|WNK5_ARATH Probable serine/threonine-protein kinase WNK5 OS=Arabidopsis thaliana GN=WNK5 PE=1 SV=2 269 405 3.0E-06
sp|Q4PKS0|HOG1_GIBIN Mitogen-activated protein kinase HOG1 (Fragment) OS=Gibberella intermedia GN=HOG1 PE=3 SV=1 302 415 3.0E-06
sp|P43405|KSYK_HUMAN Tyrosine-protein kinase SYK OS=Homo sapiens GN=SYK PE=1 SV=1 303 411 4.0E-06
sp|Q6C7U0|ATG1_YARLI Serine/threonine-protein kinase ATG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG1 PE=3 SV=1 268 406 4.0E-06
sp|Q6L5D4|MPK9_ORYSJ Mitogen-activated protein kinase 9 OS=Oryza sativa subsp. japonica GN=MPK9 PE=3 SV=2 269 416 4.0E-06
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 268 413 4.0E-06
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 268 405 4.0E-06
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 303 407 4.0E-06
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 269 412 4.0E-06
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 267 406 4.0E-06
sp|Q86YV6|MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens GN=MYLK4 PE=1 SV=2 277 406 4.0E-06
sp|P53778|MK12_HUMAN Mitogen-activated protein kinase 12 OS=Homo sapiens GN=MAPK12 PE=1 SV=3 236 412 4.0E-06
sp|P19026|CDC21_PEA Cell division control protein 2 homolog 1 (Fragment) OS=Pisum sativum GN=CDC2 PE=2 SV=1 305 406 4.0E-06
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 269 404 4.0E-06
sp|Q9FHX3|LRKS6_ARATH L-type lectin-domain containing receptor kinase S.6 OS=Arabidopsis thaliana GN=LECRKS6 PE=2 SV=1 265 406 4.0E-06
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 305 406 4.0E-06
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 269 406 4.0E-06
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 269 407 4.0E-06
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 269 409 4.0E-06
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 263 406 4.0E-06
sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2 269 404 4.0E-06
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 287 410 4.0E-06
sp|Q9ZRF9|RPK1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RPK1 OS=Arabidopsis thaliana GN=RPK1 PE=1 SV=1 310 416 4.0E-06
sp|O13945|PPK9_SCHPO Protein kinase domain-containing protein ppk9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk9 PE=3 SV=1 300 405 4.0E-06
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 267 406 5.0E-06
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8 OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1 301 406 5.0E-06
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 267 406 5.0E-06
sp|Q15831|STK11_HUMAN Serine/threonine-protein kinase STK11 OS=Homo sapiens GN=STK11 PE=1 SV=1 303 406 5.0E-06
sp|Q8S8Y8|WNK6_ARATH Probable serine/threonine-protein kinase WNK6 OS=Arabidopsis thaliana GN=WNK6 PE=2 SV=1 269 405 5.0E-06
sp|Q3UIZ8|MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus GN=Mylk3 PE=1 SV=1 277 406 5.0E-06
sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3 301 406 5.0E-06
sp|E9PT87|MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus GN=Mylk3 PE=1 SV=1 277 406 5.0E-06
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 302 412 5.0E-06
sp|Q9FE20|PBS1_ARATH Serine/threonine-protein kinase PBS1 OS=Arabidopsis thaliana GN=PBS1 PE=1 SV=1 309 406 5.0E-06
sp|Q39024|MPK4_ARATH Mitogen-activated protein kinase 4 OS=Arabidopsis thaliana GN=MPK4 PE=1 SV=2 269 406 5.0E-06
sp|Q7RAV5|CDPK3_PLAYO Calcium-dependent protein kinase 3 OS=Plasmodium yoelii yoelii GN=CPK3 PE=3 SV=1 302 405 5.0E-06
sp|Q8NJT7|HOG1_HORWE Mitogen-activated protein kinase HOG1 OS=Hortaea werneckii GN=HOG1 PE=3 SV=1 302 415 5.0E-06
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 269 404 5.0E-06
sp|Q0WRY5|CDL1_ARATH Serine/threonine-protein kinase CDL1 OS=Arabidopsis thaliana GN=CDL1 PE=1 SV=1 309 406 5.0E-06
sp|A3EZ54|HOG1_WALSE Mitogen-activated protein kinase HOG1 (Fragment) OS=Wallemia sebi GN=HOG1 PE=3 SV=1 307 415 5.0E-06
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 301 405 5.0E-06
sp|P48025|KSYK_MOUSE Tyrosine-protein kinase SYK OS=Mus musculus GN=Syk PE=1 SV=2 303 411 5.0E-06
sp|Q6Z437|MPK3_ORYSJ Mitogen-activated protein kinase 3 OS=Oryza sativa subsp. japonica GN=MPK3 PE=2 SV=1 302 408 6.0E-06
sp|Q91604|STK11_XENLA Serine/threonine-protein kinase stk11 OS=Xenopus laevis GN=stk11 PE=1 SV=1 303 406 6.0E-06
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 295 410 6.0E-06
sp|C0LGL9|FEI2_ARATH LRR receptor-like serine/threonine-protein kinase FEI 2 OS=Arabidopsis thaliana GN=FEI2 PE=1 SV=1 303 411 6.0E-06
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 269 407 6.0E-06
sp|C0LGF4|FEI1_ARATH LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1 286 411 6.0E-06
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 303 411 6.0E-06
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 269 404 6.0E-06
sp|Q6L5F7|MPK17_ORYSJ Mitogen-activated protein kinase 17 OS=Oryza sativa subsp. japonica GN=MPK17 PE=2 SV=2 269 416 6.0E-06
sp|A3EZ53|HOG1_WALMU Mitogen-activated protein kinase HOG1 (Fragment) OS=Wallemia muriae GN=HOG1 PE=3 SV=1 307 415 6.0E-06
sp|P0C431|HOG1_GIBZE Mitogen-activated protein kinase HOG1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HOG1 PE=3 SV=1 302 415 6.0E-06
sp|Q54ET3|Y6373_DICDI Probable serine/threonine-protein kinase DDB_G0291350 OS=Dictyostelium discoideum GN=DDB_G0291350 PE=3 SV=1 266 391 7.0E-06
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 257 415 7.0E-06
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 258 405 7.0E-06
sp|Q9M8J5|M2K8_ARATH Mitogen-activated protein kinase kinase 8 OS=Arabidopsis thaliana GN=MKK8 PE=3 SV=2 269 406 7.0E-06
sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 267 414 7.0E-06
sp|Q9FZB8|Y5181_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51810 OS=Arabidopsis thaliana GN=At1g51810 PE=2 SV=1 300 406 7.0E-06
sp|Q6NKZ9|Y4345_ARATH Probable receptor-like serine/threonine-protein kinase At4g34500 OS=Arabidopsis thaliana GN=At4g34500 PE=2 SV=1 265 406 7.0E-06
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 302 413 7.0E-06
sp|Q5RB23|JAK2_PONAB Tyrosine-protein kinase JAK2 OS=Pongo abelii GN=JAK2 PE=2 SV=1 303 406 7.0E-06
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 268 412 7.0E-06
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 269 413 7.0E-06
sp|Q54WS5|ROCO6_DICDI Probable serine/threonine-protein kinase roco6 OS=Dictyostelium discoideum GN=roco6 PE=3 SV=1 303 405 7.0E-06
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 302 410 8.0E-06
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 303 405 8.0E-06
sp|Q00655|KSYK_PIG Tyrosine-protein kinase SYK OS=Sus scrofa GN=SYK PE=1 SV=1 303 411 8.0E-06
sp|A2QN07|MPKC_ASPNC Mitogen-activated protein kinase mpkC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mpkC PE=3 SV=1 272 406 8.0E-06
sp|P18106|FPS_DROME Tyrosine-protein kinase Fps85D OS=Drosophila melanogaster GN=Fps85D PE=2 SV=3 234 410 8.0E-06
sp|Q9UV51|HOG1_MAGO7 Mitogen-activated protein kinase HOG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HOG1 PE=3 SV=1 302 415 8.0E-06
sp|Q8GYQ5|MPK12_ARATH Mitogen-activated protein kinase 12 OS=Arabidopsis thaliana GN=MPK12 PE=1 SV=1 269 410 8.0E-06
sp|Q62120|JAK2_MOUSE Tyrosine-protein kinase JAK2 OS=Mus musculus GN=Jak2 PE=1 SV=2 303 406 8.0E-06
sp|Q62689|JAK2_RAT Tyrosine-protein kinase JAK2 OS=Rattus norvegicus GN=Jak2 PE=1 SV=1 303 406 8.0E-06
sp|Q2H332|HOG1_CHAGB Mitogen-activated protein kinase HOG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HOG1 PE=3 SV=1 302 415 8.0E-06
sp|O19064|JAK2_PIG Tyrosine-protein kinase JAK2 OS=Sus scrofa GN=JAK2 PE=2 SV=1 303 406 8.0E-06
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 305 406 8.0E-06
sp|O55047|TLK2_MOUSE Serine/threonine-protein kinase tousled-like 2 OS=Mus musculus GN=Tlk2 PE=1 SV=2 333 411 9.0E-06
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 305 406 9.0E-06
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 305 406 9.0E-06
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 305 406 9.0E-06
sp|Q8MXI4|PMK2_CAEEL Mitogen-activated protein kinase pmk-2 OS=Caenorhabditis elegans GN=pmk-2 PE=3 SV=1 269 415 9.0E-06
sp|Q702W0|HOG1_BLAAD Mitogen-activated protein kinase hog1 OS=Blastobotrys adeninivorans GN=hog1 PE=1 SV=1 264 415 9.0E-06
sp|Q1ECX4|TLK2_DANRE Serine/threonine-protein kinase tousled-like 2 OS=Danio rerio GN=tlk2 PE=2 SV=2 333 411 9.0E-06
sp|Q28DZ1|IKKA_XENTR Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Xenopus tropicalis GN=chuk PE=2 SV=1 295 407 9.0E-06
sp|Q5RDG7|MYLK3_PONAB Myosin light chain kinase 3 OS=Pongo abelii GN=MYLK3 PE=2 SV=3 232 406 1.0E-05
sp|Q9WTK7|STK11_MOUSE Serine/threonine-protein kinase STK11 OS=Mus musculus GN=Stk11 PE=1 SV=1 303 406 1.0E-05
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 269 407 1.0E-05
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 293 416 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7548
MHQDSTSSESSQNRSNTQGSMSSELARNRSNKRQDSTTMADPNLIACLYPADTNSRLGRALETVQMDENSSRYVP
PQVIRNDSSCSRESSQSLEEEEEGNDETPHYIYSEGLELRFDHPRRNRLGILLGKSSNCDIVLPKLESLKSASQY
QCVITFDNQDGTTVTYNDKGGFKRRGFTWILGGDKFFQETRKIFITFHNKLKFQIVVAPHDIHSDLHKEKVAQFR
RAVEASVDDLPVSGLGFQSLESTAAASGAETPRRDAILLDNGELDRGAQAVVTRVWDVSTGLEYASKKPLQMKYW
HRLKKEGNLLQQIRHDNVVRCIGLMEEPEPQLVLEYAPLGSLRMQAMEKPLSAEENLQLLLQGLSALKYLHGRQD
PIAHRDIKPDNILVQSRTPLHVKLSDFGFSKENQDDLKTGIQRGC*
Coding >Hirsu2|7548
ATGCATCAAGATTCGACGAGCTCTGAATCAAGTCAGAACCGATCTAACACACAAGGTTCGATGAGCTCTGAATTA
GCCAGGAACCGATCCAACAAGCGTCAAGATTCGACAACAATGGCGGACCCAAATCTAATAGCTTGCCTATACCCC
GCCGACACAAATTCTCGTCTTGGTCGTGCGTTGGAGACGGTTCAGATGGACGAGAACAGCTCACGATATGTCCCA
CCACAGGTCATCCGCAATGACTCTTCTTGCAGCCGGGAGTCGTCCCAGTCTCTCGAGGAGGAAGAGGAAGGAAAC
GATGAAACACCACACTACATTTACAGCGAAGGCCTTGAGCTCAGGTTTGACCACCCACGAAGGAACCGGCTCGGT
ATCCTTCTGGGAAAGAGTTCGAACTGCGACATTGTCCTGCCGAAGCTGGAAAGCTTGAAGTCCGCGAGTCAATAT
CAGTGCGTCATTACCTTCGACAACCAGGATGGAACTACCGTCACTTATAACGACAAAGGAGGGTTTAAACGCCGC
GGATTCACGTGGATCCTCGGCGGCGACAAGTTCTTTCAAGAGACCCGGAAAATTTTCATCACCTTCCATAACAAA
CTGAAGTTCCAGATCGTCGTCGCTCCCCACGACATCCATTCCGATCTGCATAAGGAGAAAGTCGCTCAATTCCGG
CGTGCAGTGGAAGCATCTGTGGATGACCTTCCTGTCAGCGGGCTCGGTTTTCAGAGCCTGGAATCGACGGCCGCA
GCCAGTGGAGCGGAGACGCCGAGAAGAGACGCTATCCTGCTTGACAATGGAGAGCTCGACAGAGGAGCTCAAGCG
GTGGTGACTCGAGTCTGGGATGTCAGCACCGGCCTTGAGTATGCTTCGAAAAAGCCCCTTCAAATGAAGTACTGG
CACCGGTTGAAGAAAGAGGGAAACCTCTTACAACAGATACGTCATGATAACGTCGTTCGATGCATTGGTTTGATG
GAGGAGCCAGAACCCCAATTGGTTCTCGAATACGCCCCTCTCGGCAGTCTCCGCATGCAAGCCATGGAGAAACCA
CTATCAGCCGAAGAAAACTTGCAGCTTCTCCTCCAGGGTCTTTCTGCGCTGAAATACCTTCACGGACGCCAAGAC
CCGATCGCACATCGTGACATCAAGCCTGACAATATCCTTGTTCAGTCACGAACCCCTCTACACGTCAAGCTATCG
GACTTTGGCTTCTCAAAAGAGAATCAAGACGATTTGAAAACAGGGATACAACGAGGCTGTTGA
Transcript >Hirsu2|7548
ATGCATCAAGATTCGACGAGCTCTGAATCAAGTCAGAACCGATCTAACACACAAGGTTCGATGAGCTCTGAATTA
GCCAGGAACCGATCCAACAAGCGTCAAGATTCGACAACAATGGCGGACCCAAATCTAATAGCTTGCCTATACCCC
GCCGACACAAATTCTCGTCTTGGTCGTGCGTTGGAGACGGTTCAGATGGACGAGAACAGCTCACGATATGTCCCA
CCACAGGTCATCCGCAATGACTCTTCTTGCAGCCGGGAGTCGTCCCAGTCTCTCGAGGAGGAAGAGGAAGGAAAC
GATGAAACACCACACTACATTTACAGCGAAGGCCTTGAGCTCAGGTTTGACCACCCACGAAGGAACCGGCTCGGT
ATCCTTCTGGGAAAGAGTTCGAACTGCGACATTGTCCTGCCGAAGCTGGAAAGCTTGAAGTCCGCGAGTCAATAT
CAGTGCGTCATTACCTTCGACAACCAGGATGGAACTACCGTCACTTATAACGACAAAGGAGGGTTTAAACGCCGC
GGATTCACGTGGATCCTCGGCGGCGACAAGTTCTTTCAAGAGACCCGGAAAATTTTCATCACCTTCCATAACAAA
CTGAAGTTCCAGATCGTCGTCGCTCCCCACGACATCCATTCCGATCTGCATAAGGAGAAAGTCGCTCAATTCCGG
CGTGCAGTGGAAGCATCTGTGGATGACCTTCCTGTCAGCGGGCTCGGTTTTCAGAGCCTGGAATCGACGGCCGCA
GCCAGTGGAGCGGAGACGCCGAGAAGAGACGCTATCCTGCTTGACAATGGAGAGCTCGACAGAGGAGCTCAAGCG
GTGGTGACTCGAGTCTGGGATGTCAGCACCGGCCTTGAGTATGCTTCGAAAAAGCCCCTTCAAATGAAGTACTGG
CACCGGTTGAAGAAAGAGGGAAACCTCTTACAACAGATACGTCATGATAACGTCGTTCGATGCATTGGTTTGATG
GAGGAGCCAGAACCCCAATTGGTTCTCGAATACGCCCCTCTCGGCAGTCTCCGCATGCAAGCCATGGAGAAACCA
CTATCAGCCGAAGAAAACTTGCAGCTTCTCCTCCAGGGTCTTTCTGCGCTGAAATACCTTCACGGACGCCAAGAC
CCGATCGCACATCGTGACATCAAGCCTGACAATATCCTTGTTCAGTCACGAACCCCTCTACACGTCAAGCTATCG
GACTTTGGCTTCTCAAAAGAGAATCAAGACGATTTGAAAACAGGGATACAACGAGGCTGTTGA
Gene >Hirsu2|7548
ATGCATCAAGATTCGACGAGCTCTGAATCAAGTCAGAACCGATCTAACACACAAGGTTCGATGAGCTCTGAATTA
GCCAGGAACCGATCCAACAAGCGTCAAGATTCGACAACAATGGCGGACCCAAATCTAATAGCTTGCCTATACCCC
GCCGACACAAATTCTCGTCTTGGTCGTGCGTTGGAGACGGTTCAGATGGACGAGAACAGCTCACGATATGTCCCA
CCACAGGTCATCCGCAATGACTCTTCTTGCAGCCGGGAGTCGTCCCAGTCTCTCGAGGAGGAAGAGGAAGGAAAC
GATGAAACACCACACTACATTTACAGCGAAGGCCTTGAGCTCAGGTTTGACCACCCACGAAGGAACCGGCTCGGT
ATCCTTCTGGGAAAGAGTTCGAACTGCGACATTGTCCTGCCGAAGCTGGAAAGCTTGAAGTCCGCGAGTCAATAT
CAGTGCGTCATTACCTTCGACAACCAGGGTAGGCTGATCCTGCGGGACTTGCGAGAACCTGGACAAAAGATGGAA
CTACCGTCACTTATAACGACAAAGGAGGGTTTAAACGCCGCGGATTCACGTGGATCCTCGGCGGCGACAAGTTCT
TTCAAGAGACCCGGAAAATTTTCATCACCTTCCATAACAAACTGAAGTTCCAGATCGTCGTCGCTCCCCACGACA
TCCATTCCGATCTGCATAAGGAGAAAGTCGCTCAATTCCGGCGTGCAGTGGAAGCATCTGTGGATGACCTTCCTG
TCAGCGGGCTCGGTTTTCAGAGCCTGGAATCGACGGCCGCAGCCAGTGGAGCGGAGACGCCGAGAAGAGACGCTA
TCCTGCTTGACAATGGAGAGCTCGACAGAGGAGCTCAAGCGGTGGTGACTCGAGTCTGGGATGTCAGCACCGGCC
TTGAGTATGCTTCGAAAAAGCCCCTTCAAATGAAGTACTGGCACCGGTTGAAGAAAGAGGGAAACCTCTTACAAC
AGATACGTCATGTAAGTCAATCACGATAATCTGCGTAACCCTTTCTAACATATGCACTAGGATAACGTCGTTCGA
TGCATTGGTTTGATGGAGGAGCCAGAACCCCAATTGGTTCTCGAATACGCCCCTCTCGGCAGTCTCCGCATGCAA
GCCATGGAGAAACCACTATCAGCCGAAGAAAACTTGCAGCTTCTCCTCCAGGGTCTTTCTGCGCTGAAATACCTT
CACGGACGCCAAGACCCGATCGCACATCGTGACATCAAGCCTGACAATATCCTTGTTCAGTCACGAACCCCTCTA
CACGTCAAGCTATCGGACTTTGGCTTCTCAAAAGAGAATCAAGACGATTTGAAAACAGGGGTCGGGACACAGCGC
TACATTGCCCCCGAGATCTACACGGGAGAAAGATACAACGAGGCTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail