Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7545
Gene name
LocationContig_444:16593..17599
Strand-
Gene length (bp)1006
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain 2.5E-33 48 154
PF13534 Fer4_17 4Fe-4S dicluster domain 1.2E-08 191 264
PF13237 Fer4_10 4Fe-4S dicluster domain 3.7E-08 191 260
PF13183 Fer4_8 4Fe-4S dicluster domain 1.3E-07 189 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42772|SDHB_ZYMTR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Zymoseptoria tritici GN=SDH2 PE=3 SV=1 44 278 1.0E-148
sp|Q75CI4|SDHB_ASHGO Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SDH2 PE=3 SV=1 38 279 6.0E-136
sp|P32420|SDHB_USTMA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SDH2 PE=3 SV=1 12 280 1.0E-134
sp|Q6FWS8|SDHB_CANGA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SDH2 PE=3 SV=1 28 278 6.0E-132
sp|Q70KF8|SDHB_UROFA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Uromyces fabae GN=SDH2 PE=3 SV=1 30 277 4.0E-130
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42772|SDHB_ZYMTR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Zymoseptoria tritici GN=SDH2 PE=3 SV=1 44 278 1.0E-148
sp|Q75CI4|SDHB_ASHGO Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SDH2 PE=3 SV=1 38 279 6.0E-136
sp|P32420|SDHB_USTMA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SDH2 PE=3 SV=1 12 280 1.0E-134
sp|Q6FWS8|SDHB_CANGA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SDH2 PE=3 SV=1 28 278 6.0E-132
sp|Q70KF8|SDHB_UROFA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Uromyces fabae GN=SDH2 PE=3 SV=1 30 277 4.0E-130
sp|P21801|SDHB_YEAST Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH2 PE=1 SV=1 45 279 2.0E-129
sp|Q3B8J8|SDHB_XENLA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Xenopus laevis GN=sdhb PE=2 SV=1 45 278 1.0E-127
sp|P21911|SDHB_SCHPO Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh2 PE=3 SV=3 28 277 2.0E-127
sp|P21914|SDHB_DROME Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Drosophila melanogaster GN=SdhB PE=2 SV=2 11 277 1.0E-126
sp|Q9YHT2|SDHB_CHICK Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Gallus gallus GN=SDHB PE=1 SV=1 19 277 2.0E-126
sp|A5PL98|SDHB_DANRE Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Danio rerio GN=sdhb PE=2 SV=1 45 277 2.0E-126
sp|B0BM36|SDHB_XENTR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Xenopus tropicalis GN=sdhb PE=2 SV=1 45 277 7.0E-126
sp|P21913|SDHB_RAT Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Rattus norvegicus GN=Sdhb PE=2 SV=2 45 277 3.0E-125
sp|Q9CQA3|SDHB_MOUSE Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Mus musculus GN=Sdhb PE=1 SV=1 22 277 2.0E-124
sp|P21912|SDHB_HUMAN Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Homo sapiens GN=SDHB PE=1 SV=3 36 277 7.0E-123
sp|Q3T189|SDHB_BOVIN Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Bos taurus GN=SDHB PE=2 SV=1 22 277 9.0E-123
sp|Q007T0|SDHB_PIG Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Sus scrofa GN=SDHB PE=1 SV=1 36 277 7.0E-121
sp|Q8LB02|SDHB2_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial OS=Arabidopsis thaliana GN=SDH2-2 PE=1 SV=2 10 279 2.0E-115
sp|Q8LBZ7|SDHB1_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial OS=Arabidopsis thaliana GN=SDH2-1 PE=1 SV=2 10 274 2.0E-115
sp|Q1RGP3|SDHB_RICBR Succinate dehydrogenase iron-sulfur subunit OS=Rickettsia bellii (strain RML369-C) GN=sdhB PE=3 SV=1 44 277 9.0E-115
sp|Q09545|SDHB_CAEEL Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Caenorhabditis elegans GN=sdhb-1 PE=2 SV=1 44 273 2.0E-114
sp|Q59662|SDHB_PARDE Succinate dehydrogenase iron-sulfur subunit OS=Paracoccus denitrificans GN=sdhB PE=3 SV=1 44 277 9.0E-114
sp|A8WPF0|SDHB_CAEBR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Caenorhabditis briggsae GN=sdhb-1 PE=3 SV=2 44 273 3.0E-113
sp|Q68XS0|SDHB_RICTY Succinate dehydrogenase iron-sulfur subunit OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sdhB PE=3 SV=1 33 277 1.0E-112
sp|Q9ZEA1|SDHB_RICPR Succinate dehydrogenase iron-sulfur subunit OS=Rickettsia prowazekii (strain Madrid E) GN=sdhB PE=3 SV=1 32 277 4.0E-112
sp|Q4UN71|SDHB_RICFE Succinate dehydrogenase iron-sulfur subunit OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sdhB PE=3 SV=1 32 277 6.0E-112
sp|Q92JJ8|SDHB_RICCN Succinate dehydrogenase iron-sulfur subunit OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sdhB PE=3 SV=1 32 277 8.0E-112
sp|P80480|SDHB_RECAM Succinate dehydrogenase [ubiquinone] iron-sulfur subunit OS=Reclinomonas americana GN=SDH2 PE=3 SV=1 43 278 2.0E-110
sp|Q55CC2|SDHB_DICDI Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Dictyostelium discoideum GN=sdhB PE=3 SV=1 16 277 4.0E-107
sp|Q9S827|SDHB1_ORYSJ Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial OS=Oryza sativa subsp. japonica GN=SDH2-1 PE=1 SV=1 44 274 1.0E-104
sp|Q9FJP9|SDHB3_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial OS=Arabidopsis thaliana GN=SDH2-3 PE=1 SV=1 47 278 8.0E-102
sp|P48933|SDHB_CYACA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit OS=Cyanidium caldarium GN=SDH2 PE=3 SV=1 44 276 2.0E-100
sp|P48932|SDHB_CHOCR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit OS=Chondrus crispus GN=SDH2 PE=3 SV=1 47 276 5.0E-98
sp|P80477|SDHB_PORPU Succinate dehydrogenase [ubiquinone] iron-sulfur subunit OS=Porphyra purpurea GN=SDH2 PE=3 SV=1 45 276 8.0E-96
sp|Q6H4G3|SDHB2_ORYSJ Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial OS=Oryza sativa subsp. japonica GN=SDH2-2 PE=1 SV=1 46 279 8.0E-94
sp|Q8ZQU2|SDHB_SALTY Succinate dehydrogenase iron-sulfur subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sdhB PE=3 SV=2 49 276 1.0E-82
sp|P07014|SDHB_ECOLI Succinate dehydrogenase iron-sulfur subunit OS=Escherichia coli (strain K12) GN=sdhB PE=1 SV=1 49 276 2.0E-82
sp|P51053|SDHB_COXBU Succinate dehydrogenase iron-sulfur subunit OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=sdhB PE=3 SV=1 48 276 3.0E-66
sp|P9WN89|FRDB_MYCTU Fumarate reductase iron-sulfur subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=frdB PE=1 SV=1 48 280 1.0E-40
sp|P9WN88|FRDB_MYCTO Fumarate reductase iron-sulfur subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=frdB PE=3 SV=1 48 280 1.0E-40
sp|P44893|FRDB_HAEIN Fumarate reductase iron-sulfur subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=frdB PE=3 SV=1 43 277 2.0E-38
sp|P0AC50|FRDB_SHIFL Fumarate reductase iron-sulfur subunit OS=Shigella flexneri GN=frdB PE=3 SV=2 44 275 1.0E-34
sp|P0AC47|FRDB_ECOLI Fumarate reductase iron-sulfur subunit OS=Escherichia coli (strain K12) GN=frdB PE=1 SV=2 44 275 1.0E-34
sp|P0AC48|FRDB_ECOL6 Fumarate reductase iron-sulfur subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=frdB PE=3 SV=2 44 275 1.0E-34
sp|P0AC49|FRDB_ECO57 Fumarate reductase iron-sulfur subunit OS=Escherichia coli O157:H7 GN=frdB PE=3 SV=2 44 275 1.0E-34
sp|P20921|FRDB_PROVU Fumarate reductase iron-sulfur subunit OS=Proteus vulgaris GN=frdB PE=3 SV=2 49 277 2.0E-33
sp|P17596|FRDB_WOLSU Fumarate reductase iron-sulfur subunit OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=frdB PE=1 SV=1 44 277 1.0E-27
sp|D9PUX5|TFRB_METTM Fumarate reductase (CoM/CoB) subunit B OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=tfrB PE=1 SV=1 46 273 6.0E-26
sp|O06914|FRDB_HELPY Fumarate reductase iron-sulfur subunit OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=frdB PE=3 SV=2 50 276 8.0E-25
sp|Q9ZMP1|FRDB_HELPJ Fumarate reductase iron-sulfur subunit OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=frdB PE=3 SV=1 50 276 1.0E-24
sp|Q6LYC4|Y1067_METMP Uncharacterized iron-sulfur protein MMP1067 OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1067 PE=3 SV=1 65 264 8.0E-23
sp|Q57557|Y092_METJA Uncharacterized iron-sulfur protein MJ0092 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0092 PE=3 SV=1 46 264 2.0E-21
sp|P08066|SDHB_BACSU Succinate dehydrogenase iron-sulfur subunit OS=Bacillus subtilis (strain 168) GN=sdhB PE=3 SV=3 84 280 5.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0009055 electron transfer activity Yes
GO:0016491 oxidoreductase activity No
GO:0048037 cofactor binding No
GO:0051540 metal cluster binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7545
MAALRSSSTRILGSAAHTALRPGAVLPRRMASVSDAPAEQAPQSQMKTFQIYRWNPDTPTEKPRMQSYTLDLKKT
GPMVLDALIRIKNELDPTLTFRRSCREGICGSCAMNINGQNTLACLCRIPTESSSEVKLYPLPHTYVVKDLVPDL
THFYKQYKSIKPYLQRETPAPDGKEYRQSKEDRRKLDGLYECILCACCSTSCPSYWWNSEEYLGPAILLQSYRWL
ADSRDERKAERKSNLENSMSLYRCHTILNCTRACPKGLNPGKAIAEIKKQMALGA*
Coding >Hirsu2|7545
ATGGCCGCTCTCCGCTCCTCGTCGACCCGGATCCTCGGCTCGGCCGCCCATACGGCGCTGCGGCCCGGCGCCGTG
CTGCCGCGCCGCATGGCGTCGGTCAGCGATGCGCCGGCCGAGCAGGCGCCGCAGTCGCAGATGAAGACGTTCCAG
ATCTACCGATGGAACCCGGACACGCCGACCGAGAAGCCGCGCATGCAGTCGTACACGCTCGACCTCAAGAAGACG
GGCCCGATGGTGCTGGACGCGCTGATCCGCATCAAGAACGAGCTGGACCCGACGCTGACGTTCCGGAGGAGCTGC
CGCGAGGGCATCTGCGGGAGCTGCGCCATGAACATCAACGGCCAAAACACGCTGGCCTGCCTGTGCCGAATCCCC
ACCGAGTCGTCGTCCGAGGTCAAGCTGTACCCGTTGCCTCACACGTACGTCGTCAAGGACCTCGTGCCCGACTTG
ACGCACTTCTACAAGCAATACAAGTCCATCAAGCCCTACCTCCAGCGGGAGACGCCGGCGCCCGATGGCAAGGAG
TATCGCCAGTCCAAGGAGGACCGCCGCAAGCTGGACGGCCTGTACGAGTGCATCCTGTGCGCCTGCTGCTCGACC
TCGTGCCCGTCGTACTGGTGGAATTCGGAGGAGTACCTCGGGCCGGCCATCCTGCTGCAGTCGTACCGCTGGCTG
GCCGACTCGCGCGACGAGCGCAAGGCCGAGCGCAAGTCCAACCTGGAGAACTCGATGAGCCTGTACCGCTGCCAC
ACCATCCTCAACTGCACACGCGCCTGCCCCAAGGGCCTCAACCCGGGCAAGGCCATTGCCGAGATTAAGAAGCAA
ATGGCCCTCGGCGCATAG
Transcript >Hirsu2|7545
ATGGCCGCTCTCCGCTCCTCGTCGACCCGGATCCTCGGCTCGGCCGCCCATACGGCGCTGCGGCCCGGCGCCGTG
CTGCCGCGCCGCATGGCGTCGGTCAGCGATGCGCCGGCCGAGCAGGCGCCGCAGTCGCAGATGAAGACGTTCCAG
ATCTACCGATGGAACCCGGACACGCCGACCGAGAAGCCGCGCATGCAGTCGTACACGCTCGACCTCAAGAAGACG
GGCCCGATGGTGCTGGACGCGCTGATCCGCATCAAGAACGAGCTGGACCCGACGCTGACGTTCCGGAGGAGCTGC
CGCGAGGGCATCTGCGGGAGCTGCGCCATGAACATCAACGGCCAAAACACGCTGGCCTGCCTGTGCCGAATCCCC
ACCGAGTCGTCGTCCGAGGTCAAGCTGTACCCGTTGCCTCACACGTACGTCGTCAAGGACCTCGTGCCCGACTTG
ACGCACTTCTACAAGCAATACAAGTCCATCAAGCCCTACCTCCAGCGGGAGACGCCGGCGCCCGATGGCAAGGAG
TATCGCCAGTCCAAGGAGGACCGCCGCAAGCTGGACGGCCTGTACGAGTGCATCCTGTGCGCCTGCTGCTCGACC
TCGTGCCCGTCGTACTGGTGGAATTCGGAGGAGTACCTCGGGCCGGCCATCCTGCTGCAGTCGTACCGCTGGCTG
GCCGACTCGCGCGACGAGCGCAAGGCCGAGCGCAAGTCCAACCTGGAGAACTCGATGAGCCTGTACCGCTGCCAC
ACCATCCTCAACTGCACACGCGCCTGCCCCAAGGGCCTCAACCCGGGCAAGGCCATTGCCGAGATTAAGAAGCAA
ATGGCCCTCGGCGCATAG
Gene >Hirsu2|7545
ATGGCCGCTCTCCGCTCCTCGTCGACCCGGATCCTCGGCTCGGCCGCCCATACGGCGCTGCGGCCCGGCGCCGTG
CTGCCGCGCCGCATGGCGTCGGTCAGCGATGCGCCGGCCGAGCAGGCGCCGCAGTCGCAGATGAAGACGTTCCAG
ATCTACCGATGGAACCCGGACACGCCGACCGAGAAGCCGCGCATGCAGTCGTACACGCTCGACCTCAAGAAGACG
GGCCCGATGGTGCTGGACGCGCTGATCCGCATCAAGAACGAGCTGGACCCGACGCTGACGTTCCGGAGGAGCTGC
CGCGAGGGCATCTGCGGGAGCTGCGCCATGAACATCAACGGCCAAAACACGCTGGCCTGCCTGTGTACGTGTCCA
CCCACCGCCCCTCCTTGAAGCTGCCTCCTCCCCTCCCTCATGATCAACGTCTGCGTCCTGACGACAAAGGAAGAC
GGCGCCTAACACTTTCTTTCTGGCCAGGCCGAATCCCCACCGAGTCGTCGTCCGAGGTCAAGCTGTACCCGTTGC
CTCACACGTACGTCGTCAAGGACCTCGTGCCCGACTTGACGCACTTCTACAAGCAATACAAGTCCATCAAGCCCT
ACCTCCAGCGGGAGACGCCGGCGCCCGATGTAGGTTGAATGCCCGAGACGCCGGGCGCGCGAGGCTGACGGCGGA
GCAGGGCAAGGAGTATCGCCAGTCCAAGGAGGACCGCCGCAAGCTGGACGGCCTGTACGAGTGCATCCTGTGCGC
CTGCTGCTCGACCTCGTGCCCGTCGTACTGGTGGAATTCGGAGGAGTACCTCGGGCCGGCCATCCTGCTGCAGTC
GTACCGCTGGCTGGCCGACTCGCGCGACGAGCGCAAGGCCGAGCGCAAGTCCAACCTGGAGAACTCGATGAGCCT
GTACCGCTGCCACACCATCCTCAACTGCACACGCGCCTGCCCCAAGGGCCTCAACCCGGGCAAGGCCATTGCCGA
GATTAAGAAGCAAATGGCCCTCGGCGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail