Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7543
Gene name
LocationContig_444:13469..14386
Strand-
Gene length (bp)917
Transcript length (bp)708
Coding sequence length (bp)708
Protein length (aa) 236

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1X159|FP1V2_PERVI Foot protein 1 variant 2 OS=Perna viridis GN=fp-1 PE=1 SV=1 54 229 1.0E-23
sp|A1X158|FP1V1_PERVI Foot protein 1 variant 1 OS=Perna viridis GN=fp-1 PE=1 SV=1 14 229 9.0E-23
sp|A1X159|FP1V2_PERVI Foot protein 1 variant 2 OS=Perna viridis GN=fp-1 PE=1 SV=1 32 233 1.0E-22
sp|A1X158|FP1V1_PERVI Foot protein 1 variant 1 OS=Perna viridis GN=fp-1 PE=1 SV=1 17 229 1.0E-21
sp|A1X158|FP1V1_PERVI Foot protein 1 variant 1 OS=Perna viridis GN=fp-1 PE=1 SV=1 71 233 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1X159|FP1V2_PERVI Foot protein 1 variant 2 OS=Perna viridis GN=fp-1 PE=1 SV=1 54 229 1.0E-23
sp|A1X158|FP1V1_PERVI Foot protein 1 variant 1 OS=Perna viridis GN=fp-1 PE=1 SV=1 14 229 9.0E-23
sp|A1X159|FP1V2_PERVI Foot protein 1 variant 2 OS=Perna viridis GN=fp-1 PE=1 SV=1 32 233 1.0E-22
sp|A1X158|FP1V1_PERVI Foot protein 1 variant 1 OS=Perna viridis GN=fp-1 PE=1 SV=1 17 229 1.0E-21
sp|A1X158|FP1V1_PERVI Foot protein 1 variant 1 OS=Perna viridis GN=fp-1 PE=1 SV=1 71 233 2.0E-21
sp|A1X158|FP1V1_PERVI Foot protein 1 variant 1 OS=Perna viridis GN=fp-1 PE=1 SV=1 62 233 2.0E-21
sp|A1X159|FP1V2_PERVI Foot protein 1 variant 2 OS=Perna viridis GN=fp-1 PE=1 SV=1 71 229 6.0E-21
sp|A1X159|FP1V2_PERVI Foot protein 1 variant 2 OS=Perna viridis GN=fp-1 PE=1 SV=1 71 229 1.0E-20
sp|A1X158|FP1V1_PERVI Foot protein 1 variant 1 OS=Perna viridis GN=fp-1 PE=1 SV=1 71 229 3.0E-20
sp|A1X158|FP1V1_PERVI Foot protein 1 variant 1 OS=Perna viridis GN=fp-1 PE=1 SV=1 71 229 3.0E-19
sp|A1X158|FP1V1_PERVI Foot protein 1 variant 1 OS=Perna viridis GN=fp-1 PE=1 SV=1 32 233 2.0E-18
sp|A1X159|FP1V2_PERVI Foot protein 1 variant 2 OS=Perna viridis GN=fp-1 PE=1 SV=1 17 219 1.0E-16
sp|P0C6X2|R1AB_CVHN1 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N1) GN=rep PE=3 SV=1 33 228 3.0E-15
sp|P0C6U3|R1A_CVHN1 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N1) GN=1a PE=1 SV=1 33 228 3.0E-15
sp|A1X158|FP1V1_PERVI Foot protein 1 variant 1 OS=Perna viridis GN=fp-1 PE=1 SV=1 71 209 3.0E-14
sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N2) GN=1a PE=3 SV=1 33 203 2.0E-11
sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N2) GN=rep PE=3 SV=1 33 203 2.0E-11
sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N2) GN=1a PE=3 SV=1 87 226 4.0E-11
sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N2) GN=rep PE=3 SV=1 87 226 4.0E-11
sp|P0C6U4|R1A_CVHN2 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N2) GN=1a PE=3 SV=1 84 229 9.0E-11
sp|P0C6X3|R1AB_CVHN2 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N2) GN=rep PE=3 SV=1 84 229 1.0E-10
sp|P0C6U5|R1A_CVHN5 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N5) GN=1a PE=3 SV=1 87 213 7.0E-09
sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N5) GN=rep PE=3 SV=1 87 213 7.0E-09
sp|P0C6U5|R1A_CVHN5 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N5) GN=1a PE=3 SV=1 84 203 1.0E-08
sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N5) GN=rep PE=3 SV=1 84 203 1.0E-08
sp|P0C6U5|R1A_CVHN5 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N5) GN=1a PE=3 SV=1 77 193 2.0E-08
sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N5) GN=rep PE=3 SV=1 77 193 2.0E-08
sp|P0C6U5|R1A_CVHN5 Replicase polyprotein 1a OS=Human coronavirus HKU1 (isolate N5) GN=1a PE=3 SV=1 33 183 2.0E-06
sp|P0C6X4|R1AB_CVHN5 Replicase polyprotein 1ab OS=Human coronavirus HKU1 (isolate N5) GN=rep PE=3 SV=1 33 183 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7543
MQATATLVLAFAGVVAAAPRPGRNDCGTPYGRCYNAVETPEAAVVARATQSVATSMLPPKPTSLVGDDGWMTLWK
QDDDKMTALKSDDGVKTAWKDDDGVMTAWKRAEDGVMTAWKGDDGVMTAWKDDDGVMTAWKQDDGVMTAWNDDDG
VMTAWKEDDGVMTAWKRADDGDDGVMTALKEDDGVMTALKEDDGVMTAWKQDDGVMTAWKSDDGVMTAWKSDDGV
MTAWAPQPTQ*
Coding >Hirsu2|7543
ATGCAGGCCACTGCCACGCTTGTCTTGGCCTTCGCCGGCGTCGTCGCCGCCGCGCCCCGGCCCGGCCGCAACGAC
TGCGGAACGCCCTATGGAAGGTGCTACAACGCCGTCGAGACTCCCGAGGCTGCCGTCGTCGCCCGCGCGACCCAG
TCCGTCGCCACCTCGATGCTGCCTCCTAAGCCCACCAGCCTGGTGGGAGACGACGGCTGGATGACGCTGTGGAAG
CAGGACGACGACAAGATGACAGCCCTGAAGTCGGACGATGGAGTCAAGACTGCCTGGAAGGACGACGACGGTGTC
ATGACGGCCTGGAAGAGGGCCGAAGATGGCGTCATGACTGCCTGGAAGGGCGACGACGGTGTCATGACGGCCTGG
AAGGACGACGACGGTGTCATGACGGCCTGGAAGCAAGACGACGGTGTCATGACTGCCTGGAACGACGACGACGGT
GTCATGACAGCCTGGAAGGAGGACGATGGTGTCATGACCGCCTGGAAGAGGGCCGACGACGGTGACGACGGCGTC
ATGACTGCCTTGAAGGAGGACGACGGTGTCATGACTGCCTTGAAGGAGGACGACGGCGTCATGACGGCCTGGAAG
CAGGACGACGGTGTCATGACCGCCTGGAAGAGCGACGACGGTGTCATGACCGCCTGGAAGAGCGACGACGGCGTC
ATGACCGCCTGGGCTCCCCAGCCGACCCAGTGA
Transcript >Hirsu2|7543
ATGCAGGCCACTGCCACGCTTGTCTTGGCCTTCGCCGGCGTCGTCGCCGCCGCGCCCCGGCCCGGCCGCAACGAC
TGCGGAACGCCCTATGGAAGGTGCTACAACGCCGTCGAGACTCCCGAGGCTGCCGTCGTCGCCCGCGCGACCCAG
TCCGTCGCCACCTCGATGCTGCCTCCTAAGCCCACCAGCCTGGTGGGAGACGACGGCTGGATGACGCTGTGGAAG
CAGGACGACGACAAGATGACAGCCCTGAAGTCGGACGATGGAGTCAAGACTGCCTGGAAGGACGACGACGGTGTC
ATGACGGCCTGGAAGAGGGCCGAAGATGGCGTCATGACTGCCTGGAAGGGCGACGACGGTGTCATGACGGCCTGG
AAGGACGACGACGGTGTCATGACGGCCTGGAAGCAAGACGACGGTGTCATGACTGCCTGGAACGACGACGACGGT
GTCATGACAGCCTGGAAGGAGGACGATGGTGTCATGACCGCCTGGAAGAGGGCCGACGACGGTGACGACGGCGTC
ATGACTGCCTTGAAGGAGGACGACGGTGTCATGACTGCCTTGAAGGAGGACGACGGCGTCATGACGGCCTGGAAG
CAGGACGACGGTGTCATGACCGCCTGGAAGAGCGACGACGGTGTCATGACCGCCTGGAAGAGCGACGACGGCGTC
ATGACCGCCTGGGCTCCCCAGCCGACCCAGTGA
Gene >Hirsu2|7543
ATGCAGGCCACTGCCACGCTTGTCTTGGCCTTCGCCGGCGTCGTCGCCGCCGCGCCCCGGCCCGGCCGCAACGAC
TGCGGAACGCCCTATGGAAGGTGAGAGGAGCCGCCCGGCTGGCCCGTCTGGCCTGTATCGCATGCTCACGCTTGC
CGCCTTCAGGTGCTACAACGCCGTCGAGACTCCCGAGGCTGCCGTCGTCGCCCGCGCGACCCAGTCCGTCGCCAC
CTCGATGCTGCCTCCTAAGCCCACCAGCCTGGTGGGAGACGACGGCTGGATGACGCTGTGGAAGCAGGACGACGA
CAAGATGACAGCCCTGAAGTCGGACGATGGAGTCAAGACTGCCTGGAAGGACGACGACGGTGTCATGACGGCCTG
GAAGAGGGCCGAAGATGGCGTCATGACTGCCTGGAAGGGCGACGACGGTGTCATGACGGCCTGGAAGGACGACGA
CGGTGTCATGACGGCCTGGAAGCAAGACGACGGTGTCATGACTGCCTGGAACGACGACGACGGTGTCATGACAGC
CTGGAAGGAGGACGATGGTGTCATGACCGCCTGGAAGAGGGCCGACGACGGTGTCATGACGGCCTGGAAGCANNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGCCTGGAAGCAGGACGACGGCGTCATGACTGCCTTGAAGG
AGGACGACGGTGTCATGACTGCCTTGAAGGAGGACGACGGCGTCATGACGGCCTGGAAGCAGGACGACGGTGTCA
TGACCGCCTGGAAGAGCGACGACGGTGTCATGACCGCCTGGAAGAGCGACGACGGCGTCATGACCGCCTGGGCTC
CCCAGCCGACCCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail