Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7541
Gene name
LocationContig_444:9400..11241
Strand-
Gene length (bp)1841
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03155 Alg6_Alg8 ALG6, ALG8 glycosyltransferase family 6.0E-80 65 293
PF03155 Alg6_Alg8 ALG6, ALG8 glycosyltransferase family 1.2E-48 331 564

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43053|ALG6_SCHPO Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg6 PE=3 SV=1 36 586 1.0E-128
sp|Q12001|ALG6_YEAST Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG6 PE=1 SV=1 36 570 3.0E-120
sp|Q9VKX7|ALG6_DROME Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Drosophila melanogaster GN=gny PE=2 SV=2 65 565 1.0E-81
sp|Q54QG6|ALG6_DICDI Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum GN=alg6 PE=3 SV=1 47 576 2.0E-81
sp|Q9Y672|ALG6_HUMAN Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens GN=ALG6 PE=1 SV=1 49 443 1.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43053|ALG6_SCHPO Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg6 PE=3 SV=1 36 586 1.0E-128
sp|Q12001|ALG6_YEAST Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG6 PE=1 SV=1 36 570 3.0E-120
sp|Q9VKX7|ALG6_DROME Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Drosophila melanogaster GN=gny PE=2 SV=2 65 565 1.0E-81
sp|Q54QG6|ALG6_DICDI Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum GN=alg6 PE=3 SV=1 47 576 2.0E-81
sp|Q9Y672|ALG6_HUMAN Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens GN=ALG6 PE=1 SV=1 49 443 1.0E-79
sp|Q5NVS8|ALG6_PONAB Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Pongo abelii GN=ALG6 PE=2 SV=1 49 443 1.0E-78
sp|Q802T2|ALG6_CHICK Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gallus gallus GN=ALG6 PE=2 SV=1 49 559 1.0E-77
sp|Q3TAE8|ALG6_MOUSE Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus GN=Alg6 PE=2 SV=1 57 443 9.0E-76
sp|Q3T1L5|ALG6_RAT Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Rattus norvegicus GN=Alg6 PE=2 SV=1 57 443 1.0E-74
sp|Q09226|ALG6_CAEEL Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Caenorhabditis elegans GN=C08B11.8 PE=3 SV=1 57 431 2.0E-68
sp|Q9FF17|ALG6_ARATH Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Arabidopsis thaliana GN=At5g38460 PE=2 SV=1 63 494 4.0E-68
sp|Q4IJT0|ALG8_GIBZE Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ALG8 PE=3 SV=1 84 487 2.0E-33
sp|Q9BVK2|ALG8_HUMAN Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens GN=ALG8 PE=1 SV=2 84 471 5.0E-31
sp|Q7RXP5|ALG8_NEUCR Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-8 PE=3 SV=2 84 491 1.0E-27
sp|Q5AJD2|ALG8_CANAL Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG8 PE=3 SV=1 84 487 2.0E-27
sp|Q6P8H8|ALG8_MOUSE Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus GN=Alg8 PE=2 SV=2 84 471 6.0E-27
sp|Q2UB20|ALG8_ASPOR Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alg8 PE=3 SV=1 84 487 7.0E-27
sp|P40351|ALG8_YEAST Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG8 PE=1 SV=1 84 448 2.0E-26
sp|Q5AWM9|ALG8_EMENI Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alg8 PE=3 SV=1 84 491 2.0E-26
sp|Q6BRE5|ALG8_DEBHA Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG8 PE=3 SV=1 84 471 3.0E-26
sp|Q2HA14|ALG8_CHAGB Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ALG8 PE=3 SV=1 84 491 2.0E-25
sp|Q6FKM3|ALG8_CANGA Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG8 PE=3 SV=1 84 488 2.0E-25
sp|Q0P5D9|ALG8_BOVIN Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Bos taurus GN=ALG8 PE=2 SV=1 84 471 4.0E-25
sp|Q759R3|ALG8_ASHGO Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG8 PE=3 SV=2 84 488 1.0E-24
sp|Q6CJR2|ALG8_KLULA Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG8 PE=3 SV=1 84 490 2.0E-24
sp|Q10479|ALG8_SCHPO Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg8 PE=3 SV=1 84 450 1.0E-23
sp|Q1DJR8|ALG8_COCIM Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Coccidioides immitis (strain RS) GN=ALG8 PE=3 SV=1 84 487 9.0E-23
sp|Q9W3V8|ALG8_DROME Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Drosophila melanogaster GN=xit PE=2 SV=1 84 479 2.0E-21
sp|P52887|ALG8_CAEEL Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Caenorhabditis elegans GN=C08H9.3 PE=3 SV=3 84 441 2.0E-20
sp|O80505|ALG8_ARATH Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Arabidopsis thaliana GN=At2g44660 PE=2 SV=3 84 471 6.0E-20
sp|Q554E2|ALG8_DICDI Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum GN=alg8 PE=3 SV=1 84 165 8.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005789 endoplasmic reticulum membrane Yes
GO:0016758 transferase activity, transferring hexosyl groups Yes
GO:0044446 intracellular organelle part No
GO:0044432 endoplasmic reticulum part No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016020 membrane No
GO:0044422 organelle part No
GO:0044424 intracellular part No
GO:0044425 membrane part No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.5

Transmembrane Domains

Domain # Start End Length
1 53 75 22
2 153 175 22
3 182 199 17
4 209 228 19
5 235 257 22
6 272 294 22
7 474 491 17
8 511 533 22
9 546 568 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7541
MASPSPHKSRRKPKKAADKPAPTTRPEALVRVPSFPLAAFLWPARSSSSQWEVLPLVLMVVGLFRWAAGLWGYSG
FRRPPMYGDYEAQRHWMELTTNLPVSQWYFHDLQWWGLDYPPLTAYHSWILGQIGSLIDPAWFALFASRGSDDPN
LKIFMRATVIVSEYLVYIPAAVVFVRRFGRLSGVATWTSSIALVAFLMQPSTMLIDHAHFQYNTVMLGLVLASMN
SMLAERYKSAALFFVAALGFKQMALYYALTVFSYLLGKSVFPSVNLTRLVGIALVTLLSFAALLLPLVLGTLYDR
YRGIDSRPDLDAPPPPLPIFPFVADYFDTQSAPYAVVEQIIQMVHRIFPFSRGLFEDKVANFWCAANMVVKLRSW
PPALLQKASLGATLLAIVPPNAILFFRPRKSALPLAFAATAWGFFLFSYQVHEKSVLLPLMPMTLLLAGKRGLAG
EVRAWVGLANLVGAWTMFPLLRRVGLGIPYTVLTLLWAYLLDLPPVSWTGPLDAQDGQSRWLQWATALLHWALYV
CMGLWHVVDALFVPPADKPDLWVVANVGIGAAGFSLCYLWCLWKLAQESDILPSRRATKSKVH*
Coding >Hirsu2|7541
ATGGCCAGCCCCTCGCCGCACAAGTCGCGGCGCAAGCCCAAGAAGGCCGCCGACAAGCCCGCGCCGACGACGCGC
CCCGAAGCCCTCGTCCGAGTGCCCTCGTTCCCCCTGGCCGCCTTTCTCTGGCCCGCCCGCAGCTCGTCGTCGCAA
TGGGAGGTGCTGCCGCTGGTGCTCATGGTCGTTGGCCTGTTCCGATGGGCCGCCGGCCTCTGGGGCTACTCTGGC
TTCCGACGGCCTCCCATGTACGGCGACTACGAGGCGCAGCGGCACTGGATGGAGCTGACGACGAACCTGCCCGTG
TCGCAGTGGTATTTCCACGACCTGCAGTGGTGGGGGCTGGACTACCCGCCCCTCACGGCCTACCACAGCTGGATC
CTGGGCCAGATCGGCTCTCTCATCGACCCGGCCTGGTTCGCCCTCTTCGCCTCGCGCGGCTCCGACGACCCCAAC
CTCAAGATCTTCATGCGGGCCACCGTCATCGTGTCCGAGTACCTCGTCTACATCCCGGCCGCCGTCGTCTTCGTC
CGCCGCTTCGGCCGGCTCAGCGGCGTCGCCACCTGGACCAGCTCCATCGCCCTCGTCGCCTTCTTGATGCAGCCG
TCCACGATGCTCATCGACCACGCCCACTTCCAGTACAACACCGTCATGCTCGGCCTGGTCCTGGCCAGCATGAAC
AGCATGTTGGCCGAGAGGTACAAGAGCGCCGCCCTCTTCTTCGTCGCCGCCCTCGGCTTCAAGCAGATGGCCCTG
TACTACGCCCTCACCGTCTTCTCCTATCTCCTCGGAAAATCCGTCTTCCCCTCCGTCAACCTCACCCGGCTCGTC
GGCATAGCTCTCGTCACCCTCCTCTCCTTTGCCGCCCTGCTGCTCCCCCTCGTCCTCGGCACCCTGTACGACCGG
TATCGCGGCATCGACTCGAGGCCGGACCTGGACGCGCCTCCCCCCCCGCTTCCCATTTTCCCTTTCGTTGCCGAC
TACTTTGATACCCAGTCCGCGCCGTATGCCGTGGTCGAGCAGATCATCCAGATGGTCCATCGCATCTTTCCCTTT
TCCCGCGGCCTGTTCGAGGACAAGGTCGCCAACTTCTGGTGCGCCGCCAACATGGTCGTCAAGCTGCGCAGCTGG
CCCCCGGCCCTGCTGCAGAAGGCCTCGCTCGGCGCCACGCTTCTTGCCATCGTCCCTCCCAACGCGATCCTGTTC
TTCCGCCCGCGCAAGTCGGCGCTGCCCCTGGCCTTTGCCGCCACCGCCTGGGGCTTCTTCCTCTTCAGCTACCAG
GTCCACGAGAAGAGCGTCTTGCTGCCGCTGATGCCCATGACGCTGCTGCTGGCGGGCAAGAGGGGGCTGGCCGGC
GAGGTTCGCGCCTGGGTCGGGCTGGCCAACCTCGTCGGGGCGTGGACCATGTTCCCGCTGCTGCGTCGCGTCGGC
CTGGGCATCCCGTACACGGTCCTGACCCTTCTCTGGGCCTATCTCCTGGACCTGCCTCCCGTCTCGTGGACCGGG
CCGTTGGATGCGCAGGATGGCCAGTCCCGGTGGCTGCAGTGGGCGACGGCACTCCTGCACTGGGCCCTGTACGTC
TGCATGGGCCTCTGGCACGTCGTCGACGCCCTCTTCGTCCCGCCCGCCGACAAGCCGGATCTGTGGGTGGTGGCC
AACGTGGGCATCGGCGCCGCCGGCTTCTCGCTCTGCTACCTGTGGTGTCTGTGGAAGCTGGCCCAGGAGAGCGAC
ATCCTGCCGTCCCGGCGGGCGACCAAGTCCAAGGTTCATTAG
Transcript >Hirsu2|7541
ATGGCCAGCCCCTCGCCGCACAAGTCGCGGCGCAAGCCCAAGAAGGCCGCCGACAAGCCCGCGCCGACGACGCGC
CCCGAAGCCCTCGTCCGAGTGCCCTCGTTCCCCCTGGCCGCCTTTCTCTGGCCCGCCCGCAGCTCGTCGTCGCAA
TGGGAGGTGCTGCCGCTGGTGCTCATGGTCGTTGGCCTGTTCCGATGGGCCGCCGGCCTCTGGGGCTACTCTGGC
TTCCGACGGCCTCCCATGTACGGCGACTACGAGGCGCAGCGGCACTGGATGGAGCTGACGACGAACCTGCCCGTG
TCGCAGTGGTATTTCCACGACCTGCAGTGGTGGGGGCTGGACTACCCGCCCCTCACGGCCTACCACAGCTGGATC
CTGGGCCAGATCGGCTCTCTCATCGACCCGGCCTGGTTCGCCCTCTTCGCCTCGCGCGGCTCCGACGACCCCAAC
CTCAAGATCTTCATGCGGGCCACCGTCATCGTGTCCGAGTACCTCGTCTACATCCCGGCCGCCGTCGTCTTCGTC
CGCCGCTTCGGCCGGCTCAGCGGCGTCGCCACCTGGACCAGCTCCATCGCCCTCGTCGCCTTCTTGATGCAGCCG
TCCACGATGCTCATCGACCACGCCCACTTCCAGTACAACACCGTCATGCTCGGCCTGGTCCTGGCCAGCATGAAC
AGCATGTTGGCCGAGAGGTACAAGAGCGCCGCCCTCTTCTTCGTCGCCGCCCTCGGCTTCAAGCAGATGGCCCTG
TACTACGCCCTCACCGTCTTCTCCTATCTCCTCGGAAAATCCGTCTTCCCCTCCGTCAACCTCACCCGGCTCGTC
GGCATAGCTCTCGTCACCCTCCTCTCCTTTGCCGCCCTGCTGCTCCCCCTCGTCCTCGGCACCCTGTACGACCGG
TATCGCGGCATCGACTCGAGGCCGGACCTGGACGCGCCTCCCCCCCCGCTTCCCATTTTCCCTTTCGTTGCCGAC
TACTTTGATACCCAGTCCGCGCCGTATGCCGTGGTCGAGCAGATCATCCAGATGGTCCATCGCATCTTTCCCTTT
TCCCGCGGCCTGTTCGAGGACAAGGTCGCCAACTTCTGGTGCGCCGCCAACATGGTCGTCAAGCTGCGCAGCTGG
CCCCCGGCCCTGCTGCAGAAGGCCTCGCTCGGCGCCACGCTTCTTGCCATCGTCCCTCCCAACGCGATCCTGTTC
TTCCGCCCGCGCAAGTCGGCGCTGCCCCTGGCCTTTGCCGCCACCGCCTGGGGCTTCTTCCTCTTCAGCTACCAG
GTCCACGAGAAGAGCGTCTTGCTGCCGCTGATGCCCATGACGCTGCTGCTGGCGGGCAAGAGGGGGCTGGCCGGC
GAGGTTCGCGCCTGGGTCGGGCTGGCCAACCTCGTCGGGGCGTGGACCATGTTCCCGCTGCTGCGTCGCGTCGGC
CTGGGCATCCCGTACACGGTCCTGACCCTTCTCTGGGCCTATCTCCTGGACCTGCCTCCCGTCTCGTGGACCGGG
CCGTTGGATGCGCAGGATGGCCAGTCCCGGTGGCTGCAGTGGGCGACGGCACTCCTGCACTGGGCCCTGTACGTC
TGCATGGGCCTCTGGCACGTCGTCGACGCCCTCTTCGTCCCGCCCGCCGACAAGCCGGATCTGTGGGTGGTGGCC
AACGTGGGCATCGGCGCCGCCGGCTTCTCGCTCTGCTACCTGTGGTGTCTGTGGAAGCTGGCCCAGGAGAGCGAC
ATCCTGCCGTCCCGGCGGGCGACCAAGTCCAAGGTTCATTAG
Gene >Hirsu2|7541
ATGGCCAGCCCCTCGCCGCACAAGTCGCGGCGCAAGCCCAAGAAGGCCGCCGACAAGCCCGCGCCGACGACGCGC
CCCGAAGCCCTCGTCCGAGTGCCCTCGTTCCCCCTGGCCGCCTTTCTCTGGCCCGCCCGCAGCTCGTCGTCGCAA
TGGGAGGTGCTGCCGCTGGTGCTCATGGTCGTTGGCCTGTTCCGATGGGCCGCCGGCCTCTGGGGCTACTCTGGT
ATGCCCCTCGTCTTCGCCGACGCCCGCAGCCTCGTCGTCGCGCTGACCTCGCGCCCTCGTCCGCCACGCCAGGCT
TCCGACGGCCTCCCATGTACGGCGACTACGAGGCGCAGCGGCACTGGATGGAGCTGACGACGAACCTGCCCGTGT
CGCAGTGGTATTTCCACGACCTGCAGTGGTGGGGGCTGGACTACCCGCCCCTCACGGCCTACCACAGCTGGATCC
TGGGCCAGATCGGCTCTCTCATCGACCCGGCCTGGTTCGCCCTCTTCGCCTCGCGCGGCTCCGACGACCCCAACC
TCAAGATCTTCATGCGGGCCACCGTCATCGTGTCCGAGTACCTCGTCTACATCCCGGCCGCCGTCGTCTTCGTCC
GCCGCTTCGGCCGGCTCAGCGGCGTCGCCACCTGGACCAGCTCCATCGCCCTCGTCGCCTTCTTGATGCAGCCGT
CCACGATGCTCATCGACCACGCCCACTTCCAGTACAACACCGTCATGCTCGGCCTGGTCCTGGCCAGCATGAACA
GCATGTTGGCCGAGAGGTACAAGAGCGCCGCCCTCTTCTTCGTCGCCGCCCTCGGCTTCAAGCAGATGGCCCTGT
ACTACGCCCTCACCGTCTTCTCCTATCTCCTCGGAAAATCCGTCTTCCCCTCCGTCAACCTCACCCGGCTCGTCG
GCATAGCTCTCGTCACCCTCCTCTCCTTTGCCGCCCTGCTGCTCCCCCTCGTCCTCGGCACCCTGTACGACCGGT
ATCGCGGCATCGACTCGAGGCCGGACCTGGACGCGCCTCCCCCCCCGCTTCCCATTTTCCCTTTCGTTGCCGACT
ACTTTGATACCCAGTCCGCGCCGTATGCCGTGGTCGAGCAGATCATCCAGATGGTCCATCGCATCTTTCCCTTTT
CCCGCGGCCTGTTCGAGGACAAGGTCGCCAACTTCTGGTGCGCCGCCAACATGGTCGTCAAGCTGCGCAGCTGGC
CCCCGGCCCTGCTGCAGAAGGCCTCGCTCGGCGCCACGCTTCTTGCCATCGTCCCTCCCAACGCGATCCTGTTCT
TCCGCCCGCGCAAGTCGGCGCTGCCCCTGGCCTTTGCCGCCACCGCCTGGGGCTTCTTCCTCTTCAGCTACCAGG
TCCACGAGAAGAGCGTCTTGCTGCCGCTGATGCCCATGACGCTGCTGCTGGCGGGCAAGAGGGGGCTGGCCGGCG
AGGTTCGCGCCTGGGTCGGGCTGGCCAACCTCGTCGGGGCGTGGACCATGTTCCCGCTGCTGCGTCGCGTCGGCC
TGGGCATCCCGTACACGGTCCTGACCCTTCTCTGGGCCTATCTCCTGGACCTGCCTCCCGTCTCGTGGACCGGGC
CGTTGGATGCGCAGGATGGCCAGTCCCGGTGGCTGCAGTGGGCGACGGCACTCCTGCACTGGGCCCTGTACGTCT
GCATGGGCCTCTGGCACGTCGTCGACGCCCTCTTCGTCCCGCCCGCCGACAAGCCGGATCTGTGGGTGGTGGCCA
ACGTGGGCATCGGCGCCGCCGGCTTCTCGCTCTGCTACCTGTGGTGTCTGTGGAAGCTGGCCCAGGAGAGCGACA
TCCTGCCGTCCCGGCGGGCGACCAAGTCCAAGGTTCATTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail