Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7539
Gene name
LocationContig_444:5608..7299
Strand-
Gene length (bp)1691
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10303 DUF2408 Protein of unknown function (DUF2408) 2.1E-26 178 300

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P6K3|YLF8_SCHPO UPF0662 protein C30C2.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30C2.08 PE=3 SV=1 4 439 1.0E-85
sp|Q08977|YP260_YEAST UPF0662 protein YPL260W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL260W PE=1 SV=1 14 443 5.0E-84

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7539
MDTPSVPAPRDAREQAILDRLQLIRDQLMLLKQDRTTYIRSQDVIPLYDQTIEQVRELNAIRAETGNKEENRLDK
VLESCFQLLSLFYLTIGRNNEAPATYALTSTVKRLLDHLTESDLYSAKDLESIYSTLAKLAENISTAQSEEESQA
QHSPFLLTLLLKRVELCQATLANLQKRLERVGEPLLAVHEKLISILRQISLANTKSKFSSSEVQKLRKQLVDIGE
QSRDGNGRFTAEDGSEPQGCAVIGELHSRCLKWADMVLERKGSVAEQWRPTYDVLVGIRNDLEKLSLTQAWSLRE
TDLYDFQRQLDKIDESRENGNFHDDRGRPADLWTQRTMLYLIRRSYAYIYSFMLASEPVSEALLPIYNQLQTLKR
CLMEVKNNGGVSTVRELYPYSMKLNSLDNMRVDGKFVVNGDVPEGQGSVSELLAECFDINYDLRLAAEAAVNGGD
K*
Coding >Hirsu2|7539
ATGGATACGCCATCGGTGCCGGCGCCGCGGGACGCCCGGGAACAGGCCATCCTGGACCGCCTGCAGCTCATCCGT
GACCAGCTCATGCTGCTCAAGCAGGATCGCACGACTTACATCCGCAGCCAAGACGTCATCCCGCTGTACGACCAG
ACGATCGAGCAGGTGCGCGAGCTCAACGCCATCCGCGCCGAGACGGGCAACAAGGAGGAAAACAGACTGGACAAG
GTCCTGGAGAGCTGCTTCCAGCTGCTTTCCCTCTTCTACCTCACCATCGGCCGCAACAACGAGGCCCCCGCCACC
TACGCCCTGACCTCGACCGTCAAGCGACTCCTCGACCACCTGACCGAGTCCGACCTGTACTCGGCCAAGGACCTG
GAGAGCATCTACTCTACGCTGGCCAAGCTGGCCGAGAACATCAGCACGGCCCAGAGCGAGGAGGAGTCCCAGGCC
CAGCACTCGCCCTTCCTGCTGACCCTCCTCCTCAAGCGCGTCGAGCTGTGCCAGGCGACGCTGGCAAACCTCCAA
AAACGGCTCGAGCGCGTCGGCGAGCCGCTGCTGGCCGTGCACGAGAAGCTGATATCCATACTCCGCCAGATCTCG
CTGGCAAACACCAAGTCCAAGTTCTCCTCGAGCGAAGTCCAGAAGCTGCGAAAGCAGCTGGTGGACATTGGCGAG
CAGTCCAGAGACGGCAATGGCAGGTTCACGGCCGAGGACGGCTCGGAGCCGCAGGGCTGCGCCGTGATTGGCGAG
CTGCATAGCCGGTGTCTGAAGTGGGCCGACATGGTCCTGGAGCGCAAGGGCAGCGTGGCGGAGCAGTGGCGGCCG
ACGTACGACGTGCTCGTCGGGATCCGCAACGACCTGGAGAAGCTGTCGCTGACGCAGGCCTGGTCGCTGCGCGAG
ACGGACCTGTACGACTTCCAGCGGCAGCTGGACAAGATCGACGAGAGCCGCGAGAACGGCAACTTCCACGACGAC
CGGGGCCGGCCGGCCGACCTGTGGACGCAGCGGACGATGCTGTACCTGATCCGGCGCAGCTACGCCTACATCTAC
TCCTTCATGCTCGCGTCGGAGCCCGTCTCGGAGGCGCTGCTGCCCATCTACAACCAGCTGCAGACGCTGAAGCGG
TGCCTGATGGAGGTGAAGAACAACGGCGGCGTCTCCACCGTCCGCGAGCTGTACCCGTACAGCATGAAGCTCAAC
TCGCTCGACAACATGAGGGTGGACGGCAAGTTCGTGGTCAACGGCGACGTGCCCGAGGGCCAGGGCAGCGTCAGC
GAGCTGCTGGCCGAGTGCTTCGACATCAACTACGACCTGCGGCTGGCGGCCGAGGCGGCCGTTAACGGCGGAGAC
AAGTAA
Transcript >Hirsu2|7539
ATGGATACGCCATCGGTGCCGGCGCCGCGGGACGCCCGGGAACAGGCCATCCTGGACCGCCTGCAGCTCATCCGT
GACCAGCTCATGCTGCTCAAGCAGGATCGCACGACTTACATCCGCAGCCAAGACGTCATCCCGCTGTACGACCAG
ACGATCGAGCAGGTGCGCGAGCTCAACGCCATCCGCGCCGAGACGGGCAACAAGGAGGAAAACAGACTGGACAAG
GTCCTGGAGAGCTGCTTCCAGCTGCTTTCCCTCTTCTACCTCACCATCGGCCGCAACAACGAGGCCCCCGCCACC
TACGCCCTGACCTCGACCGTCAAGCGACTCCTCGACCACCTGACCGAGTCCGACCTGTACTCGGCCAAGGACCTG
GAGAGCATCTACTCTACGCTGGCCAAGCTGGCCGAGAACATCAGCACGGCCCAGAGCGAGGAGGAGTCCCAGGCC
CAGCACTCGCCCTTCCTGCTGACCCTCCTCCTCAAGCGCGTCGAGCTGTGCCAGGCGACGCTGGCAAACCTCCAA
AAACGGCTCGAGCGCGTCGGCGAGCCGCTGCTGGCCGTGCACGAGAAGCTGATATCCATACTCCGCCAGATCTCG
CTGGCAAACACCAAGTCCAAGTTCTCCTCGAGCGAAGTCCAGAAGCTGCGAAAGCAGCTGGTGGACATTGGCGAG
CAGTCCAGAGACGGCAATGGCAGGTTCACGGCCGAGGACGGCTCGGAGCCGCAGGGCTGCGCCGTGATTGGCGAG
CTGCATAGCCGGTGTCTGAAGTGGGCCGACATGGTCCTGGAGCGCAAGGGCAGCGTGGCGGAGCAGTGGCGGCCG
ACGTACGACGTGCTCGTCGGGATCCGCAACGACCTGGAGAAGCTGTCGCTGACGCAGGCCTGGTCGCTGCGCGAG
ACGGACCTGTACGACTTCCAGCGGCAGCTGGACAAGATCGACGAGAGCCGCGAGAACGGCAACTTCCACGACGAC
CGGGGCCGGCCGGCCGACCTGTGGACGCAGCGGACGATGCTGTACCTGATCCGGCGCAGCTACGCCTACATCTAC
TCCTTCATGCTCGCGTCGGAGCCCGTCTCGGAGGCGCTGCTGCCCATCTACAACCAGCTGCAGACGCTGAAGCGG
TGCCTGATGGAGGTGAAGAACAACGGCGGCGTCTCCACCGTCCGCGAGCTGTACCCGTACAGCATGAAGCTCAAC
TCGCTCGACAACATGAGGGTGGACGGCAAGTTCGTGGTCAACGGCGACGTGCCCGAGGGCCAGGGCAGCGTCAGC
GAGCTGCTGGCCGAGTGCTTCGACATCAACTACGACCTGCGGCTGGCGGCCGAGGCGGCCGTTAACGGCGGAGAC
AAGTAA
Gene >Hirsu2|7539
ATGGATACGCCATCGGTGCCGGCGCCGCGGGACGCCCGGGAACAGGCCATCCTGGACCGCCTGCAGCTCATCCGT
GACCAGCTCATGCTGCTCAAGCAGGATCGCACGACTTACATCCGCAGCCAAGACGTCATCCCGCTGTACGACCAG
ACGATCGAGCAGGTGCGCGAGCTCAACGCCATCCGCGCCGAGACGGGCAACAAGGAGGAAAACAGACGTAGGTGA
TGCAAGATCCGCCTCATCCGCGGCCCCGGCTGACGCTGTTGTCCGCCAGTGGACAAGGTCCTGGAGAGCTGCTTC
CAGCTGCTTTCCCTCTTCTACCTCACCATCGGCCGCAACAACGAGGCCCCCGCCACCTACGCCCTGACCTCGACC
GTCAAGCGACTCCTCGACCACCTGACCGAGTCCGACCTGTACTCGGCCAAGGACCTGGAGAGCATCTACTCTACG
CTGGCCAAGCTGGCCGAGAACATCAGCACGGCCCAGAGCGAGGAGGAGTCCCAGGCCCAGCACTCGCCCTTCCTG
CTGACCCTCCTCCTCAAGCGCGTCGAGCTGTGCCAGGCGACGCTGGCAAACCTCCAAAAACGGCTCGAGCGCGTC
GGCGAGCCGCTGCTGGCCGTGCACGAGAAGCTGATATCCATACTCCGCCAGATCTCGCTGGCAAACACCAAGTCC
AAGGTGAGAGGGGGCGGTGCACCGGTTTTTATTTTCTTCCCACATCTTGGAAAGCAGAGCGCAGAGAAGATGATG
AAACAGAAAAACATTGGGAACGATGGCCGGCTGACCTGGTCCTCTCGTCGCATAGTTCTCCTCGAGCGAAGTCCA
GAAGCTGCGAAAGCAGCTGGTGGACATTGGCGAGCAGTCCAGAGACGGCAATGGCAGGTTCACGGCCGAGGACGG
CTCGGAGCCGCAGGGCTGCGCCGTGATTGGCGAGCTGCATAGCCGGTGTCTGAAGTGGGCCGACATGGTCCTGGA
GCGGTAGGTTGTCTCGGAGGCGCATGCCGGGCGTTCTCGCGGCCGGACGCTGACTGGCTCTCTCCCCATCTACAG
CAAGGGCAGCGTGGCGGAGCAGTGGCGGCCGACGTACGACGTGCTCGTCGGGATCCGCAACGACCTGGAGAAGCT
GTCGCTGACGCAGGCCTGGTCGCTGCGCGAGACGGACCTGTACGACTTCCAGCGGCAGCTGGACAAGATCGACGA
GAGCCGCGAGAACGGCAACTTCCACGACGACCGGGGCCGGCCGGCCGACCTGTGGACGCAGCGGACGATGCTGTA
CCTGATCCGGCGCAGCTACGCCTACATCTACTCCTTCATGCTCGCGTCGGAGCCCGTCTCGGAGGCGCTGCTGCC
CATCTACAACCAGCTGCAGACGCTGAAGCGGTGCCTGATGGAGGTGAAGAACAACGGCGGCGTCTCCACCGTCCG
CGAGCTGTACCCGTACAGCATGAAGGTAGGCAGGACCCCGGGCGTCGCACCCTACGGCGCGGGCAAGACGTGGAA
GGCTGACGCCGACACGCGGCTCTGAACAGCTCAACTCGCTCGACAACATGAGGGTGGACGGCAAGTTCGTGGTCA
ACGGCGACGTGCCCGAGGGCCAGGGCAGCGTCAGCGAGCTGCTGGCCGAGTGCTTCGACATCAACTACGACCTGC
GGCTGGCGGCCGAGGCGGCCGTTAACGGCGGAGACAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail