Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7539
Gene name
LocationContig_444:5608..7299
Strand-
Gene length (bp)1691
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10303 DUF2408 Protein of unknown function (DUF2408) 4.8E-26 178 300

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P6K3|YLF8_SCHPO UPF0662 protein C30C2.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30C2.08 PE=3 SV=1 4 439 1.0E-85
sp|Q08977|YP260_YEAST UPF0662 protein YPL260W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL260W PE=1 SV=1 14 443 5.0E-84

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7782 0.4081 0.3792 0.087 0.1247 0.0199 0.1466 0.1404 0.0828 0.0968

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3832
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5740
Ophiocordyceps australis map64 (Brazil) OphauB2|4857
Ophiocordyceps camponoti-floridani Ophcf2|06867
Ophiocordyceps camponoti-rufipedis Ophun1|4741
Ophiocordyceps kimflemingae Ophio5|923
Ophiocordyceps subramaniannii Hirsu2|7539 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7539
MDTPSVPAPRDAREQAILDRLQLIRDQLMLLKQDRTTYIRSQDVIPLYDQTIEQVRELNAIRAETGNKEENRLDK
VLESCFQLLSLFYLTIGRNNEAPATYALTSTVKRLLDHLTESDLYSAKDLESIYSTLAKLAENISTAQSEEESQA
QHSPFLLTLLLKRVELCQATLANLQKRLERVGEPLLAVHEKLISILRQISLANTKSKFSSSEVQKLRKQLVDIGE
QSRDGNGRFTAEDGSEPQGCAVIGELHSRCLKWADMVLERKGSVAEQWRPTYDVLVGIRNDLEKLSLTQAWSLRE
TDLYDFQRQLDKIDESRENGNFHDDRGRPADLWTQRTMLYLIRRSYAYIYSFMLASEPVSEALLPIYNQLQTLKR
CLMEVKNNGGVSTVRELYPYSMKLNSLDNMRVDGKFVVNGDVPEGQGSVSELLAECFDINYDLRLAAEAAVNGGD
K*
Coding >Hirsu2|7539
ATGGATACGCCATCGGTGCCGGCGCCGCGGGACGCCCGGGAACAGGCCATCCTGGACCGCCTGCAGCTCATCCGT
GACCAGCTCATGCTGCTCAAGCAGGATCGCACGACTTACATCCGCAGCCAAGACGTCATCCCGCTGTACGACCAG
ACGATCGAGCAGGTGCGCGAGCTCAACGCCATCCGCGCCGAGACGGGCAACAAGGAGGAAAACAGACTGGACAAG
GTCCTGGAGAGCTGCTTCCAGCTGCTTTCCCTCTTCTACCTCACCATCGGCCGCAACAACGAGGCCCCCGCCACC
TACGCCCTGACCTCGACCGTCAAGCGACTCCTCGACCACCTGACCGAGTCCGACCTGTACTCGGCCAAGGACCTG
GAGAGCATCTACTCTACGCTGGCCAAGCTGGCCGAGAACATCAGCACGGCCCAGAGCGAGGAGGAGTCCCAGGCC
CAGCACTCGCCCTTCCTGCTGACCCTCCTCCTCAAGCGCGTCGAGCTGTGCCAGGCGACGCTGGCAAACCTCCAA
AAACGGCTCGAGCGCGTCGGCGAGCCGCTGCTGGCCGTGCACGAGAAGCTGATATCCATACTCCGCCAGATCTCG
CTGGCAAACACCAAGTCCAAGTTCTCCTCGAGCGAAGTCCAGAAGCTGCGAAAGCAGCTGGTGGACATTGGCGAG
CAGTCCAGAGACGGCAATGGCAGGTTCACGGCCGAGGACGGCTCGGAGCCGCAGGGCTGCGCCGTGATTGGCGAG
CTGCATAGCCGGTGTCTGAAGTGGGCCGACATGGTCCTGGAGCGCAAGGGCAGCGTGGCGGAGCAGTGGCGGCCG
ACGTACGACGTGCTCGTCGGGATCCGCAACGACCTGGAGAAGCTGTCGCTGACGCAGGCCTGGTCGCTGCGCGAG
ACGGACCTGTACGACTTCCAGCGGCAGCTGGACAAGATCGACGAGAGCCGCGAGAACGGCAACTTCCACGACGAC
CGGGGCCGGCCGGCCGACCTGTGGACGCAGCGGACGATGCTGTACCTGATCCGGCGCAGCTACGCCTACATCTAC
TCCTTCATGCTCGCGTCGGAGCCCGTCTCGGAGGCGCTGCTGCCCATCTACAACCAGCTGCAGACGCTGAAGCGG
TGCCTGATGGAGGTGAAGAACAACGGCGGCGTCTCCACCGTCCGCGAGCTGTACCCGTACAGCATGAAGCTCAAC
TCGCTCGACAACATGAGGGTGGACGGCAAGTTCGTGGTCAACGGCGACGTGCCCGAGGGCCAGGGCAGCGTCAGC
GAGCTGCTGGCCGAGTGCTTCGACATCAACTACGACCTGCGGCTGGCGGCCGAGGCGGCCGTTAACGGCGGAGAC
AAGTAA
Transcript >Hirsu2|7539
ATGGATACGCCATCGGTGCCGGCGCCGCGGGACGCCCGGGAACAGGCCATCCTGGACCGCCTGCAGCTCATCCGT
GACCAGCTCATGCTGCTCAAGCAGGATCGCACGACTTACATCCGCAGCCAAGACGTCATCCCGCTGTACGACCAG
ACGATCGAGCAGGTGCGCGAGCTCAACGCCATCCGCGCCGAGACGGGCAACAAGGAGGAAAACAGACTGGACAAG
GTCCTGGAGAGCTGCTTCCAGCTGCTTTCCCTCTTCTACCTCACCATCGGCCGCAACAACGAGGCCCCCGCCACC
TACGCCCTGACCTCGACCGTCAAGCGACTCCTCGACCACCTGACCGAGTCCGACCTGTACTCGGCCAAGGACCTG
GAGAGCATCTACTCTACGCTGGCCAAGCTGGCCGAGAACATCAGCACGGCCCAGAGCGAGGAGGAGTCCCAGGCC
CAGCACTCGCCCTTCCTGCTGACCCTCCTCCTCAAGCGCGTCGAGCTGTGCCAGGCGACGCTGGCAAACCTCCAA
AAACGGCTCGAGCGCGTCGGCGAGCCGCTGCTGGCCGTGCACGAGAAGCTGATATCCATACTCCGCCAGATCTCG
CTGGCAAACACCAAGTCCAAGTTCTCCTCGAGCGAAGTCCAGAAGCTGCGAAAGCAGCTGGTGGACATTGGCGAG
CAGTCCAGAGACGGCAATGGCAGGTTCACGGCCGAGGACGGCTCGGAGCCGCAGGGCTGCGCCGTGATTGGCGAG
CTGCATAGCCGGTGTCTGAAGTGGGCCGACATGGTCCTGGAGCGCAAGGGCAGCGTGGCGGAGCAGTGGCGGCCG
ACGTACGACGTGCTCGTCGGGATCCGCAACGACCTGGAGAAGCTGTCGCTGACGCAGGCCTGGTCGCTGCGCGAG
ACGGACCTGTACGACTTCCAGCGGCAGCTGGACAAGATCGACGAGAGCCGCGAGAACGGCAACTTCCACGACGAC
CGGGGCCGGCCGGCCGACCTGTGGACGCAGCGGACGATGCTGTACCTGATCCGGCGCAGCTACGCCTACATCTAC
TCCTTCATGCTCGCGTCGGAGCCCGTCTCGGAGGCGCTGCTGCCCATCTACAACCAGCTGCAGACGCTGAAGCGG
TGCCTGATGGAGGTGAAGAACAACGGCGGCGTCTCCACCGTCCGCGAGCTGTACCCGTACAGCATGAAGCTCAAC
TCGCTCGACAACATGAGGGTGGACGGCAAGTTCGTGGTCAACGGCGACGTGCCCGAGGGCCAGGGCAGCGTCAGC
GAGCTGCTGGCCGAGTGCTTCGACATCAACTACGACCTGCGGCTGGCGGCCGAGGCGGCCGTTAACGGCGGAGAC
AAGTAA
Gene >Hirsu2|7539
ATGGATACGCCATCGGTGCCGGCGCCGCGGGACGCCCGGGAACAGGCCATCCTGGACCGCCTGCAGCTCATCCGT
GACCAGCTCATGCTGCTCAAGCAGGATCGCACGACTTACATCCGCAGCCAAGACGTCATCCCGCTGTACGACCAG
ACGATCGAGCAGGTGCGCGAGCTCAACGCCATCCGCGCCGAGACGGGCAACAAGGAGGAAAACAGACGTAGGTGA
TGCAAGATCCGCCTCATCCGCGGCCCCGGCTGACGCTGTTGTCCGCCAGTGGACAAGGTCCTGGAGAGCTGCTTC
CAGCTGCTTTCCCTCTTCTACCTCACCATCGGCCGCAACAACGAGGCCCCCGCCACCTACGCCCTGACCTCGACC
GTCAAGCGACTCCTCGACCACCTGACCGAGTCCGACCTGTACTCGGCCAAGGACCTGGAGAGCATCTACTCTACG
CTGGCCAAGCTGGCCGAGAACATCAGCACGGCCCAGAGCGAGGAGGAGTCCCAGGCCCAGCACTCGCCCTTCCTG
CTGACCCTCCTCCTCAAGCGCGTCGAGCTGTGCCAGGCGACGCTGGCAAACCTCCAAAAACGGCTCGAGCGCGTC
GGCGAGCCGCTGCTGGCCGTGCACGAGAAGCTGATATCCATACTCCGCCAGATCTCGCTGGCAAACACCAAGTCC
AAGGTGAGAGGGGGCGGTGCACCGGTTTTTATTTTCTTCCCACATCTTGGAAAGCAGAGCGCAGAGAAGATGATG
AAACAGAAAAACATTGGGAACGATGGCCGGCTGACCTGGTCCTCTCGTCGCATAGTTCTCCTCGAGCGAAGTCCA
GAAGCTGCGAAAGCAGCTGGTGGACATTGGCGAGCAGTCCAGAGACGGCAATGGCAGGTTCACGGCCGAGGACGG
CTCGGAGCCGCAGGGCTGCGCCGTGATTGGCGAGCTGCATAGCCGGTGTCTGAAGTGGGCCGACATGGTCCTGGA
GCGGTAGGTTGTCTCGGAGGCGCATGCCGGGCGTTCTCGCGGCCGGACGCTGACTGGCTCTCTCCCCATCTACAG
CAAGGGCAGCGTGGCGGAGCAGTGGCGGCCGACGTACGACGTGCTCGTCGGGATCCGCAACGACCTGGAGAAGCT
GTCGCTGACGCAGGCCTGGTCGCTGCGCGAGACGGACCTGTACGACTTCCAGCGGCAGCTGGACAAGATCGACGA
GAGCCGCGAGAACGGCAACTTCCACGACGACCGGGGCCGGCCGGCCGACCTGTGGACGCAGCGGACGATGCTGTA
CCTGATCCGGCGCAGCTACGCCTACATCTACTCCTTCATGCTCGCGTCGGAGCCCGTCTCGGAGGCGCTGCTGCC
CATCTACAACCAGCTGCAGACGCTGAAGCGGTGCCTGATGGAGGTGAAGAACAACGGCGGCGTCTCCACCGTCCG
CGAGCTGTACCCGTACAGCATGAAGGTAGGCAGGACCCCGGGCGTCGCACCCTACGGCGCGGGCAAGACGTGGAA
GGCTGACGCCGACACGCGGCTCTGAACAGCTCAACTCGCTCGACAACATGAGGGTGGACGGCAAGTTCGTGGTCA
ACGGCGACGTGCCCGAGGGCCAGGGCAGCGTCAGCGAGCTGCTGGCCGAGTGCTTCGACATCAACTACGACCTGC
GGCTGGCGGCCGAGGCGGCCGTTAACGGCGGAGACAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail