Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7536
Gene name
LocationContig_444:211..2262
Strand-
Gene length (bp)2051
Transcript length (bp)1890
Coding sequence length (bp)1890
Protein length (aa) 630

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain 5.1E-24 17 107
PF00130 C1_1 Phorbol esters/diacylglycerol binding domain (C1 domain) 1.1E-14 407 457

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09746|BZZ1_SCHPO Protein BZZ1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bzz1 PE=3 SV=1 10 619 2.0E-101
sp|P38822|BZZ1_YEAST Protein BZZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BZZ1 PE=1 SV=1 9 393 6.0E-65
sp|Q96RU3|FNBP1_HUMAN Formin-binding protein 1 OS=Homo sapiens GN=FNBP1 PE=1 SV=2 9 296 2.0E-14
sp|Q5RCJ1|CIP4_PONAB Cdc42-interacting protein 4 OS=Pongo abelii GN=TRIP10 PE=2 SV=1 10 296 2.0E-14
sp|Q15642|CIP4_HUMAN Cdc42-interacting protein 4 OS=Homo sapiens GN=TRIP10 PE=1 SV=3 10 296 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09746|BZZ1_SCHPO Protein BZZ1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bzz1 PE=3 SV=1 10 619 2.0E-101
sp|P38822|BZZ1_YEAST Protein BZZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BZZ1 PE=1 SV=1 9 393 6.0E-65
sp|Q96RU3|FNBP1_HUMAN Formin-binding protein 1 OS=Homo sapiens GN=FNBP1 PE=1 SV=2 9 296 2.0E-14
sp|Q5RCJ1|CIP4_PONAB Cdc42-interacting protein 4 OS=Pongo abelii GN=TRIP10 PE=2 SV=1 10 296 2.0E-14
sp|Q15642|CIP4_HUMAN Cdc42-interacting protein 4 OS=Homo sapiens GN=TRIP10 PE=1 SV=3 10 296 4.0E-14
sp|Q8R511|FNBP1_RAT Formin-binding protein 1 OS=Rattus norvegicus GN=Fnbp1 PE=1 SV=2 9 296 8.0E-14
sp|Q80TY0|FNBP1_MOUSE Formin-binding protein 1 OS=Mus musculus GN=Fnbp1 PE=1 SV=2 9 296 1.0E-13
sp|Q6GNV5|FNBP1_XENLA Formin-binding protein 1 homolog OS=Xenopus laevis GN=fnbp1 PE=2 SV=1 9 296 3.0E-13
sp|Q2HWF0|FBP1L_RAT Formin-binding protein 1-like OS=Rattus norvegicus GN=Fnbp1l PE=1 SV=2 9 242 3.0E-12
sp|Q8K012|FBP1L_MOUSE Formin-binding protein 1-like OS=Mus musculus GN=Fnbp1l PE=1 SV=2 9 242 3.0E-12
sp|Q5U3Q6|CIP4_DANRE Cdc42-interacting protein 4 homolog OS=Danio rerio GN=trip10 PE=2 SV=1 10 296 3.0E-12
sp|Q5T0N5|FBP1L_HUMAN Formin-binding protein 1-like OS=Homo sapiens GN=FNBP1L PE=1 SV=3 9 242 3.0E-12
sp|Q8CJ53|CIP4_MOUSE Cdc42-interacting protein 4 OS=Mus musculus GN=Trip10 PE=1 SV=2 10 296 4.0E-12
sp|P97531|CIP4_RAT Cdc42-interacting protein 4 OS=Rattus norvegicus GN=Trip10 PE=1 SV=3 10 253 8.0E-12
sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens GN=PRKD3 PE=1 SV=1 363 491 1.0E-10
sp|P52757|CHIO_HUMAN Beta-chimaerin OS=Homo sapiens GN=CHN2 PE=1 SV=2 405 456 4.0E-10
sp|Q6GUF4|FBP1L_XENTR Formin-binding protein 1-like OS=Xenopus tropicalis GN=fnbp1l PE=2 SV=1 9 253 5.0E-10
sp|P30337|CHIN_RAT N-chimaerin OS=Rattus norvegicus GN=Chn1 PE=1 SV=2 405 456 5.0E-10
sp|Q17QN0|CHIN_BOVIN N-chimaerin OS=Bos taurus GN=CHN1 PE=2 SV=1 405 456 5.0E-10
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 363 458 6.0E-10
sp|Q91V57|CHIN_MOUSE N-chimaerin OS=Mus musculus GN=Chn1 PE=1 SV=2 405 456 7.0E-10
sp|P15882|CHIN_HUMAN N-chimaerin OS=Homo sapiens GN=CHN1 PE=1 SV=3 405 456 8.0E-10
sp|Q80XD1|CHIO_MOUSE Beta-chimaerin OS=Mus musculus GN=Chn2 PE=1 SV=2 405 456 8.0E-10
sp|Q03070|CHIO_RAT Beta-chimaerin OS=Rattus norvegicus GN=Chn2 PE=2 SV=1 405 456 1.0E-09
sp|Q6DCZ7|FBP1L_XENLA Formin-binding protein 1-like OS=Xenopus laevis GN=fnbp1l PE=1 SV=1 9 253 1.0E-09
sp|Q1LZ97|GRP4_BOVIN RAS guanyl-releasing protein 4 OS=Bos taurus GN=RASGRP4 PE=2 SV=1 378 456 4.0E-09
sp|Q8TDF6|GRP4_HUMAN RAS guanyl-releasing protein 4 OS=Homo sapiens GN=RASGRP4 PE=1 SV=2 378 456 6.0E-09
sp|Q55DK5|MGP3_DICDI Mental retardation GTPase activating protein homolog 3 OS=Dictyostelium discoideum GN=mgp3 PE=3 SV=1 8 234 7.0E-09
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 407 478 1.0E-08
sp|A4IJ06|GRP1_XENTR RAS guanyl-releasing protein 1 OS=Xenopus tropicalis GN=rasgrp1 PE=2 SV=1 379 456 1.0E-08
sp|O95267|GRP1_HUMAN RAS guanyl-releasing protein 1 OS=Homo sapiens GN=RASGRP1 PE=1 SV=2 339 456 1.0E-08
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 407 462 2.0E-08
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 404 458 2.0E-08
sp|Q6NTL4|GRP1_XENLA RAS guanyl-releasing protein 1 OS=Xenopus laevis GN=rasgrp1 PE=2 SV=1 379 456 2.0E-08
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 404 458 2.0E-08
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 404 458 2.0E-08
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 404 458 2.0E-08
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 404 458 2.0E-08
sp|Q9Z1S3|GRP1_MOUSE RAS guanyl-releasing protein 1 OS=Mus musculus GN=Rasgrp1 PE=1 SV=1 339 470 2.0E-08
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 407 462 2.0E-08
sp|Q8BTM9|GRP4_MOUSE RAS guanyl-releasing protein 4 OS=Mus musculus GN=Rasgrp4 PE=1 SV=1 378 456 2.0E-08
sp|Q9R1K8|GRP1_RAT RAS guanyl-releasing protein 1 OS=Rattus norvegicus GN=Rasgrp1 PE=1 SV=1 339 456 2.0E-08
sp|Q32N25|GRP2A_XENLA RAS guanyl-releasing protein 2-A OS=Xenopus laevis GN=rasgrp2-a PE=2 SV=1 342 478 3.0E-08
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 405 458 3.0E-08
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 404 458 3.0E-08
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 382 482 3.0E-08
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 405 472 3.0E-08
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 405 472 3.0E-08
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 382 460 3.0E-08
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 407 484 4.0E-08
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 404 458 4.0E-08
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 382 460 5.0E-08
sp|Q15139|KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens GN=PRKD1 PE=1 SV=2 407 499 5.0E-08
sp|Q99MK9|RASF1_MOUSE Ras association domain-containing protein 1 OS=Mus musculus GN=Rassf1 PE=2 SV=1 404 458 6.0E-08
sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens GN=PRKD3 PE=1 SV=1 407 461 7.0E-08
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 382 509 7.0E-08
sp|Q62101|KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus GN=Prkd1 PE=1 SV=2 407 497 7.0E-08
sp|Q8K0T7|UN13C_MOUSE Protein unc-13 homolog C OS=Mus musculus GN=Unc13c PE=1 SV=3 363 456 7.0E-08
sp|Q62770|UN13C_RAT Protein unc-13 homolog C OS=Rattus norvegicus GN=Unc13c PE=1 SV=3 363 456 8.0E-08
sp|Q9WTQ1|KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus GN=Prkd1 PE=1 SV=2 407 468 8.0E-08
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 407 461 1.0E-07
sp|Q9WTQ1|KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus GN=Prkd1 PE=1 SV=2 407 461 1.0E-07
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 404 458 1.0E-07
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 404 458 1.0E-07
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 404 458 1.0E-07
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 404 458 1.0E-07
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 404 472 1.0E-07
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 407 462 1.0E-07
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 404 472 1.0E-07
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 404 458 1.0E-07
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 404 485 1.0E-07
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 404 472 1.0E-07
sp|Q62101|KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus GN=Prkd1 PE=1 SV=2 407 461 2.0E-07
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 404 458 2.0E-07
sp|O75044|SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens GN=SRGAP2 PE=1 SV=2 12 297 2.0E-07
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 404 458 2.0E-07
sp|O14795|UN13B_HUMAN Protein unc-13 homolog B OS=Homo sapiens GN=UNC13B PE=1 SV=2 378 456 2.0E-07
sp|Q9UPW8|UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens GN=UNC13A PE=2 SV=4 378 456 2.0E-07
sp|Q8NB66|UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens GN=UNC13C PE=2 SV=3 363 456 2.0E-07
sp|Q62768|UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus GN=Unc13a PE=1 SV=1 378 456 2.0E-07
sp|Q4KUS2|UN13A_MOUSE Protein unc-13 homolog A OS=Mus musculus GN=Unc13a PE=1 SV=3 378 456 2.0E-07
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fascicularis GN=PRKCG PE=2 SV=1 404 469 2.0E-07
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos taurus GN=PRKCG PE=2 SV=1 404 469 2.0E-07
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 405 462 2.0E-07
sp|Q9BZL6|KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens GN=PRKD2 PE=1 SV=2 407 459 2.0E-07
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 404 469 2.0E-07
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 404 469 2.0E-07
sp|Q8BZ03|KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus GN=Prkd2 PE=1 SV=1 407 459 2.0E-07
sp|Q5XIS9|KPCD2_RAT Serine/threonine-protein kinase D2 OS=Rattus norvegicus GN=Prkd2 PE=1 SV=1 407 459 2.0E-07
sp|P27715|UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans GN=unc-13 PE=1 SV=4 384 475 2.0E-07
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 405 472 3.0E-07
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 405 472 3.0E-07
sp|Q15139|KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens GN=PRKD1 PE=1 SV=2 407 461 3.0E-07
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 407 474 3.0E-07
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus cuniculus GN=PRKCG PE=1 SV=1 404 469 3.0E-07
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 404 469 3.0E-07
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 405 462 3.0E-07
sp|Q9Z1N9|UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus GN=Unc13b PE=1 SV=2 378 456 3.0E-07
sp|Q91Z67|SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus GN=Srgap2 PE=1 SV=2 12 297 3.0E-07
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 382 456 4.0E-07
sp|D4A208|SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus GN=Srgap2 PE=1 SV=1 12 297 4.0E-07
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 407 458 5.0E-07
sp|Q62769|UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus GN=Unc13b PE=1 SV=2 378 456 5.0E-07
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 405 462 5.0E-07
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 407 479 6.0E-07
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 392 468 6.0E-07
sp|Q8IV61|GRP3_HUMAN Ras guanyl-releasing protein 3 OS=Homo sapiens GN=RASGRP3 PE=1 SV=1 407 456 6.0E-07
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 407 474 7.0E-07
sp|Q9NS23|RASF1_HUMAN Ras association domain-containing protein 1 OS=Homo sapiens GN=RASSF1 PE=1 SV=1 404 458 7.0E-07
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 407 471 9.0E-07
sp|P34125|DGKA_DICDI Diacylglycerol kinase A OS=Dictyostelium discoideum GN=dgkA PE=1 SV=3 407 456 9.0E-07
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 405 471 9.0E-07
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 407 468 1.0E-06
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 407 468 1.0E-06
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 407 468 1.0E-06
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 407 468 1.0E-06
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 407 468 1.0E-06
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 407 471 1.0E-06
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 407 471 1.0E-06
sp|Q8NEN9|PDZD8_HUMAN PDZ domain-containing protein 8 OS=Homo sapiens GN=PDZD8 PE=1 SV=1 397 540 1.0E-06
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 405 471 1.0E-06
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 407 487 1.0E-06
sp|Q6DCK3|GRP2B_XENLA RAS guanyl-releasing protein 2-B OS=Xenopus laevis GN=rasgrp2-b PE=2 SV=1 342 478 1.0E-06
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 407 456 1.0E-06
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 407 456 1.0E-06
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 407 456 1.0E-06
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 407 456 1.0E-06
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 407 492 1.0E-06
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 382 456 2.0E-06
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 382 456 2.0E-06
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 407 481 2.0E-06
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 404 458 2.0E-06
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 407 481 3.0E-06
sp|Q6PFY1|FCSD1_MOUSE F-BAR and double SH3 domains protein 1 OS=Mus musculus GN=Fchsd1 PE=2 SV=1 32 298 4.0E-06
sp|Q86WN1|FCSD1_HUMAN F-BAR and double SH3 domains protein 1 OS=Homo sapiens GN=FCHSD1 PE=1 SV=1 22 314 5.0E-06
sp|Q9BZL6|KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens GN=PRKD2 PE=1 SV=2 407 524 6.0E-06
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 371 456 6.0E-06
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 377 456 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0035556 intracellular signal transduction Yes
GO:0007165 signal transduction No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7536
MAQVDGAPTFGAELKDGFKPANAWVSHGIAWLDEIQQFYRDRSAIEKDYSAKLNALAKKYFDKKNKKSAQLSVGD
SPAMTPGSLESASITTWASQLTTLESRAAEHDRFANNLVAQVADPLKQTGARFDELRKRHAEYADRLAAERDSSY
ADLRKVKAKYDAACQEVEAKRKKSESQTDKARAQSAYQQQILDMNNVKNTYLIAINVTNNHKDRYYHEYVPELMD
SLQDLAEFRTLKLNEAWTLAARLEADMLQQSQALMDHLGREITRNEPHLDAMMYLRHNMGVFQEPVDRQFEPSPV
WHDDDVMVVDETAKIYLRNVLTKSKSQLGELRREVDKKRREVDNVKRLKLRVRDGSEKNKDEAEVVRTLFAMQDE
LHSLDRRRLTAEIETSTITAVVGDVTLGAKNHNFKSQTFKIPTNCDLCGERIWGLSAKGFDCRDCGYTCHGKCEM
KVPADCPGEQTKEERKRLKAERQEAANKLLTPAAAPPAHVAELPDLTRSNTMNSLSSHSARPSVSASSLVPRPPS
PLSADDADAPPPAPKPKGAAPPPRKNRMMAPPPAAYISELPGSNGAGPREEEKRRGKMLYAFEASADGELSVPEG
REVVQLEPDGKSGRGGAQGRNKALCSLGR*
Coding >Hirsu2|7536
ATGGCCCAAGTCGACGGCGCGCCCACCTTCGGCGCCGAGCTCAAGGATGGCTTCAAGCCCGCCAACGCCTGGGTC
AGCCACGGCATCGCCTGGCTGGACGAGATCCAGCAGTTTTACCGCGACCGTTCGGCCATCGAGAAGGACTACAGC
GCCAAGCTGAACGCGCTCGCCAAGAAGTACTTCGACAAGAAGAATAAGAAGTCAGCCCAGCTGAGCGTCGGCGAC
AGCCCGGCCATGACCCCCGGCTCGCTCGAGAGCGCCTCCATCACCACTTGGGCCAGCCAGCTCACCACGCTCGAG
TCCCGCGCCGCCGAACACGACCGCTTCGCCAACAACCTCGTCGCCCAAGTCGCCGACCCTCTCAAGCAGACGGGC
GCCCGCTTCGACGAGCTCCGCAAGCGCCATGCCGAATACGCCGACCGGCTCGCCGCCGAGCGCGACTCCTCCTAC
GCCGACCTGCGCAAGGTCAAGGCCAAGTACGACGCCGCCTGCCAGGAGGTCGAGGCCAAGCGCAAGAAGTCCGAG
TCCCAGACGGACAAGGCCAGGGCCCAGAGCGCCTACCAGCAGCAGATCCTCGACATGAACAACGTCAAGAACACG
TACCTCATCGCCATCAACGTCACCAACAACCACAAGGACAGGTACTACCACGAGTACGTCCCCGAGCTCATGGAC
AGCCTGCAGGACCTGGCCGAGTTCCGCACTCTCAAGCTCAACGAGGCCTGGACCCTCGCCGCCCGCCTCGAGGCC
GACATGCTGCAGCAGAGCCAGGCCCTGATGGACCACCTGGGCCGCGAGATCACGCGCAACGAGCCGCACCTCGAC
GCCATGATGTACCTGCGCCACAACATGGGCGTCTTCCAGGAGCCCGTCGACCGCCAGTTCGAGCCCAGCCCCGTC
TGGCACGACGACGACGTCATGGTCGTCGACGAGACGGCCAAGATTTACCTGCGCAACGTCCTGACCAAGTCCAAG
TCGCAGCTCGGCGAGCTCCGCCGCGAGGTCGACAAGAAGCGCCGCGAGGTCGACAACGTCAAGCGGCTCAAGCTG
CGCGTCCGCGACGGCAGCGAGAAGAACAAGGACGAGGCCGAGGTCGTCCGCACCCTCTTCGCCATGCAGGACGAG
CTGCACAGCCTCGACCGCCGCCGCCTGACGGCCGAGATCGAGACGTCGACCATCACCGCCGTCGTCGGCGACGTC
ACCCTCGGCGCCAAGAACCACAACTTCAAGAGCCAGACCTTCAAGATCCCCACCAACTGCGACCTCTGCGGCGAG
CGCATCTGGGGCCTGAGCGCCAAGGGCTTCGACTGCCGCGACTGCGGCTACACCTGCCACGGCAAGTGCGAGATG
AAGGTGCCGGCCGACTGCCCCGGCGAGCAGACCAAGGAGGAGCGCAAGCGGCTCAAGGCTGAGCGCCAGGAGGCC
GCCAACAAGCTGCTGACGCCCGCCGCGGCGCCCCCCGCCCACGTCGCCGAGCTGCCCGACCTGACGCGCTCCAAC
ACGATGAACTCGCTCAGCTCCCACTCGGCCCGCCCCTCCGTCTCGGCCTCGTCCCTCGTCCCCCGCCCGCCGTCG
CCGCTGAGCGCCGACGACGCCGACGCGCCGCCGCCGGCACCCAAGCCCAAGGGCGCGGCGCCCCCGCCGCGCAAG
AACAGGATGATGGCGCCCCCGCCCGCCGCCTACATCAGCGAGCTGCCGGGGAGCAACGGCGCGGGCCCGAGGGAG
GAGGAGAAGAGGAGGGGCAAGATGCTGTACGCCTTCGAGGCCAGCGCAGACGGAGAGCTGTCGGTCCCGGAAGGC
CGGGAGGTGGTCCAGCTCGAGCCCGACGGTAAGTCTGGGAGAGGAGGCGCGCAAGGGCGCAACAAGGCTCTCTGT
TCACTCGGTCGCTGA
Transcript >Hirsu2|7536
ATGGCCCAAGTCGACGGCGCGCCCACCTTCGGCGCCGAGCTCAAGGATGGCTTCAAGCCCGCCAACGCCTGGGTC
AGCCACGGCATCGCCTGGCTGGACGAGATCCAGCAGTTTTACCGCGACCGTTCGGCCATCGAGAAGGACTACAGC
GCCAAGCTGAACGCGCTCGCCAAGAAGTACTTCGACAAGAAGAATAAGAAGTCAGCCCAGCTGAGCGTCGGCGAC
AGCCCGGCCATGACCCCCGGCTCGCTCGAGAGCGCCTCCATCACCACTTGGGCCAGCCAGCTCACCACGCTCGAG
TCCCGCGCCGCCGAACACGACCGCTTCGCCAACAACCTCGTCGCCCAAGTCGCCGACCCTCTCAAGCAGACGGGC
GCCCGCTTCGACGAGCTCCGCAAGCGCCATGCCGAATACGCCGACCGGCTCGCCGCCGAGCGCGACTCCTCCTAC
GCCGACCTGCGCAAGGTCAAGGCCAAGTACGACGCCGCCTGCCAGGAGGTCGAGGCCAAGCGCAAGAAGTCCGAG
TCCCAGACGGACAAGGCCAGGGCCCAGAGCGCCTACCAGCAGCAGATCCTCGACATGAACAACGTCAAGAACACG
TACCTCATCGCCATCAACGTCACCAACAACCACAAGGACAGGTACTACCACGAGTACGTCCCCGAGCTCATGGAC
AGCCTGCAGGACCTGGCCGAGTTCCGCACTCTCAAGCTCAACGAGGCCTGGACCCTCGCCGCCCGCCTCGAGGCC
GACATGCTGCAGCAGAGCCAGGCCCTGATGGACCACCTGGGCCGCGAGATCACGCGCAACGAGCCGCACCTCGAC
GCCATGATGTACCTGCGCCACAACATGGGCGTCTTCCAGGAGCCCGTCGACCGCCAGTTCGAGCCCAGCCCCGTC
TGGCACGACGACGACGTCATGGTCGTCGACGAGACGGCCAAGATTTACCTGCGCAACGTCCTGACCAAGTCCAAG
TCGCAGCTCGGCGAGCTCCGCCGCGAGGTCGACAAGAAGCGCCGCGAGGTCGACAACGTCAAGCGGCTCAAGCTG
CGCGTCCGCGACGGCAGCGAGAAGAACAAGGACGAGGCCGAGGTCGTCCGCACCCTCTTCGCCATGCAGGACGAG
CTGCACAGCCTCGACCGCCGCCGCCTGACGGCCGAGATCGAGACGTCGACCATCACCGCCGTCGTCGGCGACGTC
ACCCTCGGCGCCAAGAACCACAACTTCAAGAGCCAGACCTTCAAGATCCCCACCAACTGCGACCTCTGCGGCGAG
CGCATCTGGGGCCTGAGCGCCAAGGGCTTCGACTGCCGCGACTGCGGCTACACCTGCCACGGCAAGTGCGAGATG
AAGGTGCCGGCCGACTGCCCCGGCGAGCAGACCAAGGAGGAGCGCAAGCGGCTCAAGGCTGAGCGCCAGGAGGCC
GCCAACAAGCTGCTGACGCCCGCCGCGGCGCCCCCCGCCCACGTCGCCGAGCTGCCCGACCTGACGCGCTCCAAC
ACGATGAACTCGCTCAGCTCCCACTCGGCCCGCCCCTCCGTCTCGGCCTCGTCCCTCGTCCCCCGCCCGCCGTCG
CCGCTGAGCGCCGACGACGCCGACGCGCCGCCGCCGGCACCCAAGCCCAAGGGCGCGGCGCCCCCGCCGCGCAAG
AACAGGATGATGGCGCCCCCGCCCGCCGCCTACATCAGCGAGCTGCCGGGGAGCAACGGCGCGGGCCCGAGGGAG
GAGGAGAAGAGGAGGGGCAAGATGCTGTACGCCTTCGAGGCCAGCGCAGACGGAGAGCTGTCGGTCCCGGAAGGC
CGGGAGGTGGTCCAGCTCGAGCCCGACGGTAAGTCTGGGAGAGGAGGCGCGCAAGGGCGCAACAAGGCTCTCTGT
TCACTCGGTCGCTGA
Gene >Hirsu2|7536
ATGGCCCAAGTCGACGGCGCGCCCACCTTCGGCGCCGAGCTCAAGGTCCGTCTCTCCGCCTCAACCTCCCGCCGC
CAGCCTCGCCGCCCTCGCCACCGACTGACGCCCGACAAAACAGGATGGCTTCAAGCCCGCCAACGCCTGGGTCAG
CCACGGCATCGCCTGGCTGGACGAGATCCAGCAGTTTTACCGCGACCGTTCGGCCATCGAGAAGGACTACAGCGC
CAAGCTGAACGCGCTCGCCAAGAAGTACTTCGACAAGAAGAATAAGAAGTCAGCCCAGCTGAGCGTCGGCGACAG
CCCGGCCATGACCCCCGGCTCGCTCGAGAGGTAACGTCGTCCTCTCCCGAACTCGCTCCGCCGTTCCCATCCCGG
CCGCCGCCCGTGCTGACCGAACGCGAAACAACAACAAAAAAAGCGCCTCCATCACCACTTGGGCCAGCCAGCTCA
CCACGCTCGAGTCCCGCGCCGCCGAACACGACCGCTTCGCCAACAACCTCGTCGCCCAAGTCGCCGACCCTCTCA
AGCAGACGGGCGCCCGCTTCGACGAGCTCCGCAAGCGCCATGCCGAATACGCCGACCGGCTCGCCGCCGAGCGCG
ACTCCTCCTACGCCGACCTGCGCAAGGTCAAGGCCAAGTACGACGCCGCCTGCCAGGAGGTCGAGGCCAAGCGCA
AGAAGTCCGAGTCCCAGACGGACAAGGCCAGGGCCCAGAGCGCCTACCAGCAGCAGATCCTCGACATGAACAACG
TCAAGAACACGTACCTCATCGCCATCAACGTCACCAACAACCACAAGGACAGGTACTACCACGAGTACGTCCCCG
AGCTCATGGACAGCCTGCAGGACCTGGCCGAGTTCCGCACTCTCAAGCTCAACGAGGCCTGGACCCTCGCCGCCC
GCCTCGAGGCCGACATGCTGCAGCAGAGCCAGGCCCTGATGGACCACCTGGGCCGCGAGATCACGCGCAACGAGC
CGCACCTCGACGCCATGATGTACCTGCGCCACAACATGGGCGTCTTCCAGGAGCCCGTCGACCGCCAGTTCGAGC
CCAGCCCCGTCTGGCACGACGACGACGTCATGGTCGTCGACGAGACGGCCAAGATTTACCTGCGCAACGTCCTGA
CCAAGTCCAAGTCGCAGCTCGGCGAGCTCCGCCGCGAGGTCGACAAGAAGCGCCGCGAGGTCGACAACGTCAAGC
GGCTCAAGCTGCGCGTCCGCGACGGCAGCGAGAAGAACAAGGACGAGGCCGAGGTCGTCCGCACCCTCTTCGCCA
TGCAGGACGAGCTGCACAGCCTCGACCGCCGCCGCCTGACGGCCGAGATCGAGACGTCGACCATCACCGCCGTCG
TCGGCGACGTCACCCTCGGCGCCAAGAACCACAACTTCAAGAGCCAGACCTTCAAGATCCCCACCAACTGCGACC
TCTGCGGCGAGCGCATCTGGGGCCTGAGCGCCAAGGGCTTCGACTGCCGCGACTGCGGCTACACCTGCCACGGCA
AGTGCGAGATGAAGGTGCCGGCCGACTGCCCCGGCGAGCAGACCAAGGAGGAGCGCAAGCGGCTCAAGGCTGAGC
GCCAGGAGGCCGCCAACAAGCTGCTGACGCCCGCCGCGGCGCCCCCCGCCCACGTCGCCGAGCTGCCCGACCTGA
CGCGCTCCAACACGATGAACTCGCTCAGCTCCCACTCGGCCCGCCCCTCCGTCTCGGCCTCGTCCCTCGTCCCCC
GCCCGCCGTCGCCGCTGAGCGCCGACGACGCCGACGCGCCGCCGCCGGCACCCAAGCCCAAGGGCGCGGCGCCCC
CGCCGCGCAAGAACAGGATGATGGCGCCCCCGCCCGCCGCCTACATCAGCGAGCTGCCGGGGAGCAACGGCGCGG
GCCCGAGGGAGGAGGAGAAGAGGAGGGGCAAGATGCTGTACGCCTTCGAGGCCAGCGCAGACGGAGAGCTGTCGG
TCCCGGAAGGCCGGGAGGTGGTCCAGCTCGAGCCCGACGGTAAGTCTGGGAGAGGAGGCGCGCAAGGGCGCAACA
AGGCTCTCTGTTCACTCGGTCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail