Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7530
Gene name
LocationContig_442:14943..16818
Strand+
Gene length (bp)1875
Transcript length (bp)1644
Coding sequence length (bp)1644
Protein length (aa) 548

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00118 Cpn60_TCP1 TCP-1/cpn60 chaperonin family 1.1E-153 38 530

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78921|TCPQ_SCHPO Probable T-complex protein 1 subunit theta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct8 PE=2 SV=3 1 547 0.0E+00
sp|P47079|TCPQ_YEAST T-complex protein 1 subunit theta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT8 PE=1 SV=1 1 547 0.0E+00
sp|Q6EE31|TCPQ_CHICK T-complex protein 1 subunit theta OS=Gallus gallus GN=CCT8 PE=1 SV=3 1 547 0.0E+00
sp|Q552J0|TCPQ_DICDI T-complex protein 1 subunit theta OS=Dictyostelium discoideum GN=cct8 PE=3 SV=1 13 547 0.0E+00
sp|P47828|TCPQ_CANAX T-complex protein 1 subunit theta OS=Candida albicans GN=CCT8 PE=3 SV=2 1 547 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78921|TCPQ_SCHPO Probable T-complex protein 1 subunit theta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct8 PE=2 SV=3 1 547 0.0E+00
sp|P47079|TCPQ_YEAST T-complex protein 1 subunit theta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT8 PE=1 SV=1 1 547 0.0E+00
sp|Q6EE31|TCPQ_CHICK T-complex protein 1 subunit theta OS=Gallus gallus GN=CCT8 PE=1 SV=3 1 547 0.0E+00
sp|Q552J0|TCPQ_DICDI T-complex protein 1 subunit theta OS=Dictyostelium discoideum GN=cct8 PE=3 SV=1 13 547 0.0E+00
sp|P47828|TCPQ_CANAX T-complex protein 1 subunit theta OS=Candida albicans GN=CCT8 PE=3 SV=2 1 547 0.0E+00
sp|Q3ZCI9|TCPQ_BOVIN T-complex protein 1 subunit theta OS=Bos taurus GN=CCT8 PE=1 SV=3 1 547 0.0E+00
sp|P42932|TCPQ_MOUSE T-complex protein 1 subunit theta OS=Mus musculus GN=Cct8 PE=1 SV=3 1 547 0.0E+00
sp|A8X6I9|TCPQ_CAEBR T-complex protein 1 subunit theta OS=Caenorhabditis briggsae GN=cct-8 PE=3 SV=1 1 547 0.0E+00
sp|Q4R5J0|TCPQ_MACFA T-complex protein 1 subunit theta OS=Macaca fascicularis GN=CCT8 PE=2 SV=1 1 547 0.0E+00
sp|Q5RAP1|TCPQ_PONAB T-complex protein 1 subunit theta OS=Pongo abelii GN=CCT8 PE=2 SV=3 1 547 0.0E+00
sp|P50990|TCPQ_HUMAN T-complex protein 1 subunit theta OS=Homo sapiens GN=CCT8 PE=1 SV=4 1 547 0.0E+00
sp|Q9N358|TCPQ_CAEEL T-complex protein 1 subunit theta OS=Caenorhabditis elegans GN=cct-8 PE=1 SV=3 1 547 2.0E-177
sp|Q94K05|TCPQ_ARATH T-complex protein 1 subunit theta OS=Arabidopsis thaliana GN=CCT8 PE=1 SV=1 13 536 2.0E-174
sp|Q58405|THS_METJA Thermosome subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ths PE=3 SV=1 3 531 2.0E-96
sp|O93624|THS_METTL Thermosome subunit OS=Methanothermococcus thermolithotrophicus GN=ths PE=1 SV=1 31 531 2.0E-93
sp|O26885|THSB_METTH Thermosome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsB PE=3 SV=1 13 529 1.0E-90
sp|Q9V2Q7|THS_PYRAB Thermosome subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ths PE=3 SV=1 13 531 2.0E-90
sp|P50016|THS_METKA Thermosome subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ths PE=3 SV=1 13 531 4.0E-90
sp|O24730|THSB_THEK1 Thermosome subunit beta OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsB PE=3 SV=2 13 545 7.0E-90
sp|O57762|THS_PYRHO Thermosome subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ths PE=3 SV=1 13 529 9.0E-90
sp|Q52500|THSB_THEKO Thermosome subunit beta OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsB PE=3 SV=1 13 545 2.0E-89
sp|Q53546|THS_DESSY Thermosome subunit OS=Desulfurococcus sp. (strain SY) GN=ths PE=3 SV=1 13 531 3.0E-87
sp|O26320|THSA_METTH Thermosome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsA PE=3 SV=2 31 530 1.0E-86
sp|P61111|THSA_THEKO Thermosome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsA PE=1 SV=1 13 530 3.0E-86
sp|P61112|THSA_THEK1 Thermosome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsA PE=1 SV=1 13 530 3.0E-86
sp|O30561|THS1_HALVD Thermosome subunit 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct1 PE=1 SV=1 31 529 4.0E-86
sp|O24732|THSB_THEK8 Thermosome subunit beta OS=Thermococcus sp. (strain KS-8) GN=thsB PE=3 SV=1 13 545 3.0E-85
sp|O28045|THSA_ARCFU Thermosome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsA PE=3 SV=1 31 530 2.0E-84
sp|P48424|THSA_THEAC Thermosome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsA PE=1 SV=1 31 535 2.0E-81
sp|O24731|THSA_THEK8 Thermosome subunit alpha OS=Thermococcus sp. (strain KS-8) GN=thsA PE=3 SV=1 13 539 3.0E-81
sp|Q9HN70|THSA_HALSA Thermosome subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsA PE=3 SV=2 31 534 7.0E-81
sp|O28821|THSB_ARCFU Thermosome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsB PE=3 SV=1 31 530 2.0E-80
sp|Q9YA66|THSB_AERPE Thermosome subunit beta OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsB PE=3 SV=2 7 529 4.0E-77
sp|P46219|THSA_SULSH Thermosome subunit alpha OS=Sulfolobus shibatae GN=thsA PE=1 SV=1 13 529 5.0E-77
sp|Q9HHA2|THS3_HALVD Thermosome subunit 3 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct3 PE=1 SV=2 16 530 3.0E-76
sp|Q9V2S9|THSA_SULSO Thermosome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsA PE=3 SV=2 13 529 4.0E-76
sp|Q9V2T5|THSA_SULAC Thermosome subunit alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsA PE=3 SV=2 13 529 1.0E-75
sp|Q9YDK6|THSA_AERPE Thermosome subunit alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsA PE=3 SV=2 31 529 2.0E-74
sp|P28488|THSB_SULSH Thermosome subunit beta OS=Sulfolobus shibatae GN=thsB PE=1 SV=1 7 539 3.0E-74
sp|Q9V2T8|THSB_SULSO Thermosome subunit beta OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsB PE=3 SV=2 7 539 2.0E-73
sp|Q9V2T3|THSB_DESMO Thermosome subunit beta (Fragment) OS=Desulfurococcus mobilis GN=thsB PE=3 SV=1 27 521 1.0E-72
sp|Q9LV21|TCPD_ARATH T-complex protein 1 subunit delta OS=Arabidopsis thaliana GN=CCT4 PE=1 SV=1 31 530 2.0E-72
sp|Q9V2T4|THSB_SULAC Thermosome subunit beta OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsB PE=3 SV=2 31 539 4.0E-72
sp|P50999|TCPD_SCHPO T-complex protein 1 subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct4 PE=2 SV=2 29 530 4.0E-71
sp|O24734|THSA_SULTO Thermosome subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsA PE=1 SV=1 13 529 6.0E-71
sp|Q9NB32|TCPD_OCHTR T-complex protein 1 subunit delta OS=Ochlerotatus triseriatus PE=2 SV=1 12 531 4.0E-70
sp|Q6FQT2|TCPD_CANGA T-complex protein 1 subunit delta OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCT4 PE=3 SV=1 31 530 2.0E-69
sp|O24735|THSB_SULTO Thermosome subunit beta OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsB PE=1 SV=1 31 529 3.0E-69
sp|Q4R6V2|TCPE_MACFA T-complex protein 1 subunit epsilon OS=Macaca fascicularis GN=CCT5 PE=2 SV=1 27 526 4.0E-69
sp|P48643|TCPE_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens GN=CCT5 PE=1 SV=1 27 526 4.0E-69
sp|P53451|TCPD_TAKRU T-complex protein 1 subunit delta OS=Takifugu rubripes GN=cct4 PE=2 SV=1 8 530 5.0E-69
sp|Q7TPB1|TCPD_RAT T-complex protein 1 subunit delta OS=Rattus norvegicus GN=Cct4 PE=1 SV=3 7 530 5.0E-69
sp|P39078|TCPD_YEAST T-complex protein 1 subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT4 PE=1 SV=2 31 530 6.0E-69
sp|Q6CL82|TCPD_KLULA T-complex protein 1 subunit delta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCT4 PE=3 SV=1 31 530 7.0E-69
sp|P87153|TCPH_SCHPO Probable T-complex protein 1 subunit eta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct7 PE=1 SV=1 1 538 8.0E-69
sp|Q54CL2|TCPD_DICDI T-complex protein 1 subunit delta OS=Dictyostelium discoideum GN=cct4 PE=3 SV=1 3 530 2.0E-68
sp|P80316|TCPE_MOUSE T-complex protein 1 subunit epsilon OS=Mus musculus GN=Cct5 PE=1 SV=1 27 526 2.0E-68
sp|P80315|TCPD_MOUSE T-complex protein 1 subunit delta OS=Mus musculus GN=Cct4 PE=1 SV=3 7 530 2.0E-68
sp|Q5RF02|TCPE_PONAB T-complex protein 1 subunit epsilon OS=Pongo abelii GN=CCT5 PE=2 SV=1 27 526 3.0E-68
sp|Q6BXF6|TCPD_DEBHA T-complex protein 1 subunit delta OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCT4 PE=3 SV=1 7 530 5.0E-68
sp|P42943|TCPH_YEAST T-complex protein 1 subunit eta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT7 PE=1 SV=1 26 538 8.0E-68
sp|Q68FQ0|TCPE_RAT T-complex protein 1 subunit epsilon OS=Rattus norvegicus GN=Cct5 PE=1 SV=1 27 526 1.0E-67
sp|Q9UTM4|TCPE_SCHPO T-complex protein 1 subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct5 PE=3 SV=1 27 529 1.0E-67
sp|P80313|TCPH_MOUSE T-complex protein 1 subunit eta OS=Mus musculus GN=Cct7 PE=1 SV=1 13 541 1.0E-67
sp|Q6C100|TCPD_YARLI T-complex protein 1 subunit delta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCT4 PE=3 SV=1 15 530 2.0E-67
sp|Q2T9X2|TCPD_BOVIN T-complex protein 1 subunit delta OS=Bos taurus GN=CCT4 PE=1 SV=3 15 530 2.0E-67
sp|P40413|TCPE_YEAST T-complex protein 1 subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT5 PE=1 SV=3 31 529 2.0E-67
sp|O04450|TCPE_ARATH T-complex protein 1 subunit epsilon OS=Arabidopsis thaliana GN=CCT5 PE=1 SV=1 31 527 4.0E-67
sp|P48425|THSB_THEAC Thermosome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsB PE=1 SV=1 5 527 5.0E-67
sp|O30560|THS2_HALVD Thermosome subunit 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct2 PE=1 SV=1 31 529 6.0E-67
sp|O15891|TCPA_TETPY T-complex protein 1 subunit alpha OS=Tetrahymena pyriformis PE=3 SV=1 31 527 7.0E-67
sp|Q84WV1|TCPG_ARATH T-complex protein 1 subunit gamma OS=Arabidopsis thaliana GN=CCT3 PE=1 SV=1 31 540 1.0E-66
sp|Q5R5C8|TCPH_PONAB T-complex protein 1 subunit eta OS=Pongo abelii GN=CCT7 PE=2 SV=1 22 527 5.0E-66
sp|Q99832|TCPH_HUMAN T-complex protein 1 subunit eta OS=Homo sapiens GN=CCT7 PE=1 SV=2 13 527 6.0E-66
sp|Q75A36|TCPD_ASHGO T-complex protein 1 subunit delta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCT4 PE=3 SV=1 31 530 7.0E-66
sp|Q5R637|TCPD_PONAB T-complex protein 1 subunit delta OS=Pongo abelii GN=CCT4 PE=2 SV=3 18 530 9.0E-66
sp|P50991|TCPD_HUMAN T-complex protein 1 subunit delta OS=Homo sapiens GN=CCT4 PE=1 SV=4 18 530 1.0E-65
sp|Q9HNI0|THSB_HALSA Thermosome subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsB PE=3 SV=2 30 529 2.0E-65
sp|Q5ZJK8|TCPH_CHICK T-complex protein 1 subunit eta OS=Gallus gallus GN=CCT7 PE=1 SV=1 28 538 3.0E-65
sp|Q54ER7|TCPH_DICDI T-complex protein 1 subunit eta OS=Dictyostelium discoideum GN=cct7 PE=3 SV=1 28 543 3.0E-65
sp|Q2NKZ1|TCPH_BOVIN T-complex protein 1 subunit eta OS=Bos taurus GN=CCT7 PE=1 SV=1 13 527 8.0E-64
sp|P54411|TCPE2_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 31 527 2.0E-63
sp|Q9LKI7|TCPG_THAWE T-complex protein 1 subunit gamma OS=Thalassiosira weissflogii PE=2 SV=1 27 534 3.0E-63
sp|P54408|TCPG_TETPY T-complex protein 1 subunit gamma OS=Tetrahymena pyriformis PE=3 SV=1 20 527 5.0E-63
sp|Q9SF16|TCPH_ARATH T-complex protein 1 subunit eta OS=Arabidopsis thaliana GN=CCT7 PE=1 SV=1 9 527 6.0E-63
sp|Q54TH8|TCPG_DICDI T-complex protein 1 subunit gamma OS=Dictyostelium discoideum GN=cct3 PE=1 SV=1 19 526 1.0E-62
sp|P47209|TCPE_CAEEL T-complex protein 1 subunit epsilon OS=Caenorhabditis elegans GN=cct-5 PE=2 SV=1 27 528 1.0E-62
sp|P28769|TCPA_ARATH T-complex protein 1 subunit alpha OS=Arabidopsis thaliana GN=CCT1 PE=1 SV=1 30 527 2.0E-62
sp|Q5NVF9|TCPG_PONAB T-complex protein 1 subunit gamma OS=Pongo abelii GN=CCT3 PE=2 SV=1 31 535 3.0E-62
sp|P49368|TCPG_HUMAN T-complex protein 1 subunit gamma OS=Homo sapiens GN=CCT3 PE=1 SV=4 31 535 4.0E-62
sp|Q3T0K2|TCPG_BOVIN T-complex protein 1 subunit gamma OS=Bos taurus GN=CCT3 PE=1 SV=1 31 535 4.0E-62
sp|P54409|TCPH_TETPY T-complex protein 1 subunit eta OS=Tetrahymena pyriformis PE=3 SV=1 9 539 9.0E-62
sp|O74341|TCPG_SCHPO T-complex protein 1 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct3 PE=1 SV=1 27 527 2.0E-61
sp|O77323|TCPH_PLAF7 T-complex protein 1 subunit eta OS=Plasmodium falciparum (isolate 3D7) GN=MAL3P3.6 PE=3 SV=1 28 538 3.0E-61
sp|Q4R963|TCPG_MACFA T-complex protein 1 subunit gamma OS=Macaca fascicularis GN=CCT3 PE=2 SV=1 31 535 3.0E-61
sp|Q9HH21|THSG_SULSH Thermosome subunit gamma OS=Sulfolobus shibatae GN=thsC PE=3 SV=1 28 527 5.0E-61
sp|Q54TD3|TCPE_DICDI T-complex protein 1 subunit epsilon OS=Dictyostelium discoideum GN=cct5 PE=3 SV=1 31 527 9.0E-61
sp|Q96SF2|TCPQM_HUMAN T-complex protein 1 subunit theta-like 2 OS=Homo sapiens GN=CCT8L2 PE=2 SV=2 28 547 9.0E-61
sp|Q9V2T7|THSG_SULSO Thermosome subunit gamma OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsC PE=3 SV=1 28 527 1.0E-60
sp|P40412|TCPE1_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 42 527 1.0E-60
sp|P50143|TCPG_XENLA T-complex protein 1 subunit gamma OS=Xenopus laevis GN=cct3 PE=2 SV=2 31 534 2.0E-60
sp|O00782|TCPG_OXYGR T-complex protein 1 subunit gamma OS=Oxytricha granulifera PE=3 SV=1 31 527 2.0E-60
sp|P80318|TCPG_MOUSE T-complex protein 1 subunit gamma OS=Mus musculus GN=Cct3 PE=1 SV=1 31 535 2.0E-60
sp|Q6P502|TCPG_RAT T-complex protein 1 subunit gamma OS=Rattus norvegicus GN=Cct3 PE=1 SV=1 31 535 3.0E-60
sp|Q54ES9|TCPB_DICDI T-complex protein 1 subunit beta OS=Dictyostelium discoideum GN=cct2 PE=1 SV=1 20 529 4.0E-60
sp|Q55BM4|TCPA_DICDI T-complex protein 1 subunit alpha OS=Dictyostelium discoideum GN=tcp1 PE=2 SV=1 30 534 5.0E-60
sp|P39077|TCPG_YEAST T-complex protein 1 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT3 PE=1 SV=2 27 527 7.0E-60
sp|P48605|TCPG_DROME T-complex protein 1 subunit gamma OS=Drosophila melanogaster GN=Cctgamma PE=2 SV=2 29 540 3.0E-59
sp|A6NM43|TCPQL_HUMAN Putative T-complex protein 1 subunit theta-like 1 OS=Homo sapiens GN=CCT8L1P PE=5 SV=1 28 547 5.0E-59
sp|P47208|TCPD_CAEEL T-complex protein 1 subunit delta OS=Caenorhabditis elegans GN=cct-4 PE=2 SV=1 15 529 2.0E-57
sp|P47207|TCPB_CAEEL T-complex protein 1 subunit beta OS=Caenorhabditis elegans GN=cct-2 PE=1 SV=2 37 529 4.0E-57
sp|Q94757|TCPA_SCHMA T-complex protein 1 subunit alpha OS=Schistosoma mansoni GN=TCP-1A PE=2 SV=1 30 539 4.0E-55
sp|O94501|TCPA_SCHPO T-complex protein 1 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct1 PE=3 SV=1 30 538 4.0E-54
sp|P41988|TCPA_CAEEL T-complex protein 1 subunit alpha OS=Caenorhabditis elegans GN=cct-1 PE=3 SV=2 30 527 4.0E-54
sp|Q10147|TCPB_SCHPO Probable T-complex protein 1 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct2 PE=3 SV=1 1 537 6.0E-53
sp|Q32L40|TCPA_BOVIN T-complex protein 1 subunit alpha OS=Bos taurus GN=TCP1 PE=1 SV=1 22 527 4.0E-52
sp|Q9XT06|TCPA_MONDO T-complex protein 1 subunit alpha OS=Monodelphis domestica GN=TCP1 PE=2 SV=1 30 527 5.0E-52
sp|P12613|TCPA_DROME T-complex protein 1 subunit alpha OS=Drosophila melanogaster GN=T-cp1 PE=2 SV=2 24 527 9.0E-52
sp|Q9W790|TCPA_PALPA T-complex protein 1 subunit alpha OS=Paleosuchus palpebrosus GN=TCP1 PE=2 SV=1 30 527 1.0E-51
sp|Q4R5G2|TCPA_MACFA T-complex protein 1 subunit alpha OS=Macaca fascicularis GN=TCP1 PE=2 SV=1 22 527 1.0E-51
sp|P17987|TCPA_HUMAN T-complex protein 1 subunit alpha OS=Homo sapiens GN=TCP1 PE=1 SV=1 22 527 1.0E-51
sp|Q4R6F8|TCPB_MACFA T-complex protein 1 subunit beta OS=Macaca fascicularis GN=CCT2 PE=2 SV=3 13 529 3.0E-51
sp|P78371|TCPB_HUMAN T-complex protein 1 subunit beta OS=Homo sapiens GN=CCT2 PE=1 SV=4 13 529 3.0E-51
sp|Q8SS33|TCPQ_ENCCU T-complex protein 1 subunit theta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT8 PE=1 SV=1 36 547 5.0E-51
sp|P18279|TCPA_CRIGR T-complex protein 1 subunit alpha OS=Cricetulus griseus GN=TCP1 PE=2 SV=1 22 527 6.0E-51
sp|Q3ZBH0|TCPB_BOVIN T-complex protein 1 subunit beta OS=Bos taurus GN=CCT2 PE=1 SV=3 13 529 7.0E-51
sp|Q940P8|TCPB_ARATH T-complex protein 1 subunit beta OS=Arabidopsis thaliana GN=CCT2 PE=1 SV=1 37 529 7.0E-51
sp|P28480|TCPA_RAT T-complex protein 1 subunit alpha OS=Rattus norvegicus GN=Tcp1 PE=1 SV=1 22 527 1.0E-50
sp|P39076|TCPB_YEAST T-complex protein 1 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT2 PE=1 SV=1 37 530 2.0E-50
sp|P12612|TCPA_YEAST T-complex protein 1 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCP1 PE=1 SV=2 30 543 2.0E-50
sp|P80314|TCPB_MOUSE T-complex protein 1 subunit beta OS=Mus musculus GN=Cct2 PE=1 SV=4 13 529 1.0E-49
sp|Q5XIM9|TCPB_RAT T-complex protein 1 subunit beta OS=Rattus norvegicus GN=Cct2 PE=1 SV=3 13 529 2.0E-49
sp|P11983|TCPA_MOUSE T-complex protein 1 subunit alpha OS=Mus musculus GN=Tcp1 PE=1 SV=3 30 527 6.0E-49
sp|Q8SR53|TCPH_ENCCU T-complex protein 1 subunit eta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT7 PE=1 SV=1 28 532 8.0E-49
sp|Q5ZJ54|TCPZ_CHICK T-complex protein 1 subunit zeta OS=Gallus gallus GN=CCT6 PE=1 SV=3 31 529 1.0E-46
sp|O77622|TCPZ_RABIT T-complex protein 1 subunit zeta OS=Oryctolagus cuniculus GN=CCT6 PE=1 SV=3 31 529 2.0E-46
sp|Q8SRP9|TCPE_ENCCU T-complex protein 1 subunit epsilon OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT5 PE=1 SV=1 27 527 4.0E-46
sp|Q3MHL7|TCPZ_BOVIN T-complex protein 1 subunit zeta OS=Bos taurus GN=CCT6A PE=1 SV=3 31 529 4.0E-46
sp|Q5RCD2|TCPZ_PONAB T-complex protein 1 subunit zeta OS=Pongo abelii GN=CCT6 PE=2 SV=3 31 529 8.0E-46
sp|P40227|TCPZ_HUMAN T-complex protein 1 subunit zeta OS=Homo sapiens GN=CCT6A PE=1 SV=3 31 529 2.0E-45
sp|P80317|TCPZ_MOUSE T-complex protein 1 subunit zeta OS=Mus musculus GN=Cct6a PE=1 SV=3 31 529 2.0E-45
sp|Q8SR76|TCPG_ENCCU T-complex protein 1 subunit gamma OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT3 PE=1 SV=1 34 531 5.0E-44
sp|Q8SSC9|TCPA_ENCCU T-complex protein 1 subunit alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TCP1 PE=1 SV=1 27 543 3.0E-41
sp|P39079|TCPZ_YEAST T-complex protein 1 subunit zeta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT6 PE=1 SV=1 25 538 4.0E-40
sp|Q3T084|TCPW_BOVIN T-complex protein 1 subunit zeta-2 OS=Bos taurus GN=CCT6B PE=2 SV=3 31 529 4.0E-39
sp|Q92526|TCPW_HUMAN T-complex protein 1 subunit zeta-2 OS=Homo sapiens GN=CCT6B PE=1 SV=5 31 529 6.0E-39
sp|Q76NU3|TCPZ_DICDI T-complex protein 1 subunit zeta OS=Dictyostelium discoideum GN=cct6 PE=1 SV=1 22 539 7.0E-39
sp|Q8SSH3|TCPD_ENCCU T-complex protein 1 subunit delta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT4 PE=1 SV=1 34 531 3.0E-37
sp|Q9M888|TCPZA_ARATH T-complex protein 1 subunit zeta 1 OS=Arabidopsis thaliana GN=CCT6A PE=1 SV=1 23 529 2.0E-36
sp|Q8SQP2|TCPB_ENCCU T-complex protein 1 subunit beta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT2 PE=1 SV=1 38 530 2.0E-36
sp|Q8L7N0|TCPZB_ARATH T-complex protein 1 subunit zeta 2 OS=Arabidopsis thaliana GN=CCT6B PE=1 SV=1 23 529 5.0E-36
sp|P46550|TCPZ_CAEEL T-complex protein 1 subunit zeta OS=Caenorhabditis elegans GN=cct-6 PE=1 SV=1 9 542 6.0E-36
sp|P54410|TCPH_TETTH T-complex protein 1 subunit eta (Fragment) OS=Tetrahymena thermophila PE=3 SV=1 66 414 2.0E-35
sp|Q61390|TCPW_MOUSE T-complex protein 1 subunit zeta-2 OS=Mus musculus GN=Cct6b PE=1 SV=4 31 529 2.0E-34
sp|O94515|TCPZ_SCHPO T-complex protein 1 subunit zeta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct6 PE=3 SV=1 31 538 2.0E-34
sp|Q9NPJ1|MKKS_HUMAN McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin OS=Homo sapiens GN=MKKS PE=1 SV=1 42 479 2.0E-15
sp|Q5R4T7|MKKS_PONAB McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin OS=Pongo abelii GN=MKKS PE=2 SV=2 42 479 4.0E-14
sp|Q29068|TCPG_PIG T-complex protein 1 subunit gamma (Fragment) OS=Sus scrofa GN=CCT3 PE=2 SV=1 33 114 3.0E-13
sp|P50157|TCPA_AMBME T-complex protein 1 subunit alpha (Fragment) OS=Ambystoma mexicanum PE=2 SV=1 386 527 4.0E-12
sp|Q9JI70|MKKS_MOUSE McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin OS=Mus musculus GN=Mkks PE=2 SV=2 42 514 5.0E-11
sp|Q29236|TCPZ_PIG T-complex protein 1 subunit zeta (Fragment) OS=Sus scrofa GN=CCT6 PE=2 SV=1 31 122 4.0E-08
sp|A3NHB6|CH602_BURP6 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain 668) GN=groL2 PE=3 SV=1 25 186 2.0E-07
sp|A3P2X2|CH602_BURP0 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain 1106a) GN=groL2 PE=3 SV=1 25 186 2.0E-07
sp|Q63N20|CH602_BURPS 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain K96243) GN=groL2 PE=3 SV=1 25 186 3.0E-07
sp|Q3JGX2|CH602_BURP1 60 kDa chaperonin 2 OS=Burkholderia pseudomallei (strain 1710b) GN=groL2 PE=3 SV=1 25 186 3.0E-07
sp|O32847|CH60_LACZE 60 kDa chaperonin OS=Lactobacillus zeae GN=groL PE=3 SV=1 23 146 3.0E-07
sp|B3W9W7|CH60_LACCB 60 kDa chaperonin OS=Lactobacillus casei (strain BL23) GN=groL PE=3 SV=1 23 146 3.0E-07
sp|Q035Y9|CH60_LACC3 60 kDa chaperonin OS=Lactobacillus casei (strain ATCC 334) GN=groL PE=3 SV=1 23 146 3.0E-07
sp|Q2T3W7|CH602_BURTA 60 kDa chaperonin 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=groL2 PE=3 SV=1 25 186 4.0E-07
sp|Q2LPJ8|CH601_SYNAS 60 kDa chaperonin 1 OS=Syntrophus aciditrophicus (strain SB) GN=groL1 PE=3 SV=1 28 223 4.0E-07
sp|C5D4F4|CH60_GEOSW 60 kDa chaperonin OS=Geobacillus sp. (strain WCH70) GN=groL PE=3 SV=1 27 186 2.0E-06
sp|P47632|CH60_MYCGE 60 kDa chaperonin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=groL PE=3 SV=1 30 193 2.0E-06
sp|A8FAG3|CH60_BACP2 60 kDa chaperonin OS=Bacillus pumilus (strain SAFR-032) GN=groL PE=3 SV=1 27 223 2.0E-06
sp|Q7TTT6|CH602_SYNPX 60 kDa chaperonin 2 OS=Synechococcus sp. (strain WH8102) GN=groL2 PE=3 SV=1 22 186 2.0E-06
sp|Q8VV84|CH60_GEOTM 60 kDa chaperonin OS=Geobacillus thermoglucosidasius GN=groL PE=3 SV=1 27 186 3.0E-06
sp|Q89P00|CH604_BRADU 60 kDa chaperonin 4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=groL4 PE=3 SV=1 28 186 3.0E-06
sp|Q07201|CH60_GEOSE 60 kDa chaperonin OS=Geobacillus stearothermophilus GN=groL PE=2 SV=1 27 186 3.0E-06
sp|Q13IM9|CH605_BURXL 60 kDa chaperonin 5 OS=Burkholderia xenovorans (strain LB400) GN=groL5 PE=3 SV=1 32 186 4.0E-06
sp|B0U418|CH60_XYLFM 60 kDa chaperonin OS=Xylella fastidiosa (strain M12) GN=groL PE=3 SV=1 30 189 4.0E-06
sp|P26209|CH60_BACP3 60 kDa chaperonin OS=Bacillus sp. (strain PS3) GN=groL PE=3 SV=1 27 186 4.0E-06
sp|A4IJV3|CH60_GEOTN 60 kDa chaperonin OS=Geobacillus thermodenitrificans (strain NG80-2) GN=groL PE=3 SV=1 27 186 4.0E-06
sp|Q5L3E6|CH60_GEOKA 60 kDa chaperonin OS=Geobacillus kaustophilus (strain HTA426) GN=groL PE=3 SV=1 27 186 5.0E-06
sp|Q93G07|CH60_LACAC 60 kDa chaperonin OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=groL PE=3 SV=2 27 223 7.0E-06
sp|A8YTH8|CH60_LACH4 60 kDa chaperonin OS=Lactobacillus helveticus (strain DPC 4571) GN=groL PE=3 SV=1 27 146 8.0E-06
sp|Q9AGE6|CH60_LISMO 60 kDa chaperonin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=groL PE=3 SV=1 23 223 9.0E-06
sp|B8DH59|CH60_LISMH 60 kDa chaperonin OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=groL PE=3 SV=1 23 223 9.0E-06
sp|Q71XU6|CH60_LISMF 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain F2365) GN=groL PE=3 SV=1 23 223 9.0E-06
sp|C1KX21|CH60_LISMC 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=groL PE=3 SV=1 23 223 9.0E-06
sp|A0AKH5|CH60_LISW6 60 kDa chaperonin OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=groL PE=3 SV=1 23 223 1.0E-05
sp|Q13NE4|CH604_BURXL 60 kDa chaperonin 4 OS=Burkholderia xenovorans (strain LB400) GN=groL4 PE=3 SV=1 30 186 1.0E-05
sp|B7GFR6|CH60_ANOFW 60 kDa chaperonin OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=groL PE=3 SV=1 27 146 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7530
MSLNIPGAPNAGLFKHGYNNYDSEDGAVLRNIDACRAIASTVQTSLGPYGRNKVVINHLQKMILTSDAATILREL
DVVHPAAKLLVMASQQQESEMGDATNLVIVLAGELLRKAEDLLRMGLKTSDIVAGYEKAQKLALDALEKLAVDKV
DDIRDREELGKAIRTVVASKQNGSEDLLAQLVAEAVLAVLPKNPAQFNVDNVRVVKIMGGSLEQSRVVRGMVFAK
EPDGSVKKARRAKVAVFTCPIDTSQTETKGTVLLHNAKEMMDFTKGEESQVEAAVRGLHDAGIRVVVCGDRIGDL
AMHYLNRFGILAIRILSKFELRRVCRVVGATPLARLGAPMPDEAGSIDVVETLEIGGDRVTVFRQEDEATRTATL
VLRGATQNHLDDVERAVDDGVNVVKAITRDPRLVPGAGATEIQLSARVQAQGEKTPGLAQYAIRKYGEAFEVVPR
TLAESCGLDATEVLSTLYAAHHKGDNADTGVDVENNDDSGTLDATDDGILDLLAPKHWAIKLATEAARTILSVDQ
IIVARQAGGPKPPGPNPNWDED*
Coding >Hirsu2|7530
ATGTCCCTCAACATCCCCGGCGCGCCCAACGCGGGCCTTTTCAAGCACGGCTACAACAACTACGACTCGGAAGAT
GGCGCCGTCCTGCGCAACATCGACGCCTGCCGGGCCATCGCCTCGACCGTCCAGACGTCGCTCGGCCCCTACGGC
CGCAACAAGGTCGTCATCAACCACCTGCAGAAGATGATACTCACCTCGGACGCCGCCACCATCCTGCGCGAGCTC
GACGTCGTCCACCCCGCCGCCAAGCTGCTCGTCATGGCCAGCCAGCAGCAGGAGTCGGAGATGGGCGACGCCACC
AACCTCGTCATCGTCCTCGCCGGCGAGCTGCTGCGCAAGGCCGAGGACCTGCTGCGCATGGGGCTCAAGACGTCC
GACATCGTGGCCGGCTACGAGAAGGCCCAGAAGCTGGCCCTGGACGCGCTCGAGAAGCTGGCCGTCGACAAGGTC
GACGACATCCGCGACCGCGAGGAGCTGGGCAAGGCCATCCGCACCGTCGTCGCTAGCAAGCAGAACGGCAGCGAG
GACCTGCTGGCCCAGCTCGTCGCCGAGGCCGTCCTGGCCGTGCTGCCCAAGAACCCGGCCCAGTTCAACGTCGAC
AACGTGCGGGTCGTCAAGATCATGGGCGGCAGCCTGGAGCAGAGCCGGGTCGTGCGCGGCATGGTCTTCGCCAAG
GAGCCCGACGGGTCGGTCAAGAAGGCGCGCCGCGCCAAGGTCGCTGTCTTCACCTGCCCCATCGACACGAGCCAG
ACCGAGACCAAGGGCACCGTCCTCCTCCACAACGCCAAGGAGATGATGGACTTCACCAAGGGCGAGGAGAGCCAG
GTGGAGGCGGCCGTGCGCGGGCTGCACGACGCCGGCATCCGCGTCGTCGTCTGCGGCGACCGCATCGGCGACCTG
GCCATGCACTACCTCAACCGCTTCGGCATCCTCGCCATCCGCATCCTCAGCAAGTTCGAGCTGCGCCGGGTGTGC
CGCGTCGTCGGCGCCACGCCGCTGGCCCGCCTGGGCGCCCCCATGCCCGACGAGGCCGGCAGCATCGACGTGGTC
GAGACGCTCGAGATCGGCGGCGATCGCGTCACCGTCTTCCGGCAGGAGGACGAGGCGACGCGGACGGCGACGCTG
GTCCTGCGCGGCGCCACCCAGAACCACCTGGACGACGTGGAGCGCGCCGTCGACGACGGCGTCAACGTCGTCAAG
GCCATCACCCGCGACCCGCGCCTCGTCCCCGGCGCCGGCGCCACCGAGATCCAGCTGAGCGCCCGGGTCCAGGCC
CAGGGCGAGAAGACGCCCGGCCTGGCCCAGTACGCCATCCGCAAGTACGGCGAGGCCTTCGAGGTCGTGCCCCGC
ACCCTGGCCGAGAGCTGCGGTCTCGACGCGACCGAGGTCCTGAGCACCCTCTACGCCGCCCACCACAAAGGCGAC
AACGCCGACACGGGCGTCGACGTCGAGAACAACGACGACAGCGGCACGCTCGACGCCACCGACGACGGCATCCTC
GACCTGCTGGCCCCCAAGCACTGGGCCATCAAGCTGGCCACCGAGGCCGCCCGCACCATTCTCTCCGTCGACCAG
ATCATCGTCGCGCGCCAGGCCGGCGGGCCCAAGCCGCCCGGGCCCAACCCCAACTGGGACGAGGACTAG
Transcript >Hirsu2|7530
ATGTCCCTCAACATCCCCGGCGCGCCCAACGCGGGCCTTTTCAAGCACGGCTACAACAACTACGACTCGGAAGAT
GGCGCCGTCCTGCGCAACATCGACGCCTGCCGGGCCATCGCCTCGACCGTCCAGACGTCGCTCGGCCCCTACGGC
CGCAACAAGGTCGTCATCAACCACCTGCAGAAGATGATACTCACCTCGGACGCCGCCACCATCCTGCGCGAGCTC
GACGTCGTCCACCCCGCCGCCAAGCTGCTCGTCATGGCCAGCCAGCAGCAGGAGTCGGAGATGGGCGACGCCACC
AACCTCGTCATCGTCCTCGCCGGCGAGCTGCTGCGCAAGGCCGAGGACCTGCTGCGCATGGGGCTCAAGACGTCC
GACATCGTGGCCGGCTACGAGAAGGCCCAGAAGCTGGCCCTGGACGCGCTCGAGAAGCTGGCCGTCGACAAGGTC
GACGACATCCGCGACCGCGAGGAGCTGGGCAAGGCCATCCGCACCGTCGTCGCTAGCAAGCAGAACGGCAGCGAG
GACCTGCTGGCCCAGCTCGTCGCCGAGGCCGTCCTGGCCGTGCTGCCCAAGAACCCGGCCCAGTTCAACGTCGAC
AACGTGCGGGTCGTCAAGATCATGGGCGGCAGCCTGGAGCAGAGCCGGGTCGTGCGCGGCATGGTCTTCGCCAAG
GAGCCCGACGGGTCGGTCAAGAAGGCGCGCCGCGCCAAGGTCGCTGTCTTCACCTGCCCCATCGACACGAGCCAG
ACCGAGACCAAGGGCACCGTCCTCCTCCACAACGCCAAGGAGATGATGGACTTCACCAAGGGCGAGGAGAGCCAG
GTGGAGGCGGCCGTGCGCGGGCTGCACGACGCCGGCATCCGCGTCGTCGTCTGCGGCGACCGCATCGGCGACCTG
GCCATGCACTACCTCAACCGCTTCGGCATCCTCGCCATCCGCATCCTCAGCAAGTTCGAGCTGCGCCGGGTGTGC
CGCGTCGTCGGCGCCACGCCGCTGGCCCGCCTGGGCGCCCCCATGCCCGACGAGGCCGGCAGCATCGACGTGGTC
GAGACGCTCGAGATCGGCGGCGATCGCGTCACCGTCTTCCGGCAGGAGGACGAGGCGACGCGGACGGCGACGCTG
GTCCTGCGCGGCGCCACCCAGAACCACCTGGACGACGTGGAGCGCGCCGTCGACGACGGCGTCAACGTCGTCAAG
GCCATCACCCGCGACCCGCGCCTCGTCCCCGGCGCCGGCGCCACCGAGATCCAGCTGAGCGCCCGGGTCCAGGCC
CAGGGCGAGAAGACGCCCGGCCTGGCCCAGTACGCCATCCGCAAGTACGGCGAGGCCTTCGAGGTCGTGCCCCGC
ACCCTGGCCGAGAGCTGCGGTCTCGACGCGACCGAGGTCCTGAGCACCCTCTACGCCGCCCACCACAAAGGCGAC
AACGCCGACACGGGCGTCGACGTCGAGAACAACGACGACAGCGGCACGCTCGACGCCACCGACGACGGCATCCTC
GACCTGCTGGCCCCCAAGCACTGGGCCATCAAGCTGGCCACCGAGGCCGCCCGCACCATTCTCTCCGTCGACCAG
ATCATCGTCGCGCGCCAGGCCGGCGGGCCCAAGCCGCCCGGGCCCAACCCCAACTGGGACGAGGACTAG
Gene >Hirsu2|7530
ATGTCCCTCAACATCCCCGGCGCGCCCAACGCGGGCCTTTTCAAGCACGGCTACAACAAGTGAGTGGCAAGACCG
GTACGGCCGGCCTCCCTCCCATGGCCCCGAAGCGCCCAAGCCAACCATGACCGTGTTCGCAGCTACGACTCGGAA
GATGGCGCCGTCCTGCGCAACATCGACGCCTGCCGGGCCATCGCCTCGACCGTCCAGACGTCGCTCGGCCCCTAC
GGCCGCAACAAGGTCGTCATCAACCACCTGCAGAAGATGATACTCACCTCGGACGCCGCCACCATCCTGCGCGAG
CTCGACGTCGTCCACCCCGCCGCCAAGCTGCTCGTCATGGCCAGCCAGCAGCAGGAGTCGGAGATGGGCGACGCC
ACCAACCTCGTCATCGTCCTCGCCGGCGAGCTGCTGCGCAAGGCCGAGGACCTGCTGCGCATGGGGCTCAAGACG
TCCGACATCGTGGCCGGCTACGAGAAGGCCCAGAAGCTGGCCCTGGACGCGCTCGAGAAGCTGGCCGTCGACAAG
GTCGACGACATCCGCGACCGCGAGGAGCTGGGCAAGGCCATCCGCACCGTCGTCGCTAGCAAGCAGAACGGCAGC
GAGGACCTGCTGGCCCAGCTCGTCGCCGAGGCCGTCCTGGCCGTGCTGCCCAAGAACCCGGCCCAGTTCAACGTC
GACAACGTGCGGGTCGTCAAGATCATGGGCGGCAGCCTGGAGCAGAGCCGGGTCGTGCGCGGCATGGTCTTCGCC
AAGGAGCCCGACGGGTCGGTCAAGAAGGCGCGCCGCGCCAAGGTCGCTGTCTTCACCTGCCCCATCGACACGAGC
CAGACCGAGACCAAGGGCACCGTCCTCCTCCACAACGCCAAGGAGATGATGGACTTCACCAAGGGCGAGGAGAGC
CAGGTGGAGGCGGCCGTGCGCGGGCTGCACGACGCCGGCATCCGCGTCGTCGTCTGCGGCGACCGCATCGGCGAC
CTGGCCATGCACTACCTCAACCGCTTCGGCATCCTCGCCATCCGCATCCTCAGCAAGTTCGAGCTGCGCCGGGTG
TGCCGCGTCGTCGGCGCCACGCCGCTGGCCCGCCTGGGCGCCCCCATGCCCGACGAGGCCGGCAGCATCGACGTG
GTCGAGACGCTCGAGATCGGCGGCGATCGCGTCACCGTCTTCCGGCAGGAGGACGAGGCGACGCGGACGGCGACG
CTGGTCCTGCGCGGCGCCACCCAGAACCACCTGGACGACGTGGAGCGCGCCGTCGACGACGGCGTCAACGTCGTC
AAGGCCATCACCCGCGACCCGCGCCTCGTCCCCGGCGCCGGCGCCACCGAGATCCAGCTGAGCGCCCGGGTCCAG
GCCCAGGGCGAGAAGACGCCCGGCCTGGCCCAGTACGCCATCCGCAAGTACGGCGAGGCCTTCGAGGTCGTGCCC
CGCACCCTGGCCGAGAGCTGCGGTCTCGACGCGACCGAGGTCCTGAGCACCCTCTACGCCGCCCACCACAAAGGC
GACAACGCCGACACGGGCGTCGACGTCGAGGTGAGCTCGCCCGCCTGCCCGCCCGCCAAGGAGAGGCACGTACGC
TGACGGGCGCCCCGCAGAACAACGACGACAGCGGCACGCTCGACGCCACCGACGACGGCATCCTCGACCTGCTGG
CCCCCAAGCACTGGGCCATCAAGCTGGCCACCGAGGCCGCCCGCACCATTCTCTCCGTCGACCAGATCATCGTCG
CGCGCCAGGCCGGCGGGCCCAAGCCGCCCGGGCCCAACCCCGTACGTTTCTTCCTCCCCATGTCCCTACTGACTC
GACACTTTTTTTTTTTTTCTTTGCTAACGTTCCGATCCCCCCGTTTCTCGGTTGCAGAACTGGGACGAGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail