Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7526
Gene name
LocationContig_442:7537..9313
Strand-
Gene length (bp)1776
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02582 DUF155 RMND1/Sif2-Sif3/Mrx10, DUF155 5.8E-53 297 468

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74446|SIF2_SCHPO Sad1-interacting factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif2 PE=1 SV=2 95 516 4.0E-128
sp|Q03441|RMD1_YEAST Sporulation protein RMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD1 PE=1 SV=1 48 521 5.0E-117
sp|P43620|RMD8_YEAST Sporulation protein RMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD8 PE=1 SV=1 296 515 1.0E-44
sp|Q09877|SIF3_SCHPO Sad1-interacting factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif3 PE=1 SV=2 92 482 5.0E-41
sp|Q9NWS8|RMND1_HUMAN Required for meiotic nuclear division protein 1 homolog OS=Homo sapiens GN=RMND1 PE=1 SV=2 297 507 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74446|SIF2_SCHPO Sad1-interacting factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif2 PE=1 SV=2 95 516 4.0E-128
sp|Q03441|RMD1_YEAST Sporulation protein RMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD1 PE=1 SV=1 48 521 5.0E-117
sp|P43620|RMD8_YEAST Sporulation protein RMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD8 PE=1 SV=1 296 515 1.0E-44
sp|Q09877|SIF3_SCHPO Sad1-interacting factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif3 PE=1 SV=2 92 482 5.0E-41
sp|Q9NWS8|RMND1_HUMAN Required for meiotic nuclear division protein 1 homolog OS=Homo sapiens GN=RMND1 PE=1 SV=2 297 507 2.0E-23
sp|Q8CI78|RMND1_MOUSE Required for meiotic nuclear division protein 1 homolog OS=Mus musculus GN=Rmnd1 PE=1 SV=1 297 507 5.0E-23
sp|Q5RAR5|RMND1_PONAB Required for meiotic nuclear division protein 1 homolog OS=Pongo abelii GN=RMND1 PE=2 SV=1 297 507 2.0E-22
sp|Q05648|MRX10_YEAST MIOREX complex component 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX10 PE=1 SV=1 303 506 2.0E-19
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1211 0.0485 0.0088 0.3309 0.1248 0.0121 0.4717 0.2944 0.7169 0.0744

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 496 515 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3825
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6988
Ophiocordyceps australis map64 (Brazil) OphauB2|5179
Ophiocordyceps camponoti-floridani Ophcf2|06528
Ophiocordyceps camponoti-rufipedis Ophun1|6821
Ophiocordyceps kimflemingae Ophio5|6625
Ophiocordyceps subramaniannii Hirsu2|7526 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7526
MEARGSQDENAPLLANQPASPDSRPKNARTVTFSADPVTRTIEPEPMLIHSGQNAPVAAGNAVQPPALAALNNKL
RRRYSHGAAPAAVPAPAGAKIGPQRSTKKTEKLKLLPNPDFEDGEDEESGRDVYSQYTRIKDPTARRDAARLGKS
DRSRLPRVTAYSTANKYDMEGLMRFLKGRGKTRGANPKLIDECIYTPYAYGKPGDPRLRPVRRRSRRHSTGGETF
DAESRRQLARDDLRDSSTHDSGYGDDFPADDVHPDADVGGDGLLEPEGLDDMPVAESETAPDFDTQVHTPEVFLF
DYGVVVVWGMQEAQEARFLRDIAKFEIEKLSPDDVETEHFNFYYTREYQARIYNDFITLRDKHNYMTKLAISHAL
AQSVKTSLFEELIASTIDTCKDIPTQIALTGKINLSRSQINMQIGELFILRINIHLNGSVLDTPELFWVEPQLEP
VYQAVRSYLEMDQRVELLTERLDVIADLLAVLKDQLSHGHDEKLEWIVIVLIAMEILVAAVNIVVDIYAGEA*
Coding >Hirsu2|7526
ATGGAGGCTCGGGGAAGCCAGGACGAGAACGCGCCTCTCCTGGCGAACCAGCCCGCGTCGCCCGACAGCCGGCCC
AAGAACGCGCGCACCGTCACCTTCAGCGCCGACCCCGTCACCAGGACCATCGAGCCCGAGCCGATGCTCATTCAT
TCCGGCCAAAACGCCCCAGTCGCCGCCGGCAATGCCGTCCAGCCCCCCGCGCTCGCCGCCCTGAACAACAAGCTC
CGCCGGCGATACAGCCACGGCGCCGCCCCGGCCGCCGTCCCTGCTCCCGCCGGTGCCAAGATTGGGCCTCAGAGG
AGCACGAAGAAGACGGAGAAGCTCAAGCTTCTGCCCAACCCCGACTTCGAGGACGGCGAGGACGAGGAGAGCGGC
CGAGACGTCTACTCGCAGTACACCCGCATCAAGGACCCGACCGCCAGGAGAGATGCGGCCCGGCTGGGGAAGAGC
GACCGCAGCCGGCTCCCTCGCGTGACGGCCTACTCGACCGCCAACAAGTATGACATGGAGGGCCTCATGCGCTTC
CTCAAGGGCCGCGGCAAGACCCGCGGCGCCAACCCCAAGCTCATCGACGAGTGCATATACACCCCCTACGCCTAC
GGCAAGCCCGGCGACCCGCGTCTCCGTCCGGTGCGCCGACGCAGCCGTCGTCACTCGACCGGCGGCGAGACCTTT
GACGCCGAGTCGCGCCGCCAGCTGGCCCGCGACGACCTGCGCGACTCGTCGACGCACGACTCGGGATACGGAGAC
GACTTCCCGGCCGACGACGTCCACCCGGATGCCGACGTCGGCGGCGACGGGCTGCTCGAACCCGAAGGCTTGGAC
GACATGCCCGTCGCCGAGTCGGAGACCGCGCCCGACTTTGACACCCAGGTGCACACGCCCGAGGTCTTCCTCTTC
GACTACGGCGTCGTCGTCGTCTGGGGCATGCAGGAGGCTCAGGAGGCTCGCTTCCTCCGCGACATTGCCAAGTTC
GAGATCGAAAAGCTCTCGCCCGACGACGTCGAGACGGAACACTTCAACTTCTACTACACCCGCGAGTACCAGGCG
CGCATCTACAACGACTTCATCACGCTGCGCGACAAGCACAACTACATGACCAAGCTGGCCATCTCGCATGCTCTC
GCGCAGAGCGTCAAGACGTCCCTGTTCGAGGAACTCATCGCCTCCACCATTGATACGTGCAAAGACATCCCGACA
CAGATTGCCCTGACGGGCAAGATCAACCTGAGCCGGTCCCAGATCAACATGCAGATCGGCGAGCTCTTCATCCTC
CGCATCAACATCCACCTCAACGGCTCCGTCCTCGACACGCCCGAGCTCTTCTGGGTCGAACCCCAGCTGGAGCCC
GTCTACCAGGCCGTGCGGAGCTACCTGGAGATGGACCAGCGCGTCGAGCTCCTGACGGAGCGCCTGGATGTCATC
GCCGACTTACTGGCCGTTCTCAAGGACCAGCTGAGCCACGGCCACGACGAGAAGCTCGAGTGGATCGTGATCGTG
CTGATTGCCATGGAAATCCTCGTCGCGGCCGTGAACATCGTGGTGGACATCTACGCCGGCGAAGCATGA
Transcript >Hirsu2|7526
ATGGAGGCTCGGGGAAGCCAGGACGAGAACGCGCCTCTCCTGGCGAACCAGCCCGCGTCGCCCGACAGCCGGCCC
AAGAACGCGCGCACCGTCACCTTCAGCGCCGACCCCGTCACCAGGACCATCGAGCCCGAGCCGATGCTCATTCAT
TCCGGCCAAAACGCCCCAGTCGCCGCCGGCAATGCCGTCCAGCCCCCCGCGCTCGCCGCCCTGAACAACAAGCTC
CGCCGGCGATACAGCCACGGCGCCGCCCCGGCCGCCGTCCCTGCTCCCGCCGGTGCCAAGATTGGGCCTCAGAGG
AGCACGAAGAAGACGGAGAAGCTCAAGCTTCTGCCCAACCCCGACTTCGAGGACGGCGAGGACGAGGAGAGCGGC
CGAGACGTCTACTCGCAGTACACCCGCATCAAGGACCCGACCGCCAGGAGAGATGCGGCCCGGCTGGGGAAGAGC
GACCGCAGCCGGCTCCCTCGCGTGACGGCCTACTCGACCGCCAACAAGTATGACATGGAGGGCCTCATGCGCTTC
CTCAAGGGCCGCGGCAAGACCCGCGGCGCCAACCCCAAGCTCATCGACGAGTGCATATACACCCCCTACGCCTAC
GGCAAGCCCGGCGACCCGCGTCTCCGTCCGGTGCGCCGACGCAGCCGTCGTCACTCGACCGGCGGCGAGACCTTT
GACGCCGAGTCGCGCCGCCAGCTGGCCCGCGACGACCTGCGCGACTCGTCGACGCACGACTCGGGATACGGAGAC
GACTTCCCGGCCGACGACGTCCACCCGGATGCCGACGTCGGCGGCGACGGGCTGCTCGAACCCGAAGGCTTGGAC
GACATGCCCGTCGCCGAGTCGGAGACCGCGCCCGACTTTGACACCCAGGTGCACACGCCCGAGGTCTTCCTCTTC
GACTACGGCGTCGTCGTCGTCTGGGGCATGCAGGAGGCTCAGGAGGCTCGCTTCCTCCGCGACATTGCCAAGTTC
GAGATCGAAAAGCTCTCGCCCGACGACGTCGAGACGGAACACTTCAACTTCTACTACACCCGCGAGTACCAGGCG
CGCATCTACAACGACTTCATCACGCTGCGCGACAAGCACAACTACATGACCAAGCTGGCCATCTCGCATGCTCTC
GCGCAGAGCGTCAAGACGTCCCTGTTCGAGGAACTCATCGCCTCCACCATTGATACGTGCAAAGACATCCCGACA
CAGATTGCCCTGACGGGCAAGATCAACCTGAGCCGGTCCCAGATCAACATGCAGATCGGCGAGCTCTTCATCCTC
CGCATCAACATCCACCTCAACGGCTCCGTCCTCGACACGCCCGAGCTCTTCTGGGTCGAACCCCAGCTGGAGCCC
GTCTACCAGGCCGTGCGGAGCTACCTGGAGATGGACCAGCGCGTCGAGCTCCTGACGGAGCGCCTGGATGTCATC
GCCGACTTACTGGCCGTTCTCAAGGACCAGCTGAGCCACGGCCACGACGAGAAGCTCGAGTGGATCGTGATCGTG
CTGATTGCCATGGAAATCCTCGTCGCGGCCGTGAACATCGTGGTGGACATCTACGCCGGCGAAGCATGA
Gene >Hirsu2|7526
ATGGAGGCTCGGGGAAGCCAGGACGAGAACGCGCCTCTCCTGGCGAACCAGCCCGCGTCGCCCGACAGCCGGCCC
AAGAACGCGCGCACCGTCACCTTCAGCGCCGACCCCGTCACCAGGACCATCGAGCCCGAGCCGATGCTCATTCAT
TCCGGCCAAAACGCCCCAGTCGCCGCCGGCAATGCCGTCCAGCCCCCCGCGCTCGCCGCCCTGAACAACAAGCTC
CGCCGGCGATACAGCCACGGCGCCGCCCCGGCCGCCGTCCCTGCTCCCGCCGGTGCCAAGATTGGGCCTCAGAGG
AGCACGAAGAAGACGGAGAAGCTCAAGCTTCTGCCCAACCCCGACTTCGAGGACGGCGAGGACGAGGAGAGCGGC
CGAGACGTCTACTCGCAGTACACCCGCATCAAGGACCCGACCGCCAGGAGAGATGCGGCCCGGCTGGGGAAGAGC
GACCGCAGCCGGCTCCCTCGCGTGACGGCCTACTCGACCGCCAACAAGTATGACATGGAGGGCCTCATGCGCTTC
CTCAAGGGCCGCGGCAAGACCCGCGGCGCCAACCCCAAGCTCATCGACGAGTGCATATACACCCCCTACGCCTAC
GGCAAGCCCGGCGACCCGCGTCTCCGTCCGGTGCGCCGACGCAGCCGTCGTCACTCGACCGGCGGCGAGACCTTT
GACGCCGAGTCGCGCCGCCAGCTGGCCCGCGACGACCTGCGCGACTCGTCGACGCACGACTCGGGATACGGAGAC
GACTTCCCGGCCGACGACGTCCACCCGGATGCCGACGTCGGCGGCGACGGGCTGCTCGAACCCGAAGGCTTGGAC
GACATGCCCGTCGCCGAGTCGGAGACCGCGCCCGACTTTGACACCCAGGTGCACACGCCCGAGGTCTTCCTCTTC
GACTACGGCGTCGTCGTCGTCTGGGGCATGCAGGAGGCTCAGGAGGCTCGCTTCCTCCGCGACATTGCCAAGTTC
GAGATCGAAAAGCTCTCGCCCGACGACGTCGAGACGGAACACTTCAACTTCTACTACACCCGCGAGTACCAGGCG
CGCATCTACAACGACTTCATCACGCTGCGCGACAAGCACAACTACATGACCAAGCTGGCCATCTCGCATGCTCTC
GCGCAGAGCGTCAAGGTACGTTTGGCTTGCTCTCCCCCCCTCCCCGCCGGCATTTGCCCACCCGGCTGGTCTCTA
TCTCTCGCCCGAGGCACATGGTGACCGAAGCCCGGCGGACAGACGTCCCTGTTCGAGGAACTCATCGCCTCCACC
ATTGATACGTGCAAAGACATCCCGACACAGATTGCCCTGACGGGCAAGATCAACCTGAGCCGGTCCCAGATCAAC
ATGCAGATCGGCGAGCTCTTCATCCTCCGCATCAACATCCACCTCAACGGCTCCGTCCTCGACACGCCCGAGCTC
TTCTGGGTCGAACCCCAGCTGGAGCCCGTCTACCAGGCCGTGCGGAGCTACCTGGAGATGGACCAGCGCGTCGAG
CTCCTGACGGAGCGCCTGGATGTCATCGCCGACTTACTGGCCGTTCTCAAGGACCAGCTGAGCCACGGCCACGAC
GAGAAGCTCGAGTGGATCGGTGAGCCCCCCCCATCTTTTTCCTCTTCCCGCACCCTGGCGTTTCCGACCGGGTGG
CGAGCCGGCGCTGACGGTGTGGCCTTGTCCATTACCACGTATCCTGCAGTGATCGTGCTGATTGCCATGGAAATC
CTCGTCGCGGCCGTGAACATCGTGGTGGACATCTACGCCGGCGAAGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail