Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7523
Gene name
LocationContig_442:3133..3900
Strand-
Gene length (bp)767
Transcript length (bp)279
Coding sequence length (bp)279
Protein length (aa) 93

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01780 Ribosomal_L37ae Ribosomal L37ae protein family 2.2E-40 4 88

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q751L1|RL43_ASHGO 60S ribosomal protein L43 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL43 PE=3 SV=1 1 91 6.0E-43
sp|Q6FRG6|RL43_CANGA 60S ribosomal protein L43 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL43 PE=3 SV=1 1 91 1.0E-42
sp|O61598|RL37A_OSTOS 60S ribosomal protein L37a OS=Ostertagia ostertagi GN=rpl-37a PE=3 SV=3 1 91 3.0E-42
sp|Q9VMU4|RL37A_DROME 60S ribosomal protein L37a OS=Drosophila melanogaster GN=RpL37A PE=1 SV=3 1 91 3.0E-42
sp|Q54UG4|RL37A_DICDI 60S ribosomal protein L37a OS=Dictyostelium discoideum GN=rpl37A PE=3 SV=1 1 89 7.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q751L1|RL43_ASHGO 60S ribosomal protein L43 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL43 PE=3 SV=1 1 91 6.0E-43
sp|Q6FRG6|RL43_CANGA 60S ribosomal protein L43 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL43 PE=3 SV=1 1 91 1.0E-42
sp|O61598|RL37A_OSTOS 60S ribosomal protein L37a OS=Ostertagia ostertagi GN=rpl-37a PE=3 SV=3 1 91 3.0E-42
sp|Q9VMU4|RL37A_DROME 60S ribosomal protein L37a OS=Drosophila melanogaster GN=RpL37A PE=1 SV=3 1 91 3.0E-42
sp|Q54UG4|RL37A_DICDI 60S ribosomal protein L37a OS=Dictyostelium discoideum GN=rpl37A PE=3 SV=1 1 89 7.0E-42
sp|P0CX26|RL43B_YEAST 60S ribosomal protein L43-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL43B PE=1 SV=1 1 91 1.0E-41
sp|P0CX25|RL43A_YEAST 60S ribosomal protein L43-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL43A PE=1 SV=1 1 91 1.0E-41
sp|O61462|RL37A_CRYST 60S ribosomal protein L37a OS=Cryptochiton stelleri GN=RPL37A PE=3 SV=3 1 91 8.0E-41
sp|Q9ZRS8|RL37A_PSEMZ 60S ribosomal protein L37a OS=Pseudotsuga menziesii GN=RPL37A PE=3 SV=1 1 91 7.0E-40
sp|Q9XHE4|RL37A_GOSHI 60S ribosomal protein L37a OS=Gossypium hirsutum GN=RPL37A PE=3 SV=1 1 91 7.0E-39
sp|Q5QM99|RL37A_ORYSJ 60S ribosomal protein L37a OS=Oryza sativa subsp. japonica GN=Os01g0679700 PE=1 SV=1 1 91 7.0E-39
sp|Q8RXU5|R37A2_ARATH 60S ribosomal protein L37a-2 OS=Arabidopsis thaliana GN=RPL37AC PE=3 SV=1 1 91 4.0E-38
sp|P32046|RL37A_CHICK 60S ribosomal protein L37a OS=Gallus gallus GN=RPL37A PE=3 SV=2 1 91 1.0E-37
sp|P61515|RL37P_RAT Putative 60S ribosomal protein L37a OS=Rattus norvegicus GN=Rpl37a-ps1 PE=5 SV=2 1 91 1.0E-37
sp|Q5RBF9|RL37A_PONAB 60S ribosomal protein L37a OS=Pongo abelii GN=RPL37A PE=3 SV=3 1 91 1.0E-37
sp|P61514|RL37A_MOUSE 60S ribosomal protein L37a OS=Mus musculus GN=Rpl37a PE=1 SV=2 1 91 1.0E-37
sp|P61513|RL37A_HUMAN 60S ribosomal protein L37a OS=Homo sapiens GN=RPL37A PE=1 SV=2 1 91 1.0E-37
sp|Q3MIC0|RL37A_BOVIN 60S ribosomal protein L37a OS=Bos taurus GN=RPL37A PE=3 SV=3 1 91 1.0E-37
sp|Q9U2A8|RL37A_CAEEL 60S ribosomal protein L37a OS=Caenorhabditis elegans GN=rpl-43 PE=3 SV=3 1 91 3.0E-37
sp|Q90YT0|RL37A_ICTPU 60S ribosomal protein L37a OS=Ictalurus punctatus GN=rpl37a PE=3 SV=3 1 91 5.0E-37
sp|Q9SRK6|R37A1_ARATH Putative 60S ribosomal protein L37a-1 OS=Arabidopsis thaliana GN=RPL37AB PE=3 SV=1 1 91 6.0E-37
sp|Q7SZB4|RL37A_XENLA 60S ribosomal protein L37a OS=Xenopus laevis GN=rpl37a PE=3 SV=3 1 91 1.0E-36
sp|P43209|RL37A_BRARR 60S ribosomal protein L37a OS=Brassica rapa subsp. rapa GN=RPL37A PE=3 SV=2 1 91 3.0E-36
sp|A4S6Z4|RL37A_OSTLU 60S ribosomal protein L37a OS=Ostreococcus lucimarinus (strain CCE9901) GN=RPL37a PE=3 SV=1 1 91 4.0E-36
sp|Q00VK4|RL37A_OSTTA 60S ribosomal protein L37a OS=Ostreococcus tauri GN=RPL37a PE=3 SV=2 1 91 2.0E-35
sp|Q23G98|RL37A_TETTS 60S ribosomal protein L37a OS=Tetrahymena thermophila (strain SB210) GN=RPL37A PE=1 SV=1 1 88 6.0E-35
sp|Q9Y0H7|RL37A_MYXGL 60S ribosomal protein L37a (Fragment) OS=Myxine glutinosa GN=rpl37a PE=2 SV=1 8 91 1.0E-34
sp|O96184|RL37A_PLAF7 60S ribosomal protein L37a OS=Plasmodium falciparum (isolate 3D7) GN=RPL37A PE=1 SV=1 1 91 2.0E-32
sp|O17307|RL37A_SCHMA 60S ribosomal protein L37a (Fragment) OS=Schistosoma mansoni PE=2 SV=1 2 91 9.0E-32
sp|D4AAZ6|RL37A_RAT 60S ribosomal protein L37a OS=Rattus norvegicus GN=Rpl37a PE=1 SV=1 1 69 4.0E-31
sp|O94686|RL43B_SCHPO 60S ribosomal protein L43-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl4302 PE=3 SV=1 1 92 5.0E-30
sp|Q9HGL8|RL43A_SCHPO 60S ribosomal protein L43-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl4301 PE=3 SV=1 1 92 7.0E-30
sp|A6NKH3|RL37L_HUMAN Putative 60S ribosomal protein L37a-like protein OS=Homo sapiens GN=RPL37AP8 PE=5 SV=2 1 91 1.0E-24
sp|C6A452|RL37A_THESM 50S ribosomal protein L37Ae OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl37ae PE=3 SV=1 4 76 1.0E-19
sp|Q8TZI4|RL37A_PYRFU 50S ribosomal protein L37Ae OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl37ae PE=1 SV=1 5 80 3.0E-19
sp|Q5JDM6|RL37A_THEKO 50S ribosomal protein L37Ae OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl37ae PE=3 SV=1 4 75 4.0E-18
sp|C5A4Z4|RL37A_THEGJ 50S ribosomal protein L37Ae OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl37ae PE=3 SV=1 4 75 5.0E-18
sp|Q9V202|RL37A_PYRAB 50S ribosomal protein L37Ae OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl37ae PE=3 SV=1 5 76 7.0E-18
sp|B6YTZ8|RL37A_THEON 50S ribosomal protein L37Ae OS=Thermococcus onnurineus (strain NA1) GN=rpl37ae PE=3 SV=1 4 75 1.0E-17
sp|P54051|RL37A_METJA 50S ribosomal protein L37Ae OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl37ae PE=3 SV=1 1 91 2.0E-17
sp|O26777|RL37A_METTH 50S ribosomal protein L37Ae OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl37ae PE=3 SV=1 4 86 5.0E-17
sp|A5UNQ7|RL37A_METS3 50S ribosomal protein L37Ae OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl37ae PE=3 SV=1 4 89 6.0E-17
sp|O74106|RL37A_PYRHO 50S ribosomal protein L37Ae OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl37ae PE=3 SV=2 5 83 9.0E-17
sp|B8D6B7|RL37A_DESK1 50S ribosomal protein L37Ae OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rpl37ae PE=3 SV=1 4 85 2.0E-16
sp|Q2NEX3|RL37A_METST 50S ribosomal protein L37Ae OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl37ae PE=3 SV=1 1 86 2.0E-16
sp|Q9YC06|RL37A_AERPE 50S ribosomal protein L37Ae OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl37ae PE=3 SV=1 4 69 3.0E-16
sp|Q8TYC3|RL37A_METKA 50S ribosomal protein L37Ae OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl37ae PE=3 SV=1 4 88 9.0E-16
sp|A6URN7|RL37A_METVS 50S ribosomal protein L37Ae OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl37ae PE=3 SV=1 5 88 2.0E-14
sp|A6UTE9|RL37A_META3 50S ribosomal protein L37Ae OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl37ae PE=3 SV=1 5 88 2.0E-14
sp|Q9HIP0|RL37A_THEAC 50S ribosomal protein L37Ae OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl37ae PE=3 SV=1 1 75 2.0E-14
sp|Q6M0M1|RL37A_METMP 50S ribosomal protein L37Ae OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl37ae PE=3 SV=1 5 88 2.0E-14
sp|Q97BZ3|RL37A_THEVO 50S ribosomal protein L37Ae OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl37ae PE=3 SV=1 1 69 3.0E-14
sp|A4FZT8|RL37A_METM5 50S ribosomal protein L37Ae OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl37ae PE=3 SV=1 5 88 3.0E-14
sp|Q6L225|RL37A_PICTO 50S ribosomal protein L37Ae OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl37ae PE=3 SV=1 1 69 4.0E-14
sp|P60619|RL37A_HALMA 50S ribosomal protein L37Ae OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl37ae PE=1 SV=2 1 84 4.0E-14
sp|O30179|RL37A_ARCFU 50S ribosomal protein L37Ae OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl37ae PE=3 SV=1 4 83 5.0E-14
sp|A9A848|RL37A_METM6 50S ribosomal protein L37Ae OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl37ae PE=3 SV=1 5 88 6.0E-14
sp|A6VIN8|RL37A_METM7 50S ribosomal protein L37Ae OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl37ae PE=3 SV=1 5 88 6.0E-14
sp|Q74N55|RL37A_NANEQ 50S ribosomal protein L37Ae OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl37ae PE=3 SV=1 5 69 5.0E-13
sp|A1RSS8|RL37A_PYRIL 50S ribosomal protein L37Ae OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl37ae PE=3 SV=1 5 73 1.0E-12
sp|Q9HSG8|RL37A_HALSA 50S ribosomal protein L37Ae OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl37ae PE=3 SV=2 8 84 6.0E-12
sp|B0R2Y1|RL37A_HALS3 50S ribosomal protein L37Ae OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl37ae PE=3 SV=1 8 84 6.0E-12
sp|Q8ZVN1|RL37A_PYRAE 50S ribosomal protein L37Ae OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl37ae PE=3 SV=1 5 73 7.0E-12
sp|B1Y976|RL37A_PYRNV 50S ribosomal protein L37Ae OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rpl37ae PE=3 SV=1 5 73 2.0E-11
sp|Q97ZQ3|RL37A_SULSO 50S ribosomal protein L37Ae OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl37ae PE=3 SV=2 6 69 1.0E-08
sp|Q975H0|RL37A_SULTO 50S ribosomal protein L37Ae OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl37ae PE=3 SV=1 6 69 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005622 intracellular Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044267 cellular protein metabolic process No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7523
MTKRTKKVGVTGKYGTRYGASLRKQVKKMEITQHAKYTCTFCGKTTVRRHSVGIWNCKSCKRTMAGGAYIVSTPA
AAAMRSTLRRLREIAEV*
Coding >Hirsu2|7523
ATGACGAAGCGCACGAAGAAGGTCGGCGTGACCGGCAAATACGGTACTCGCTACGGTGCCTCCCTGCGTAAGCAG
GTGAAGAAGATGGAAATCACGCAGCACGCCAAGTACACCTGCACCTTCTGCGGCAAGACGACGGTCCGCCGCCAC
TCGGTCGGCATCTGGAACTGCAAGTCGTGCAAGCGGACCATGGCTGGCGGCGCCTACATTGTCTCGACGCCTGCC
GCCGCCGCCATGCGGTCGACGCTGCGACGTCTGAGGGAAATTGCCGAAGTCTAA
Transcript >Hirsu2|7523
ATGACGAAGCGCACGAAGAAGGTCGGCGTGACCGGCAAATACGGTACTCGCTACGGTGCCTCCCTGCGTAAGCAG
GTGAAGAAGATGGAAATCACGCAGCACGCCAAGTACACCTGCACCTTCTGCGGCAAGACGACGGTCCGCCGCCAC
TCGGTCGGCATCTGGAACTGCAAGTCGTGCAAGCGGACCATGGCTGGCGGCGCCTACATTGTCTCGACGCCTGCC
GCCGCCGCCATGCGGTCGACGCTGCGACGTCTGAGGGAAATTGCCGAAGTCTAA
Gene >Hirsu2|7523
ATGACGAAGCGCACGAAGAAGGTCGGCGTGACGTGCGTATCTCCCGATGATATCCGGCGTCGCGCCTTGCATGCT
AACATTGACGACAGCGGCAAATACGGTACTCGGTAAGTCGCTTGCGCACATCGCCGCCCCATCGTCGACCCGTCT
CGCACGCCGTCGTTCATGCTCGGAGACGAGAACGAGAGGCTCTCCCTCTGTCCTGCCCTGTTACGACGCCATGAC
AGAATGGAGCTCTTCCTGTTCACGGAACACGGCCGCCACACCTGCTGGACTGGATTCGCAGACTTGCACCGCCGC
CGAGCCGACAAATAGACATACAATTCTGCACACACACACACACACACACACACACACACACGTACACACAACTTG
CGCATGGGCATGGCAGGCGGGACGGGCAGGGCCGTGATGGACGCAATAGTCGAACAGAGACGGCGGATACTGACT
TGACACTCGTCGCACAGCTACGGTGCCTCCCTGCGTAAGCAGGTGAAGAAGATGGAAATCACGCAGCACGCCAAG
TACACCTGCACCTTCTGCGGCAAGACGACGGTCCGCCGCCACTCGGTCGGCATCTGGAACTGCAAGTCGTGCAAG
CGGACCATGGCTGGCGGCGCCTACATTGTCTCGTACGTTGACCCGGGCGCTCTCTCGCCGTCTCCAAGCGCCGAC
ACGTGCGGCCACGCTAACCGGCCAGCAGGACGCCTGCCGCCGCCGCCATGCGGTCGACGCTGCGACGTCTGAGGG
AAATTGCCGAAGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail