Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7508
Gene name
LocationContig_44:41745..43747
Strand-
Gene length (bp)2002
Transcript length (bp)1779
Coding sequence length (bp)1779
Protein length (aa) 593

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08016 PKD_channel Polycystin cation channel 1.6E-04 203 399

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5A2J7|YVC1_CANAL Calcium channel YVC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YVC1 PE=2 SV=1 2 517 2.0E-141
sp|Q12324|YVC1_YEAST Calcium channel YVC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YVC1 PE=1 SV=2 6 493 2.0E-122

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

Domain # Start End Length
1 174 191 17
2 206 223 17
3 230 252 22
4 267 289 22
5 310 329 19
6 371 393 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7508
MEESRITTPNSRVITPKVVQAAREAGGQELRGCVVFCLLVNQRWFHREALVELWDSDLHKLRAAACGVVAKAIIE
SEEDLGYLLQAVLLRRYSVIADGLPTTPANVIEKAVDLHAVRVIGSSGYQKCINYLWRGWLVQDQDDPSVFVDYE
NKDNTSFLVHMDPDRMRAPKYQNAAQLLFSLIYLALYTVAINSVNPTGVFDAAEVALYVFTLGFVCDEVVKFYKA
GYHILGFWNAFNGILYAFLTASFVLRIVGLTAPSQSHFRSHYSTLSYNILSFVAPMFWTRLLLYLDSFRFFGAML
VVLKVMMKESLIFFALLVIVVVGFLQAFIGLDLTDDNVAGDAAFIVEAMMKAILQSPEFDGFEGFGPPWGIILYY
CFTFVVMIILLNILIALYNSAYEDIYDNADDEYLALFSHKTLQFVRAPDENVYIAPLNLFEIVISALFEWWMKKT
TYELINDYVMGLLYSPLLFVTAYSETHTAHEIRRNRARGDDDDDVMEEWERLAHELDFEAEGWAKTCDAVKPNLE
DDPAVLEVRKLRAEIGELKAALKEISKAVGITATQKQGTRNEESRDRQPRVGIIGTTESTGTLPDTS*
Coding >Hirsu2|7508
ATGGAAGAGAGCCGCATCACGACCCCCAACAGCCGCGTCATCACGCCCAAGGTCGTCCAGGCGGCGAGGGAAGCC
GGCGGACAAGAGCTCAGAGGCTGCGTCGTCTTCTGCTTGCTTGTCAACCAGCGCTGGTTTCACCGTGAGGCCCTG
GTCGAGCTTTGGGATTCCGACCTCCATAAGCTGCGCGCCGCGGCGTGCGGTGTTGTTGCCAAAGCAATCATCGAG
TCGGAGGAGGACCTGGGCTATTTGTTGCAAGCCGTCCTGCTTCGCCGCTACTCCGTCATTGCCGACGGTCTTCCC
ACGACTCCGGCAAACGTCATCGAGAAAGCCGTTGACCTGCACGCCGTTCGGGTCATCGGATCCTCTGGCTACCAG
AAATGCATCAACTATCTGTGGCGTGGCTGGCTCGTGCAGGACCAGGATGACCCTTCCGTCTTTGTCGACTACGAA
AACAAGGACAACACGAGTTTCCTCGTCCACATGGATCCCGATCGCATGAGGGCACCGAAATACCAAAACGCCGCC
CAGCTGCTCTTTTCCCTCATCTACCTCGCCCTCTACACGGTGGCCATCAACTCCGTCAACCCCACCGGCGTTTTC
GATGCGGCCGAGGTTGCCTTGTACGTCTTCACCCTCGGCTTTGTATGCGATGAAGTCGTCAAGTTTTACAAGGCG
GGATATCACATTTTGGGCTTCTGGAACGCTTTCAATGGCATCTTGTATGCCTTCCTGACGGCCTCTTTCGTCCTT
CGCATCGTCGGCCTGACCGCCCCGAGTCAGTCTCACTTCCGCAGCCATTACAGCACCCTGAGCTATAACATCCTT
TCGTTCGTGGCTCCCATGTTTTGGACGCGGCTGCTCCTCTACCTAGACAGCTTCCGATTCTTCGGCGCCATGCTT
GTCGTGCTCAAAGTCATGATGAAGGAGTCGCTCATATTCTTCGCCTTGCTCGTCATCGTCGTTGTCGGCTTTCTC
CAGGCCTTCATTGGTCTCGATTTGACCGACGACAACGTTGCCGGCGACGCCGCCTTTATCGTCGAGGCCATGATG
AAGGCCATCCTGCAGAGCCCGGAGTTTGATGGCTTTGAGGGGTTCGGGCCCCCGTGGGGCATCATTCTCTACTAC
TGCTTCACTTTCGTTGTCATGATCATCCTTCTCAACATCCTCATTGCTCTTTACAACTCGGCCTACGAAGACATT
TACGATAACGCCGACGACGAGTACCTCGCCCTTTTCTCCCACAAGACGCTGCAATTCGTTCGCGCGCCGGACGAG
AATGTCTACATTGCGCCCCTGAATCTCTTCGAGATCGTCATCTCCGCGCTGTTTGAGTGGTGGATGAAGAAGACG
ACGTACGAGCTCATTAACGACTACGTCATGGGCCTCCTGTACTCTCCTCTCCTCTTTGTGACGGCCTACTCCGAG
ACCCACACAGCACATGAGATCCGGCGAAACCGTGCTCGGGGCGACGACGACGACGACGTGATGGAGGAGTGGGAG
CGACTGGCCCATGAGCTCGATTTCGAAGCCGAAGGCTGGGCCAAGACGTGCGATGCTGTGAAGCCGAACCTGGAA
GACGATCCGGCTGTCCTGGAGGTCAGAAAGCTGCGAGCCGAGATAGGGGAGCTCAAGGCCGCGCTGAAGGAGATA
AGCAAGGCCGTTGGCATCACAGCAACGCAGAAACAAGGCACCAGAAATGAGGAGTCTCGGGACAGGCAACCGCGA
GTTGGAATCATTGGCACGACGGAATCTACGGGAACCCTGCCAGACACCTCTTAG
Transcript >Hirsu2|7508
ATGGAAGAGAGCCGCATCACGACCCCCAACAGCCGCGTCATCACGCCCAAGGTCGTCCAGGCGGCGAGGGAAGCC
GGCGGACAAGAGCTCAGAGGCTGCGTCGTCTTCTGCTTGCTTGTCAACCAGCGCTGGTTTCACCGTGAGGCCCTG
GTCGAGCTTTGGGATTCCGACCTCCATAAGCTGCGCGCCGCGGCGTGCGGTGTTGTTGCCAAAGCAATCATCGAG
TCGGAGGAGGACCTGGGCTATTTGTTGCAAGCCGTCCTGCTTCGCCGCTACTCCGTCATTGCCGACGGTCTTCCC
ACGACTCCGGCAAACGTCATCGAGAAAGCCGTTGACCTGCACGCCGTTCGGGTCATCGGATCCTCTGGCTACCAG
AAATGCATCAACTATCTGTGGCGTGGCTGGCTCGTGCAGGACCAGGATGACCCTTCCGTCTTTGTCGACTACGAA
AACAAGGACAACACGAGTTTCCTCGTCCACATGGATCCCGATCGCATGAGGGCACCGAAATACCAAAACGCCGCC
CAGCTGCTCTTTTCCCTCATCTACCTCGCCCTCTACACGGTGGCCATCAACTCCGTCAACCCCACCGGCGTTTTC
GATGCGGCCGAGGTTGCCTTGTACGTCTTCACCCTCGGCTTTGTATGCGATGAAGTCGTCAAGTTTTACAAGGCG
GGATATCACATTTTGGGCTTCTGGAACGCTTTCAATGGCATCTTGTATGCCTTCCTGACGGCCTCTTTCGTCCTT
CGCATCGTCGGCCTGACCGCCCCGAGTCAGTCTCACTTCCGCAGCCATTACAGCACCCTGAGCTATAACATCCTT
TCGTTCGTGGCTCCCATGTTTTGGACGCGGCTGCTCCTCTACCTAGACAGCTTCCGATTCTTCGGCGCCATGCTT
GTCGTGCTCAAAGTCATGATGAAGGAGTCGCTCATATTCTTCGCCTTGCTCGTCATCGTCGTTGTCGGCTTTCTC
CAGGCCTTCATTGGTCTCGATTTGACCGACGACAACGTTGCCGGCGACGCCGCCTTTATCGTCGAGGCCATGATG
AAGGCCATCCTGCAGAGCCCGGAGTTTGATGGCTTTGAGGGGTTCGGGCCCCCGTGGGGCATCATTCTCTACTAC
TGCTTCACTTTCGTTGTCATGATCATCCTTCTCAACATCCTCATTGCTCTTTACAACTCGGCCTACGAAGACATT
TACGATAACGCCGACGACGAGTACCTCGCCCTTTTCTCCCACAAGACGCTGCAATTCGTTCGCGCGCCGGACGAG
AATGTCTACATTGCGCCCCTGAATCTCTTCGAGATCGTCATCTCCGCGCTGTTTGAGTGGTGGATGAAGAAGACG
ACGTACGAGCTCATTAACGACTACGTCATGGGCCTCCTGTACTCTCCTCTCCTCTTTGTGACGGCCTACTCCGAG
ACCCACACAGCACATGAGATCCGGCGAAACCGTGCTCGGGGCGACGACGACGACGACGTGATGGAGGAGTGGGAG
CGACTGGCCCATGAGCTCGATTTCGAAGCCGAAGGCTGGGCCAAGACGTGCGATGCTGTGAAGCCGAACCTGGAA
GACGATCCGGCTGTCCTGGAGGTCAGAAAGCTGCGAGCCGAGATAGGGGAGCTCAAGGCCGCGCTGAAGGAGATA
AGCAAGGCCGTTGGCATCACAGCAACGCAGAAACAAGGCACCAGAAATGAGGAGTCTCGGGACAGGCAACCGCGA
GTTGGAATCATTGGCACGACGGAATCTACGGGAACCCTGCCAGACACCTCTTAG
Gene >Hirsu2|7508
ATGGAAGAGAGCCGCATCACGACCCCCAACAGCCGCGTCATCACGCCCAAGGTCGTCCAGGCGGCGAGGGAAGCC
GGCGGACAAGAGCTCAGAGGCTGCGTCGTGCGTGCCTATGCCCCAGGCCACCCGAGATCGGCCAATCCACCTGCA
CTCACTGACTGTGGGAGCCCCTCCAGGTCTTCTGCTTGCTTGTCAACCAGCGCTGGTTTCACCGTGAGGCCCTGG
TCGAGCTTTGGGATTCCGACCTCCATAAGCTGCGCGCCGCGGCGTGCGGTGTTGTTGCCAAAGCAATGTGCGTTG
TCGCCCACCCACCTCCTTTGCTGGCCCCAATTAGGGTCGCATGTGCATGTAGCGCAATGCTGACCGAGGATGGGA
CCCGCGGCGTAGCATCGAGTCGGAGGAGGACCTGGGCTATTTGTTGCAAGCCGTCCTGCTTCGCCGCTACTCCGT
CATTGCCGACGGTCTTCCCACGACTCCGGCAAACGTCATCGAGAAAGCCGTTGACCTGCACGCCGTTCGGGTCAT
CGGATCCTCTGGCTACCAGAAATGCATCAACTATCTGTGGCGTGGCTGGCTCGTGCAGGACCAGGATGACCCTTC
CGTCTTTGTCGACTACGAAAACAAGGACAACACGAGTTTCCTCGTCCACATGGATCCCGATCGCATGAGGGCACC
GAAATACCAAAACGCCGCCCAGCTGCTCTTTTCCCTCATCTACCTCGCCCTCTACACGGTGGCCATCAACTCCGT
CAACCCCACCGGCGTTTTCGATGCGGCCGAGGTTGCCTTGTACGTCTTCACCCTCGGCTTTGTATGCGATGAAGT
CGTCAAGTTTTACAAGGCGGGATATCACATTTTGGGCTTCTGGAACGCTTTCAATGGCATCTTGTATGCCTTCCT
GACGGCCTCTTTCGTCCTTCGCATCGTCGGCCTGACCGCCCCGAGTCAGTCTCACTTCCGCAGCCATTACAGCAC
CCTGAGCTATAACATCCTTTCGTTCGTGGCTCCCATGTTTTGGACGCGGCTGCTCCTCTACCTAGACAGCTTCCG
ATTCTTCGGCGCCATGCTTGTCGTGCTCAAAGTCATGATGAAGGAGTCGCTCATATTCTTCGCCTTGCTCGTCAT
CGTCGTTGTCGGCTTTCTCCAGGCCTTCATTGGTCTCGATTTGACCGACGACAACGTTGCCGGCGACGCCGCCTT
TATCGTCGAGGCCATGATGAAGGCCATCCTGCAGAGCCCGGAGTTTGATGGCTTTGAGGGGTTCGGGCCCCCGTG
GGGCATCATTCTCTACTACTGCTTCACTTTCGTTGTCATGGTACGTTTCACACTCCTAGGCCTCGGCGAGATCGC
GCTAATAGCTTGCCGCAAGATCATCCTTCTCAACATCCTCATTGCTCTTTACAACTCGGCCTACGAAGACATTTA
CGATAACGCCGACGACGAGTACCTCGCCCTTTTCTCCCACAAGACGCTGCAATTCGTTCGCGCGCCGGACGAGAA
TGTCTACATTGCGCCCCTGAATCTCTTCGAGATCGTCATCTCCGCGCTGTTTGAGTGGTGGATGAAGAAGACGAC
GTACGAGCTCATTAACGACTACGTCATGGGCCTCCTGTACTCTCCTCTCCTCTTTGTGACGGCCTACTCCGAGAC
CCACACAGCACATGAGATCCGGCGAAACCGTGCTCGGGGCGACGACGACGACGACGTGATGGAGGAGTGGGAGCG
ACTGGCCCATGAGCTCGATTTCGAAGCCGAAGGCTGGGCCAAGACGTGCGATGCTGTGAAGCCGAACCTGGAAGA
CGATCCGGCTGTCCTGGAGGTCAGAAAGCTGCGAGCCGAGATAGGGGAGCTCAAGGCCGCGCTGAAGGAGATAAG
CAAGGCCGTTGGCATCACAGCAACGCAGAAACAAGGCACCAGAAATGAGGAGTCTCGGGACAGGCAACCGCGAGT
TGGAATCATTGGCACGACGGAATCTACGGGAACCCTGCCAGACACCTCTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail