Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7504
Gene name
LocationContig_44:28539..30442
Strand+
Gene length (bp)1903
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 1.7E-96 45 511
PF13520 AA_permease_2 Amino acid permease 4.0E-30 46 473

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38090|AGP2_YEAST General amino acid permease AGP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP2 PE=1 SV=1 7 531 7.0E-138
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 31 531 5.0E-99
sp|O74543|YCV4_SCHPO Uncharacterized amino-acid permease C777.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.04 PE=3 SV=1 31 520 2.0E-92
sp|P15380|PUT4_YEAST Proline-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT4 PE=2 SV=2 4 541 1.0E-90
sp|P18696|PUTX_EMENI Proline-specific permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prnB PE=2 SV=2 31 529 7.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38090|AGP2_YEAST General amino acid permease AGP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP2 PE=1 SV=1 7 531 7.0E-138
sp|P53388|DIP5_YEAST Dicarboxylic amino acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP5 PE=1 SV=1 31 531 5.0E-99
sp|O74543|YCV4_SCHPO Uncharacterized amino-acid permease C777.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.04 PE=3 SV=1 31 520 2.0E-92
sp|P15380|PUT4_YEAST Proline-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT4 PE=2 SV=2 4 541 1.0E-90
sp|P18696|PUTX_EMENI Proline-specific permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prnB PE=2 SV=2 31 529 7.0E-85
sp|P04817|CAN1_YEAST Arginine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAN1 PE=1 SV=2 21 481 5.0E-83
sp|P32487|LYP1_YEAST Lysine-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYP1 PE=1 SV=2 23 546 2.0E-81
sp|Q9URZ3|PUT4_SCHPO Probable proline-specific permease put4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=put4 PE=3 SV=1 5 480 2.0E-81
sp|Q9C0V0|YQD2_SCHPO Probable amino-acid permease PB1C11.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.02 PE=3 SV=1 34 533 3.0E-74
sp|P43059|CAN1_CANAW Lysine/arginine permease OS=Candida albicans (strain WO-1) GN=CAN1 PE=3 SV=2 21 546 2.0E-73
sp|O60170|MEU22_SCHPO Probable amino-acid permease meu22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu22 PE=2 SV=1 4 520 8.0E-72
sp|P38971|ALP1_YEAST Basic amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALP1 PE=1 SV=2 36 481 3.0E-69
sp|Q876K6|AGP1_SACU7 General amino acid permease AGP1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AGP1 PE=3 SV=1 2 529 1.0E-67
sp|P25376|AGP1_YEAST General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP1 PE=1 SV=3 2 529 6.0E-66
sp|A6ZTG5|AGP1_YEAS7 General amino acid permease AGP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=AGP1 PE=3 SV=1 2 529 1.0E-65
sp|P19145|GAP1_YEAST General amino-acid permease GAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAP1 PE=1 SV=2 5 528 2.0E-65
sp|P25737|LYSP_ECOLI Lysine-specific permease OS=Escherichia coli (strain K12) GN=lysP PE=1 SV=5 32 517 2.0E-63
sp|P34054|INDA1_HYPAT Amino-acid permease inda1 OS=Hypocrea atroviridis GN=inda1 PE=2 SV=1 20 520 6.0E-63
sp|Q9URZ4|CAT1_SCHPO Cationic amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cat1 PE=1 SV=3 30 537 8.0E-62
sp|Q9P768|YI26_SCHPO Uncharacterized amino-acid permease P7G5.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP7G5.06 PE=3 SV=1 31 520 6.0E-61
sp|B5BP45|YP51_SCHPO Uncharacterized amino-acid permease C460.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.01c PE=3 SV=1 31 520 2.0E-60
sp|Q9P5N2|AAT1_SCHPO Amino acid transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aat1 PE=3 SV=1 30 532 2.0E-59
sp|P06775|HIP1_YEAST Histidine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIP1 PE=1 SV=2 23 528 7.0E-59
sp|Q9P5N4|YH81_SCHPO Uncharacterized amino-acid permease C359.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC359.01 PE=3 SV=2 29 536 3.0E-57
sp|Q12372|MMP1_YEAST S-methylmethionine permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMP1 PE=1 SV=1 37 509 1.0E-56
sp|P43548|AGP3_YEAST General amino acid permease AGP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGP3 PE=1 SV=1 13 519 2.0E-55
sp|Q92367|AAP1_SCHPO Amino-acid permease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aap1 PE=3 SV=1 40 481 6.0E-54
sp|O59831|YCUB_SCHPO Uncharacterized amino-acid permease C965.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.11c PE=3 SV=1 2 545 7.0E-54
sp|P38084|BAP2_YEAST Leu/Val/Ile amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP2 PE=1 SV=2 18 528 3.0E-53
sp|P48813|GNP1_YEAST High-affinity glutamine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNP1 PE=1 SV=2 34 529 3.0E-52
sp|Q03770|SSY1_YEAST SPS-sensor component SSY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSY1 PE=1 SV=1 36 560 9.0E-52
sp|P38967|TAT2_YEAST Tryptophan permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT2 PE=1 SV=1 32 528 2.0E-50
sp|P40901|ISP5_SCHPO Sexual differentiation process putative amino-acid permease isp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp5 PE=2 SV=2 36 537 3.0E-49
sp|Q08986|SAM3_YEAST S-adenosylmethionine permease SAM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAM3 PE=1 SV=1 37 560 2.0E-48
sp|P38085|TAT1_YEAST Valine/tyrosine/tryptophan amino-acid permease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAT1 PE=1 SV=1 23 548 4.0E-48
sp|Q9HDV2|YHE1_SCHPO Uncharacterized amino-acid permease PB2B2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.01 PE=3 SV=1 34 520 9.0E-45
sp|P41815|BAP3_YEAST Valine amino-acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAP3 PE=1 SV=2 5 531 3.0E-44
sp|P24207|PHEP_ECOLI Phenylalanine-specific permease OS=Escherichia coli (strain K12) GN=pheP PE=1 SV=1 36 443 3.0E-43
sp|O34618|YTNA_BACSU Uncharacterized amino acid permease YtnA OS=Bacillus subtilis (strain 168) GN=ytnA PE=3 SV=1 36 477 9.0E-42
sp|Q8FL49|AROP_ECOL6 Aromatic amino acid transport protein AroP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aroP PE=3 SV=1 31 444 1.0E-40
sp|P15993|AROP_ECOLI Aromatic amino acid transport protein AroP OS=Escherichia coli (strain K12) GN=aroP PE=1 SV=3 31 444 2.0E-40
sp|P59737|AROP_SHIFL Aromatic amino acid transport protein AroP OS=Shigella flexneri GN=aroP PE=3 SV=1 31 444 2.0E-40
sp|P0CK99|AROP_SALTY Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aroP PE=3 SV=1 25 472 2.0E-40
sp|E1W822|AROP_SALTS Aromatic amino acid transport protein AroP OS=Salmonella typhimurium (strain SL1344) GN=aroP PE=3 SV=1 25 472 2.0E-40
sp|P0A188|AROP_SALTI Aromatic amino acid transport protein AroP OS=Salmonella typhi GN=aroP PE=3 SV=1 25 472 2.0E-40
sp|Q8X968|AROP_ECO57 Aromatic amino acid transport protein AroP OS=Escherichia coli O157:H7 GN=aroP PE=3 SV=1 31 444 6.0E-40
sp|P27837|YIFK_ECOLI Probable transport protein YifK OS=Escherichia coli (strain K12) GN=yifK PE=1 SV=4 29 472 2.0E-36
sp|P25527|GABP_ECOLI GABA permease OS=Escherichia coli (strain K12) GN=gabP PE=1 SV=1 40 472 4.0E-36
sp|P42087|HUTM_BACSU Putative histidine permease OS=Bacillus subtilis (strain 168) GN=hutM PE=3 SV=2 31 466 4.0E-35
sp|P77610|ANSP_ECOLI L-asparagine permease OS=Escherichia coli (strain K12) GN=ansP PE=3 SV=2 18 384 5.0E-35
sp|Q46065|AROP_CORGL Aromatic amino acid transport protein AroP OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aroP PE=3 SV=1 29 462 9.0E-35
sp|P0A189|YIFK_SALTY Probable transport protein YifK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yifK PE=3 SV=1 29 472 2.0E-34
sp|P0A190|YIFK_SALTI Probable transport protein YifK OS=Salmonella typhi GN=yifK PE=3 SV=1 29 472 2.0E-34
sp|P40812|ANSP_SALTY L-asparagine permease OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ansP PE=3 SV=1 29 384 3.0E-34
sp|P39636|ROCC_BACSU Amino-acid permease RocC OS=Bacillus subtilis (strain 168) GN=rocC PE=2 SV=1 29 466 7.0E-34
sp|P46349|GABP_BACSU GABA permease OS=Bacillus subtilis (strain 168) GN=gabP PE=1 SV=3 29 464 8.0E-34
sp|P39137|ROCE_BACSU Amino-acid permease RocE OS=Bacillus subtilis (strain 168) GN=rocE PE=2 SV=1 31 477 3.0E-33
sp|P0AAE0|CYCA_ECOLI D-serine/D-alanine/glycine transporter OS=Escherichia coli (strain K12) GN=cycA PE=1 SV=1 34 391 5.0E-32
sp|P0AAE1|CYCA_ECO57 D-serine/D-alanine/glycine transporter OS=Escherichia coli O157:H7 GN=cycA PE=3 SV=1 34 391 5.0E-32
sp|P37460|PROY_SALTY Proline-specific permease ProY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proY PE=3 SV=3 31 511 8.0E-32
sp|O31462|YBGF_BACSU Uncharacterized amino acid permease YbgF OS=Bacillus subtilis (strain 168) GN=ybgF PE=3 SV=1 25 463 9.0E-32
sp|P9WQM7|ANSP2_MYCTU L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP2 PE=1 SV=1 23 519 3.0E-31
sp|P9WQM6|ANSP2_MYCTO L-asparagine permease 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP2 PE=3 SV=1 23 519 3.0E-31
sp|P0A4W1|ANSP2_MYCBO L-asparagine permease 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP2 PE=3 SV=1 23 519 3.0E-31
sp|P0AAE2|PROY_ECOLI Proline-specific permease ProY OS=Escherichia coli (strain K12) GN=proY PE=1 SV=1 31 397 7.0E-31
sp|P0AAE3|PROY_ECOL6 Proline-specific permease ProY OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=proY PE=3 SV=1 31 397 7.0E-31
sp|P0AAE4|PROY_ECO57 Proline-specific permease ProY OS=Escherichia coli O157:H7 GN=proY PE=3 SV=1 31 397 7.0E-31
sp|Q47689|MMUP_ECOLI Probable S-methylmethionine permease OS=Escherichia coli (strain K12) GN=mmuP PE=3 SV=2 36 392 8.0E-31
sp|P96704|YDGF_BACSU Uncharacterized transporter YdgF OS=Bacillus subtilis (strain 168) GN=ydgF PE=3 SV=1 32 384 4.0E-30
sp|Q9I703|BAUD_PSEAE Probable GABA permease OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bauD PE=2 SV=1 40 443 2.0E-29
sp|P54425|YBXG_BACSU Uncharacterized transporter YbxG OS=Bacillus subtilis (strain 168) GN=ybxG PE=3 SV=2 36 472 3.0E-28
sp|O06005|AAPA_BACSU Amino-acid permease AapA OS=Bacillus subtilis (strain 168) GN=aapA PE=3 SV=2 21 384 4.0E-26
sp|Q9X7P0|ANSP_STRCO L-asparagine permease OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ansP PE=3 SV=1 24 525 2.0E-23
sp|O32257|YVBW_BACSU Uncharacterized amino acid permease YvbW OS=Bacillus subtilis (strain 168) GN=yvbW PE=2 SV=1 29 393 7.0E-23
sp|Q7VEQ4|ANSP1_MYCBO L-asparagine permease 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansP1 PE=3 SV=1 30 384 3.0E-21
sp|P9WQM9|ANSP1_MYCTU L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansP1 PE=1 SV=1 27 384 2.0E-19
sp|P9WQM8|ANSP1_MYCTO L-asparagine permease 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansP1 PE=3 SV=1 27 384 2.0E-19
sp|P45495|YPEV_LACDL Uncharacterized transporter in pepV 3'region (Fragment) OS=Lactobacillus delbrueckii subsp. lactis PE=3 SV=1 31 197 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 47 69 22
2 74 93 19
3 125 147 22
4 157 179 22
5 184 206 22
6 243 265 22
7 278 300 22
8 330 352 22
9 380 402 22
10 412 434 22
11 454 476 22
12 486 504 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7504
MATTDEEKQSGKLEIPGSPDVGDADSGHLGDNADGLHRQLNNRQIQLIAIGGSIGTALFVSIGNGLAYGGPASML
IAYTLYPMILACVNNSIAEMTVLMPVSGGFIRLAGHWVDDAFGFMAGWNFFFYEALLIPFEITALNLVLSFWEPK
MKDPGPTAGICCAVIICYAALNILAVRGYGEAEFWLSGGKVILIFILFSFTFVAMLGGNPQHDRFGFRYWNNPGA
FAEHHTKGDLGRFEGFLGALWNAAFAVVGPEYISMVAAEAQRPRTYIKAAFKTIYYRFGIFFFGSALAVGIIVPY
NDPTLVQIKNGEKESGTAAASPYVIAMQNLGVQVLPHIVNALMFTSIFSAGNTYTYCATRSLYGLALEGRAPRIL
RKCWSNGVPIYCFCIVMCFPLLSFLQVGNGSAKVLDWLVSLITAGGIIDYLVMSVTFLFYYRACKAQGVDRASLP
YCGWGQPYCAIVALFFQTLVIIFYGYEAFTPWSVDSFFRHYTMQIAAPILFFGWKFFKRTRLIRPHEADLVWERP
TIDRYEASFTEPPVGFWTEIAQLLRIKRGKRKQQIDE*
Coding >Hirsu2|7504
ATGGCCACCACCGACGAGGAGAAGCAGTCGGGCAAGCTCGAGATCCCCGGCTCCCCGGACGTTGGCGATGCCGAC
AGCGGCCACCTGGGCGATAACGCCGATGGCCTCCACCGCCAGCTCAACAACCGCCAGATCCAGCTCATCGCCATC
GGCGGCTCCATCGGAACGGCTCTGTTCGTCAGCATCGGCAACGGCCTGGCCTACGGCGGCCCCGCTAGCATGCTC
ATCGCTTACACCCTGTACCCCATGATACTCGCTTGTGTCAACAACTCCATCGCCGAAATGACCGTTCTGATGCCC
GTCTCGGGGGGCTTCATCCGCCTCGCCGGCCACTGGGTCGACGACGCCTTCGGTTTCATGGCCGGCTGGAACTTC
TTCTTCTACGAGGCCTTGCTGATCCCCTTTGAGATCACGGCTCTCAATCTCGTCCTCTCCTTCTGGGAGCCCAAG
ATGAAGGATCCTGGCCCGACGGCCGGCATCTGCTGTGCCGTCATCATCTGTTACGCTGCTCTCAACATCCTTGCT
GTGCGTGGCTATGGTGAGGCTGAGTTCTGGCTATCGGGAGGAAAGGTCATCCTCATCTTCATACTCTTCTCCTTC
ACGTTTGTTGCCATGCTCGGCGGCAATCCTCAGCACGATCGCTTCGGCTTCCGTTACTGGAACAACCCGGGCGCG
TTTGCCGAGCACCACACCAAGGGCGATCTGGGCCGCTTCGAGGGCTTCCTCGGCGCCTTGTGGAACGCCGCCTTC
GCCGTCGTCGGCCCCGAGTACATCTCCATGGTGGCCGCCGAGGCCCAGCGCCCCCGCACGTACATCAAGGCGGCC
TTCAAGACCATCTATTACCGCTTCGGCATCTTCTTCTTCGGCAGCGCCCTCGCCGTCGGCATCATCGTCCCCTAC
AACGACCCGACGCTCGTGCAGATCAAGAACGGCGAGAAGGAGAGCGGGACGGCGGCGGCCTCGCCCTACGTCATC
GCCATGCAGAATCTGGGCGTCCAGGTCCTGCCCCACATCGTCAACGCCCTCATGTTCACCTCCATCTTCTCTGCC
GGCAACACTTACACCTACTGCGCCACCCGGTCGCTGTACGGCTTGGCCCTCGAGGGCCGCGCGCCGCGCATCCTG
CGCAAGTGCTGGAGCAATGGCGTGCCCATCTACTGCTTCTGCATCGTCATGTGCTTTCCCCTGCTGTCCTTCCTG
CAGGTCGGCAACGGCTCCGCCAAGGTGCTCGATTGGCTCGTCAGCCTCATCACGGCTGGCGGCATCATCGATTAC
CTCGTCATGTCCGTCACCTTCCTCTTCTACTACCGCGCCTGCAAGGCCCAGGGCGTCGACCGCGCATCGCTGCCG
TACTGCGGCTGGGGTCAGCCATACTGCGCCATCGTCGCTCTCTTCTTCCAAACGCTGGTCATCATCTTCTACGGC
TACGAGGCCTTCACACCCTGGAGCGTCGACTCCTTCTTCCGGCATTACACCATGCAGATCGCCGCCCCCATCCTG
TTCTTCGGCTGGAAGTTTTTCAAGCGCACCCGCCTCATCCGCCCCCACGAGGCCGACCTGGTGTGGGAGCGCCCC
ACCATCGATCGCTACGAGGCCAGCTTCACCGAGCCGCCCGTGGGCTTCTGGACCGAGATCGCTCAGCTCCTGCGC
ATCAAGCGCGGCAAGAGAAAGCAGCAGATTGATGAATAG
Transcript >Hirsu2|7504
ATGGCCACCACCGACGAGGAGAAGCAGTCGGGCAAGCTCGAGATCCCCGGCTCCCCGGACGTTGGCGATGCCGAC
AGCGGCCACCTGGGCGATAACGCCGATGGCCTCCACCGCCAGCTCAACAACCGCCAGATCCAGCTCATCGCCATC
GGCGGCTCCATCGGAACGGCTCTGTTCGTCAGCATCGGCAACGGCCTGGCCTACGGCGGCCCCGCTAGCATGCTC
ATCGCTTACACCCTGTACCCCATGATACTCGCTTGTGTCAACAACTCCATCGCCGAAATGACCGTTCTGATGCCC
GTCTCGGGGGGCTTCATCCGCCTCGCCGGCCACTGGGTCGACGACGCCTTCGGTTTCATGGCCGGCTGGAACTTC
TTCTTCTACGAGGCCTTGCTGATCCCCTTTGAGATCACGGCTCTCAATCTCGTCCTCTCCTTCTGGGAGCCCAAG
ATGAAGGATCCTGGCCCGACGGCCGGCATCTGCTGTGCCGTCATCATCTGTTACGCTGCTCTCAACATCCTTGCT
GTGCGTGGCTATGGTGAGGCTGAGTTCTGGCTATCGGGAGGAAAGGTCATCCTCATCTTCATACTCTTCTCCTTC
ACGTTTGTTGCCATGCTCGGCGGCAATCCTCAGCACGATCGCTTCGGCTTCCGTTACTGGAACAACCCGGGCGCG
TTTGCCGAGCACCACACCAAGGGCGATCTGGGCCGCTTCGAGGGCTTCCTCGGCGCCTTGTGGAACGCCGCCTTC
GCCGTCGTCGGCCCCGAGTACATCTCCATGGTGGCCGCCGAGGCCCAGCGCCCCCGCACGTACATCAAGGCGGCC
TTCAAGACCATCTATTACCGCTTCGGCATCTTCTTCTTCGGCAGCGCCCTCGCCGTCGGCATCATCGTCCCCTAC
AACGACCCGACGCTCGTGCAGATCAAGAACGGCGAGAAGGAGAGCGGGACGGCGGCGGCCTCGCCCTACGTCATC
GCCATGCAGAATCTGGGCGTCCAGGTCCTGCCCCACATCGTCAACGCCCTCATGTTCACCTCCATCTTCTCTGCC
GGCAACACTTACACCTACTGCGCCACCCGGTCGCTGTACGGCTTGGCCCTCGAGGGCCGCGCGCCGCGCATCCTG
CGCAAGTGCTGGAGCAATGGCGTGCCCATCTACTGCTTCTGCATCGTCATGTGCTTTCCCCTGCTGTCCTTCCTG
CAGGTCGGCAACGGCTCCGCCAAGGTGCTCGATTGGCTCGTCAGCCTCATCACGGCTGGCGGCATCATCGATTAC
CTCGTCATGTCCGTCACCTTCCTCTTCTACTACCGCGCCTGCAAGGCCCAGGGCGTCGACCGCGCATCGCTGCCG
TACTGCGGCTGGGGTCAGCCATACTGCGCCATCGTCGCTCTCTTCTTCCAAACGCTGGTCATCATCTTCTACGGC
TACGAGGCCTTCACACCCTGGAGCGTCGACTCCTTCTTCCGGCATTACACCATGCAGATCGCCGCCCCCATCCTG
TTCTTCGGCTGGAAGTTTTTCAAGCGCACCCGCCTCATCCGCCCCCACGAGGCCGACCTGGTGTGGGAGCGCCCC
ACCATCGATCGCTACGAGGCCAGCTTCACCGAGCCGCCCGTGGGCTTCTGGACCGAGATCGCTCAGCTCCTGCGC
ATCAAGCGCGGCAAGAGAAAGCAGCAGATTGATGAATAG
Gene >Hirsu2|7504
ATGGCCACCACCGACGAGGAGAAGCAGTCGGGCAAGCTCGAGATCCCCGGCTCCCCGGACGTTGGCGATGCCGAC
AGCGGCCACCTGGGCGATAACGCCGATGGCCTCCACCGCCAGCTCAACAACCGCCAGATCCAGCTCATCGCCATC
GGCGGCTCCATCGGAACGGCTCTGTTCGTCAGCATCGGCAACGGCCTGGCCTACGGCGGCCCCGCTAGCATGCTC
ATCGCTTACACCCTGTACCCCATGATACTCGCTTGTGTCAACAACTCCATCGCCGAAATGACCGTTCTGATGCCC
GTCTCGGGGGGCTTCATCCGCCTCGCCGGCCACTGGGTCGACGACGCCTTCGGTTTCATGGCCGGCTGGAACTTC
TTCTTCTACGAGGCCTTGCTGATCCCCTTTGAGATCACGGCTCTCAATCTCGTCCTCTCCTTCTGGGAGCCCAAG
ATGAAGGATCCTGGCCCGACGGCCGGCATCTGCTGTGCCGTCATCATCTGTTACGCGTAAGACTTGTGCTCCGTG
GTGAAGGAGGGGGGAAAGACCCGGAGAGAGTTCGGCCTTGACCCCTCGTCTCCCGGCGGCCCGTCTCCCCAACGT
GCTTGTCTCGCCCGGCCCGGCCTGCTCTCTCCCCCTTCCCCCGATTCCCCCTCCCCCCCCCCCCCCCCCGCTGCT
GAAGACGAGGTCGCATGCTAAACTTTCACCTGTTGTGAAATGTAGTGCTCTCAACATCCTTGCTGTGCGTGGCTA
TGGTGAGGCTGAGTTCTGGCTATCGGGAGGAAAGGTCATCCTCATCTTCATACTCTTCTCCTTCACGTTTGTTGC
CATGCTCGGCGGCAATCCTCAGCACGATCGCTTCGGCTTCCGTTACTGGAACAACCCGGGCGCGTTTGCCGAGCA
CCACACCAAGGGCGATCTGGGCCGCTTCGAGGGCTTCCTCGGCGCCTTGTGGAACGCCGCCTTCGCCGTCGTCGG
CCCCGAGTACATCTCCATGGTGGCCGCCGAGGCCCAGCGCCCCCGCACGTACATCAAGGCGGCCTTCAAGACCAT
CTATTACCGCTTCGGCATCTTCTTCTTCGGCAGCGCCCTCGCCGTCGGCATCATCGTCCCCTACAACGACCCGAC
GCTCGTGCAGATCAAGAACGGCGAGAAGGAGAGCGGGACGGCGGCGGCCTCGCCCTACGTCATCGCCATGCAGAA
TCTGGGCGTCCAGGTCCTGCCCCACATCGTCAACGCCCTCATGTTCACCTCCATCTTCTCTGCCGGCAACACTTA
CACCTACTGCGCCACCCGGTCGCTGTACGGCTTGGCCCTCGAGGGCCGCGCGCCGCGCATCCTGCGCAAGTGCTG
GAGCAATGGCGTGCCCATCTACTGCTTCTGCATCGTCATGTGCTTTCCCCTGCTGTCCTTCCTGCAGGTCGGCAA
CGGCTCCGCCAAGGTGCTCGATTGGCTCGTCAGCCTCATCACGGCTGGCGGCATCATCGATTACCTCGTCATGTC
CGTCACCTTCCTCTTCTACTACCGCGCCTGCAAGGCCCAGGGCGTCGACCGCGCATCGCTGCCGTACTGCGGCTG
GGGTCAGCCATACTGCGCCATCGTCGCTCTCTTCTTCCAAACGCTGGTCATCATCTTCTACGGCTACGAGGCCTT
CACACCCTGGAGCGTCGACTCCTTCTTCCGGCATTACACCATGCAGATCGCCGCCCCCATCCTGTTCTTCGGCTG
GAAGTTTTTCAAGCGCACCCGCCTCATCCGCCCCCACGAGGCCGACCTGGTGTGGGAGCGCCCCACCATCGATCG
CTACGAGGCCAGCTTCACCGAGCCGCCCGTGGGCTTCTGGACCGAGATCGCTCAGCTCCTGCGCATCAAGCGCGG
CAAGAGAAAGCAGCAGATTGATGAATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail