Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7501
Gene name
LocationContig_44:12673..16241
Strand-
Gene length (bp)3568
Transcript length (bp)3408
Coding sequence length (bp)3408
Protein length (aa) 1136

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.0E-09 608 694
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.6E-07 729 776
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.5E-08 828 910
PF13637 Ank_4 Ankyrin repeats (many copies) 5.2E-06 607 657
PF13637 Ank_4 Ankyrin repeats (many copies) 4.9E-10 735 777
PF13857 Ank_5 Ankyrin repeats (many copies) 2.4E-08 732 774
PF13857 Ank_5 Ankyrin repeats (many copies) 2.3E-07 869 923
PF00023 Ank Ankyrin repeat 2.7E-02 639 663
PF00023 Ank Ankyrin repeat 2.4E-06 734 763
PF00023 Ank Ankyrin repeat 2.1E-02 883 910
PF13606 Ank_3 Ankyrin repeat 1.8E-04 734 762
PF05729 NACHT NACHT domain 3.8E-06 200 362

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 611 1092 1.0E-27
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 617 1113 2.0E-27
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 617 1113 7.0E-27
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 608 1107 3.0E-26
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 608 1107 4.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 611 1092 1.0E-27
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 617 1113 2.0E-27
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 617 1113 7.0E-27
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 608 1107 3.0E-26
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 608 1107 4.0E-26
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 608 1127 6.0E-26
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 608 1107 2.0E-25
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 608 1107 2.0E-25
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 606 938 8.0E-24
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 607 1113 1.0E-23
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 611 1118 1.0E-23
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 607 1113 1.0E-23
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 606 938 2.0E-23
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 588 1074 3.0E-23
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 606 938 6.0E-23
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 611 1114 6.0E-23
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 607 1113 2.0E-22
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 611 1118 3.0E-22
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 611 1071 6.0E-22
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 608 1071 4.0E-21
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 608 1071 4.0E-21
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 588 1074 7.0E-21
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 608 1020 9.0E-21
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 611 1019 2.0E-20
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 607 1113 3.0E-20
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 608 912 8.0E-20
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 606 1027 1.0E-19
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 606 1027 2.0E-19
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 606 1027 3.0E-19
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 605 1024 5.0E-19
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 608 1074 6.0E-19
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 613 992 6.0E-19
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 606 1113 7.0E-19
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 734 1113 2.0E-18
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 623 1107 3.0E-18
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 597 1119 4.0E-18
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 608 993 4.0E-18
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 623 1107 4.0E-18
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 462 1068 5.0E-18
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 623 1107 1.0E-17
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 606 1113 2.0E-17
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 608 993 2.0E-17
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 592 1073 3.0E-17
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 608 947 3.0E-17
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 608 947 4.0E-17
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 608 1113 7.0E-17
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 608 932 7.0E-17
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 615 1110 9.0E-17
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 597 1068 1.0E-16
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 592 958 3.0E-16
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 620 1032 3.0E-16
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 620 1032 4.0E-16
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 597 1107 1.0E-15
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 620 1044 1.0E-15
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 597 1125 2.0E-15
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 623 1077 2.0E-15
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 623 1101 2.0E-15
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 609 1107 3.0E-15
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 597 1010 3.0E-15
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 597 1010 4.0E-15
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 623 1077 4.0E-15
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 597 1010 6.0E-15
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 608 1027 6.0E-15
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 592 1081 1.0E-14
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 610 992 1.0E-14
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 620 1027 1.0E-14
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 611 1048 1.0E-14
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 623 1096 2.0E-14
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 728 1120 4.0E-14
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 623 1101 4.0E-14
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 592 1081 5.0E-14
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 592 958 6.0E-14
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 608 1102 6.0E-14
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 834 1109 6.0E-14
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 611 1077 6.0E-14
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 709 1113 7.0E-14
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 606 925 7.0E-14
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 610 1076 8.0E-14
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 709 1113 1.0E-13
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 571 926 1.0E-13
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 623 1106 1.0E-13
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 606 925 2.0E-13
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 611 1046 2.0E-13
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 716 1111 3.0E-13
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 608 1114 4.0E-13
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 716 1111 4.0E-13
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 605 1113 5.0E-13
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 838 1067 5.0E-13
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 598 957 6.0E-13
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 611 1106 6.0E-13
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 735 1106 8.0E-13
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 728 982 8.0E-13
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 820 1120 9.0E-13
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 628 932 1.0E-12
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 623 976 1.0E-12
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 608 937 1.0E-12
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 669 1113 2.0E-12
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 634 936 2.0E-12
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 732 1120 2.0E-12
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 731 982 2.0E-12
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 724 1120 3.0E-12
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 608 992 4.0E-12
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 608 959 6.0E-12
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 627 937 7.0E-12
sp|Q6C520|AKR1_YARLI Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 797 992 8.0E-12
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 617 1000 8.0E-12
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 608 1109 9.0E-12
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 608 964 9.0E-12
sp|Q9J5I3|V018_FOWPN Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 736 1027 1.0E-11
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 634 936 2.0E-11
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 612 1077 2.0E-11
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 618 1017 2.0E-11
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 601 934 3.0E-11
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 634 936 3.0E-11
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 713 937 3.0E-11
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 608 937 3.0E-11
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 634 1076 3.0E-11
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 626 979 3.0E-11
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 596 1113 4.0E-11
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 608 939 4.0E-11
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 713 937 4.0E-11
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 635 1102 5.0E-11
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 605 936 5.0E-11
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 605 1074 6.0E-11
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 619 936 7.0E-11
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 874 1102 7.0E-11
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 183 535 8.0E-11
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 608 1015 8.0E-11
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 582 909 9.0E-11
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 735 1106 1.0E-10
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 601 934 1.0E-10
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 656 992 1.0E-10
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 635 1027 1.0E-10
sp|Q641X1|ANR61_RAT Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 738 998 1.0E-10
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 594 957 2.0E-10
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 838 1111 2.0E-10
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 734 933 2.0E-10
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 713 935 3.0E-10
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 734 1112 3.0E-10
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 738 1049 4.0E-10
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 582 909 4.0E-10
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 611 775 5.0E-10
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 582 909 5.0E-10
sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 716 907 5.0E-10
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 608 890 5.0E-10
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 655 992 5.0E-10
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 581 909 6.0E-10
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 734 908 6.0E-10
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 635 1027 7.0E-10
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 608 966 8.0E-10
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 869 1076 8.0E-10
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 595 1120 8.0E-10
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 608 936 8.0E-10
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 839 1074 9.0E-10
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 634 1074 9.0E-10
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 614 944 1.0E-09
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 820 1074 1.0E-09
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 551 890 1.0E-09
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 722 937 1.0E-09
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 736 992 1.0E-09
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 608 939 1.0E-09
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 819 1074 2.0E-09
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 613 909 2.0E-09
sp|Q9CQM6|ANR61_MOUSE Ankyrin repeat domain-containing protein 61 OS=Mus musculus GN=Ankrd61 PE=2 SV=1 738 998 2.0E-09
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 691 923 2.0E-09
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 626 937 2.0E-09
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 691 924 2.0E-09
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 837 1111 2.0E-09
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 608 905 3.0E-09
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 635 1102 3.0E-09
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 731 982 3.0E-09
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 731 982 3.0E-09
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 691 941 3.0E-09
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 606 774 3.0E-09
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 812 1116 3.0E-09
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 733 992 3.0E-09
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 608 1107 4.0E-09
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 608 912 4.0E-09
sp|P39010|AKR1_YEAST Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 840 1027 4.0E-09
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 598 812 4.0E-09
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 638 927 4.0E-09
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 826 992 4.0E-09
sp|Q9J507|V228_FOWPN Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 865 1069 4.0E-09
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 815 1078 4.0E-09
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 734 962 5.0E-09
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 736 984 5.0E-09
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 815 1078 6.0E-09
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 869 1102 6.0E-09
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 655 992 6.0E-09
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 608 902 7.0E-09
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 826 992 7.0E-09
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 749 1021 8.0E-09
sp|Q2T9W8|ANR61_BOVIN Ankyrin repeat domain-containing protein 61 OS=Bos taurus GN=ANKRD61 PE=2 SV=1 713 889 8.0E-09
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 734 953 8.0E-09
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 819 1074 9.0E-09
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 608 776 9.0E-09
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 815 1078 9.0E-09
sp|Q8VHS5|ASB16_MOUSE Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 623 784 9.0E-09
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 734 932 9.0E-09
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 608 1107 1.0E-08
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 608 781 1.0E-08
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 631 1074 1.0E-08
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 869 1073 1.0E-08
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 875 1112 1.0E-08
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 608 890 1.0E-08
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 805 992 1.0E-08
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 822 1067 1.0E-08
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 822 1067 1.0E-08
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 691 923 1.0E-08
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 691 923 1.0E-08
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 610 905 1.0E-08
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 805 992 1.0E-08
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 608 934 2.0E-08
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 611 936 2.0E-08
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 620 890 2.0E-08
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 620 890 2.0E-08
sp|Q641X1|ANR61_RAT Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 596 889 2.0E-08
sp|Q2T9W8|ANR61_BOVIN Ankyrin repeat domain-containing protein 61 OS=Bos taurus GN=ANKRD61 PE=2 SV=1 738 1015 2.0E-08
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 805 992 2.0E-08
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 805 992 2.0E-08
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 734 932 2.0E-08
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 623 776 2.0E-08
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 733 936 2.0E-08
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 805 992 2.0E-08
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 611 775 2.0E-08
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 623 776 2.0E-08
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 608 937 3.0E-08
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 805 992 3.0E-08
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 741 992 3.0E-08
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 734 932 3.0E-08
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 732 911 3.0E-08
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 732 911 3.0E-08
sp|Q54XX5|Y9849_DICDI Probable serine/threonine-protein kinase DDB_G0278535 OS=Dictyostelium discoideum GN=DDB_G0278535 PE=3 SV=1 747 910 3.0E-08
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 833 1108 3.0E-08
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 727 909 3.0E-08
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 736 938 3.0E-08
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 815 1078 3.0E-08
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 866 1107 4.0E-08
sp|Q9WTK5|NFKB2_MOUSE Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus GN=Nfkb2 PE=1 SV=1 736 909 4.0E-08
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 736 938 4.0E-08
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 736 938 4.0E-08
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 736 938 4.0E-08
sp|P77736|YAHD_ECOLI Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 609 777 4.0E-08
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 736 938 4.0E-08
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 869 1107 5.0E-08
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 608 936 5.0E-08
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 733 992 5.0E-08
sp|Q9J507|V228_FOWPN Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 605 776 5.0E-08
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 738 986 5.0E-08
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 736 938 5.0E-08
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 736 938 5.0E-08
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 732 911 5.0E-08
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 736 938 5.0E-08
sp|Q9TXQ1|TNKS1_CAEEL Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 738 1076 5.0E-08
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 736 938 5.0E-08
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 736 938 6.0E-08
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 601 931 6.0E-08
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 733 908 6.0E-08
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 833 1027 6.0E-08
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 736 938 6.0E-08
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 822 1067 7.0E-08
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 734 1011 7.0E-08
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 734 1011 7.0E-08
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 608 907 8.0E-08
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 734 1011 8.0E-08
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 734 997 8.0E-08
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 736 951 8.0E-08
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 623 890 9.0E-08
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 623 776 9.0E-08
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 827 1075 9.0E-08
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 661 970 9.0E-08
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 608 1106 1.0E-07
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 608 992 1.0E-07
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 736 1077 1.0E-07
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 623 907 1.0E-07
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 860 1069 1.0E-07
sp|Q755Y0|AKR1_ASHGO Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 805 1027 1.0E-07
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 610 775 1.0E-07
sp|Q54KH3|ANR39_DICDI Ankyrin repeat domain-containing protein 39 homolog OS=Dictyostelium discoideum GN=ankrd39 PE=3 SV=2 827 936 1.0E-07
sp|Q876A6|AKR1_NAUCC Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 828 1027 1.0E-07
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 629 909 1.0E-07
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 611 886 1.0E-07
sp|Q1LZC5|ANR54_BOVIN Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 733 774 1.0E-07
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 661 939 1.0E-07
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 611 886 1.0E-07
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 733 774 1.0E-07
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 733 774 1.0E-07
sp|Q876L5|AKR1_SACU7 Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 840 1027 1.0E-07
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 639 1046 1.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 608 937 2.0E-07
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 840 1037 2.0E-07
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 883 1032 2.0E-07
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 695 908 2.0E-07
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 735 1112 2.0E-07
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 733 774 2.0E-07
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 865 1027 2.0E-07
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 588 775 2.0E-07
sp|A6NGH8|ANR61_HUMAN Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 713 889 2.0E-07
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 606 774 2.0E-07
sp|P57044|ILK_CAVPO Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 830 947 2.0E-07
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 741 992 2.0E-07
sp|Q13418|ILK_HUMAN Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 830 947 2.0E-07
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 833 1027 2.0E-07
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 606 774 2.0E-07
sp|Q5R5V4|ILK_PONAB Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 830 947 2.0E-07
sp|Q3SWY2|ILK_BOVIN Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 830 947 2.0E-07
sp|Q99J82|ILK_RAT Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 830 947 2.0E-07
sp|O55222|ILK_MOUSE Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 830 947 2.0E-07
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 588 775 2.0E-07
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 866 1113 2.0E-07
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 733 908 2.0E-07
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 695 908 2.0E-07
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 608 916 3.0E-07
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 620 775 3.0E-07
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 608 890 3.0E-07
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 805 992 3.0E-07
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 805 992 3.0E-07
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 865 1125 3.0E-07
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 691 907 3.0E-07
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 875 1107 3.0E-07
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 751 1023 3.0E-07
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 841 957 3.0E-07
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 736 938 3.0E-07
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 860 1046 3.0E-07
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 611 773 3.0E-07
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 474 907 4.0E-07
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 608 916 4.0E-07
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 691 907 4.0E-07
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 588 775 4.0E-07
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 865 1027 4.0E-07
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 828 992 4.0E-07
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 828 992 4.0E-07
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 736 938 4.0E-07
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 608 780 4.0E-07
sp|Q3V0J4|ANR53_MOUSE Ankyrin repeat domain-containing protein 53 OS=Mus musculus GN=Ankrd53 PE=2 SV=2 813 922 4.0E-07
sp|Q9J503|V232_FOWPN Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 620 776 4.0E-07
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 736 937 4.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 620 992 5.0E-07
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 841 1109 5.0E-07
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 883 1032 5.0E-07
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 588 775 5.0E-07
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 709 1043 5.0E-07
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 841 957 5.0E-07
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 883 1032 6.0E-07
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 866 1022 6.0E-07
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 865 1027 6.0E-07
sp|Q9J517|V218_FOWPN Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 735 992 6.0E-07
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 734 992 6.0E-07
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 820 1086 7.0E-07
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 641 970 7.0E-07
sp|Q8R560|ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 588 775 7.0E-07
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 883 1032 8.0E-07
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 734 972 8.0E-07
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 833 1027 8.0E-07
sp|Q554E7|ZDHC5_DICDI Putative ZDHHC-type palmitoyltransferase 5 OS=Dictyostelium discoideum GN=DDB_G0275097 PE=3 SV=1 841 988 8.0E-07
sp|P98150|NFKB2_CHICK Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 843 1062 8.0E-07
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 665 906 8.0E-07
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 865 1027 9.0E-07
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 608 774 9.0E-07
sp|Q8TF21|ANR24_HUMAN Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2 733 936 9.0E-07
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 873 1113 1.0E-06
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 730 931 1.0E-06
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 810 1024 1.0E-06
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 623 1034 1.0E-06
sp|Q876A6|AKR1_NAUCC Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 735 909 1.0E-06
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 736 931 1.0E-06
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 736 937 1.0E-06
sp|P46531|NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 732 911 1.0E-06
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 606 774 1.0E-06
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 866 1080 1.0E-06
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 734 992 1.0E-06
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 734 988 1.0E-06
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 733 908 1.0E-06
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 734 936 1.0E-06
sp|Q6C520|AKR1_YARLI Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 734 909 2.0E-06
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 873 1113 2.0E-06
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 850 992 2.0E-06
sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 732 908 2.0E-06
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 733 908 2.0E-06
sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 732 911 2.0E-06
sp|Q5UPG7|YL091_MIMIV Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 733 1073 2.0E-06
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 841 957 2.0E-06
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 626 887 2.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 608 774 3.0E-06
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 734 1100 3.0E-06
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 833 957 3.0E-06
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 841 957 3.0E-06
sp|Q4KL97|ANKR1_XENLA Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 611 776 3.0E-06
sp|Q07008|NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=1 SV=3 732 911 3.0E-06
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 623 771 3.0E-06
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 623 771 3.0E-06
sp|G3I6Z6|NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus GN=NOTCH1 PE=1 SV=2 732 911 3.0E-06
sp|Q7EZ44|XB35_ORYSJ Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 850 1106 3.0E-06
sp|O54910|IKBE_MOUSE NF-kappa-B inhibitor epsilon OS=Mus musculus GN=Nfkbie PE=1 SV=2 637 780 3.0E-06
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 733 924 3.0E-06
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 611 775 3.0E-06
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 623 771 3.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 608 916 4.0E-06
sp|Q5BKI6|ANKR1_XENTR Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 622 776 4.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 653 913 4.0E-06
sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 732 911 4.0E-06
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 829 1074 4.0E-06
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 623 771 4.0E-06
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 830 1122 5.0E-06
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 841 1109 5.0E-06
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 734 982 5.0E-06
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 734 982 5.0E-06
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 840 1027 5.0E-06
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 608 780 5.0E-06
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 714 906 5.0E-06
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 822 919 5.0E-06
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 803 978 5.0E-06
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 826 1016 5.0E-06
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 606 997 6.0E-06
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 734 992 6.0E-06
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 860 1027 6.0E-06
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 606 774 6.0E-06
sp|Q61982|NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus GN=Notch3 PE=1 SV=1 732 938 6.0E-06
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 606 774 6.0E-06
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 859 1027 6.0E-06
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 611 890 7.0E-06
sp|Q9Y574|ASB4_HUMAN Ankyrin repeat and SOCS box protein 4 OS=Homo sapiens GN=ASB4 PE=2 SV=1 734 938 7.0E-06
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 623 771 7.0E-06
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 734 956 7.0E-06
sp|Q9CR42|ANKR1_MOUSE Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 588 775 7.0E-06
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 608 774 7.0E-06
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 603 749 8.0E-06
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 606 997 8.0E-06
sp|B0G124|Y9043_DICDI Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 608 698 8.0E-06
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 649 1054 8.0E-06
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 875 1131 8.0E-06
sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 606 774 8.0E-06
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 603 749 9.0E-06
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 734 982 9.0E-06
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 818 1088 9.0E-06
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 603 749 1.0E-05
sp|A6NGH8|ANR61_HUMAN Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 733 998 1.0E-05
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 611 774 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7501
MGDFIAVLELVTKIRKRFVGAPSQFNDISAELRNLCNIIHDVDVMLSACESDARQKANLQEIAGSCHKVLVDLEQ
RLDKCSVLQSRGDSSGRILKRFWERLKWDPEDIREVRDRIMSNVTLLNAIIGQISSQATLATKKGIDRLNEREDD
RERLIVLDWLTPIDFAIKQSEITSERQSGTGQWLLDSSEYKSWVENENQTLFCPGMPGAGKTTLTSIVIEHLTTL
FQRDRNIGIAYLYIEYRRQAEQKACDLLASVLKQLAQSLSPLPECLTSLCSVHKARQTRPSFEEILKTLRSLAGF
HSRVFILVDALDESRADGAREKLLTELFNLQDACGANLFATSRSIPEISEVFVKSRTLEIRANDADVRKFIDSRI
LNFKAFVRQSPEIQEQIRTKIVRSTQGMFLLACFHLDALQYKTSVKKLQIALTKIPIGRDGYDSAYDDTMKRIEG
QPSDHVELAKQILSWLTCAKRPLKTSELQEALAVELGELELDENNRPDVEDMISVCAGLVTVDEGGDTIRLIHYT
TQEYLERTQSTWFPDAETEITSCCITYLSFSTFENGLRRSNRQLLLSDYATRYWTHHARLCSPDPSLISSFLSSP
SKMPGVCLLVAAQNGEEASLSWLLDRGVDANVCDETWKTPLHHAVLNSWTRCVELLLARGAKITTDVHNMTPFHY
TVSKASEEIAKCFVDAEIPIDVKLERKTWQPVYQEGEMRYIAENETQVSGEEEAGGRKGLTALHYAAVTGSRRMT
KFLLDHGADPNAVSGYGETPLHLALKRDLHGAKWPGAVDCWNDPVWRIEVGFEVVELASDSEDEHAWTGAYVEEH
RFAVLNLLLDHASTDVNAQDDSGASPLHEVMNRNRASSTIINKLIERKANVSARNQRGQTPLHLACWTGNVGTVV
TMLENGADIADGDLEGLNAVHYAARNSSMEVLLHLLANVCPVALARRRDNRGRNALHHLLSGKKQVDPAVVQHLI
DNGVDANDLDDMGMSPLANYLSRFPPGHEHAQEVVRLLFQGGADASFRTRSGGLGLVHLYARSRRPTVELLTILE
SSGVNLQMEDDENRTVLHHCAISGTLTQEVLCFLCNQVGLSARSRDVHGRTPRQYAAEAAKMERHPHVFDPNRWS
RTEKILDSLV*
Coding >Hirsu2|7501
ATGGGCGACTTCATCGCCGTCCTCGAGCTAGTCACTAAAATCCGAAAACGTTTTGTCGGGGCTCCGAGCCAGTTC
AACGACATCTCTGCTGAACTCCGAAACCTCTGTAACATTATCCATGATGTTGATGTCATGCTGTCGGCGTGCGAG
TCCGATGCCCGGCAGAAGGCAAATCTACAGGAAATCGCCGGCAGCTGCCACAAGGTACTTGTTGACTTGGAACAA
AGACTCGACAAGTGCAGCGTACTCCAGTCTCGCGGCGACAGTTCGGGTCGAATCTTGAAGAGATTTTGGGAGAGG
CTTAAATGGGATCCGGAGGACATTCGCGAGGTTCGAGATCGAATTATGTCGAATGTGACATTGCTTAATGCAATA
ATCGGACAGATATCGAGTCAAGCAACGTTGGCGACGAAGAAAGGGATCGATCGCCTTAATGAGCGGGAGGACGAC
CGAGAACGACTCATAGTTCTTGACTGGCTCACACCAATCGACTTCGCTATAAAACAAAGCGAAATTACGAGTGAG
CGACAATCGGGAACTGGCCAGTGGCTTCTAGACTCATCAGAGTACAAGTCTTGGGTAGAGAACGAGAACCAAACG
TTGTTCTGCCCAGGCATGCCAGGAGCTGGAAAGACAACACTGACGTCTATCGTTATTGAGCATCTTACAACTTTG
TTTCAGCGCGATAGAAATATTGGCATCGCATACCTGTATATCGAGTACAGACGACAAGCCGAACAGAAAGCTTGC
GACCTCCTCGCAAGTGTCCTCAAGCAGCTTGCGCAATCCCTATCTCCTCTACCGGAATGTTTGACGTCTCTGTGT
AGTGTTCACAAGGCTAGGCAAACAAGACCGTCATTCGAGGAGATCTTGAAGACCCTCCGTTCCCTGGCAGGTTTC
CATTCGCGAGTCTTTATCTTGGTCGACGCCCTGGACGAGTCCCGAGCCGATGGCGCCCGGGAAAAACTCCTGACC
GAACTATTCAACCTTCAGGACGCGTGTGGCGCAAACCTATTCGCAACATCGAGATCCATACCGGAGATAAGTGAA
GTATTTGTGAAAAGCCGGACTTTAGAAATTCGAGCCAACGATGCCGACGTTCGAAAATTTATTGATAGCCGTATT
TTGAATTTCAAGGCTTTCGTTCGTCAGAGCCCGGAGATACAGGAGCAGATTCGAACTAAGATTGTTCGTTCGACT
CAAGGAATGTTCCTCCTGGCCTGTTTCCATCTTGATGCCCTACAATATAAGACGTCTGTCAAGAAACTCCAAATT
GCTCTCACCAAGATACCTATAGGACGAGATGGATACGACAGTGCGTACGACGATACGATGAAGAGAATCGAAGGG
CAGCCTTCAGATCACGTAGAGCTTGCCAAACAGATTCTATCGTGGCTCACCTGCGCGAAGAGGCCGCTAAAAACC
TCGGAACTTCAGGAAGCGCTAGCTGTGGAGCTTGGTGAGCTTGAGCTTGATGAAAACAACCGTCCGGACGTCGAG
GACATGATTTCTGTCTGTGCCGGATTGGTAACGGTCGACGAAGGAGGAGACACGATCCGGCTGATCCATTACACG
ACACAAGAGTACTTGGAGCGGACCCAGTCTACTTGGTTTCCTGATGCAGAAACAGAAATTACCTCGTGCTGCATC
ACTTACCTGTCATTTTCCACCTTTGAAAATGGACTTCGGCGTTCGAACAGGCAGCTCCTGCTGTCTGATTACGCC
ACAAGATACTGGACTCACCACGCCCGACTCTGTTCACCAGACCCGAGCTTGATCTCCAGCTTCCTATCCTCGCCG
TCAAAGATGCCCGGTGTCTGCTTACTGGTAGCAGCACAGAATGGAGAGGAGGCAAGCCTATCTTGGCTATTGGAT
CGTGGCGTGGATGCAAATGTGTGCGATGAAACCTGGAAAACACCGTTGCATCACGCTGTGCTGAACTCTTGGACG
AGATGTGTCGAGCTGCTGCTTGCACGAGGTGCAAAAATAACCACAGACGTCCACAACATGACTCCCTTCCACTAC
ACTGTGTCGAAAGCAAGCGAGGAGATTGCGAAGTGCTTCGTGGACGCCGAAATACCGATCGACGTCAAGCTGGAA
AGGAAAACCTGGCAGCCAGTCTACCAAGAGGGCGAAATGCGGTACATAGCAGAGAACGAAACTCAAGTCTCCGGG
GAGGAGGAGGCTGGCGGCAGGAAAGGGCTCACAGCGTTGCACTACGCGGCCGTAACAGGAAGCCGGCGAATGACC
AAATTCTTGCTCGACCACGGAGCCGACCCGAACGCCGTCTCTGGATACGGTGAGACGCCTCTGCATCTAGCACTC
AAACGCGATCTGCACGGCGCAAAGTGGCCTGGCGCGGTTGATTGCTGGAATGACCCGGTCTGGAGAATCGAAGTC
GGCTTTGAAGTTGTGGAGTTGGCTTCCGACAGCGAGGACGAACATGCCTGGACCGGGGCCTACGTCGAGGAGCAT
AGATTCGCTGTCCTCAACCTGCTTCTGGATCATGCCTCGACCGACGTCAACGCCCAAGACGATTCTGGCGCATCC
CCCCTCCATGAGGTGATGAACAGAAACCGGGCATCTTCAACCATCATCAACAAGCTAATTGAGAGGAAAGCCAAC
GTCTCTGCGCGCAATCAGCGGGGGCAGACTCCACTACACCTGGCCTGCTGGACAGGGAATGTCGGCACAGTCGTC
ACCATGCTGGAAAATGGGGCGGATATTGCAGATGGCGACCTTGAGGGACTCAACGCCGTGCACTACGCAGCGCGA
AACAGCAGCATGGAAGTCCTTCTGCACCTCCTGGCGAATGTATGTCCTGTGGCCTTGGCCAGAAGGCGAGATAAC
CGTGGGCGAAATGCACTGCATCATCTGTTGAGCGGGAAGAAACAAGTCGACCCTGCCGTCGTTCAACATCTCATC
GACAACGGAGTCGATGCCAACGACCTCGACGACATGGGTATGTCGCCATTGGCGAATTACCTCAGCCGCTTCCCG
CCCGGACACGAACACGCGCAGGAAGTGGTCCGGCTGCTCTTCCAAGGCGGTGCAGACGCTTCCTTCAGGACTCGC
AGTGGGGGGTTGGGTTTGGTTCATCTTTACGCTCGATCCCGCAGACCGACGGTTGAACTCCTGACCATACTGGAA
AGCTCGGGCGTAAATCTGCAAATGGAAGACGACGAAAATCGTACAGTCCTACATCATTGTGCCATCTCAGGTACC
CTCACCCAAGAGGTCCTATGCTTTCTCTGCAATCAAGTAGGATTGTCAGCGCGTTCCCGCGATGTACATGGGAGA
ACACCACGACAATACGCAGCTGAAGCTGCTAAGATGGAACGCCACCCACACGTCTTTGACCCAAATCGTTGGTCT
CGAACCGAGAAAATCCTCGATAGCTTGGTCTAG
Transcript >Hirsu2|7501
ATGGGCGACTTCATCGCCGTCCTCGAGCTAGTCACTAAAATCCGAAAACGTTTTGTCGGGGCTCCGAGCCAGTTC
AACGACATCTCTGCTGAACTCCGAAACCTCTGTAACATTATCCATGATGTTGATGTCATGCTGTCGGCGTGCGAG
TCCGATGCCCGGCAGAAGGCAAATCTACAGGAAATCGCCGGCAGCTGCCACAAGGTACTTGTTGACTTGGAACAA
AGACTCGACAAGTGCAGCGTACTCCAGTCTCGCGGCGACAGTTCGGGTCGAATCTTGAAGAGATTTTGGGAGAGG
CTTAAATGGGATCCGGAGGACATTCGCGAGGTTCGAGATCGAATTATGTCGAATGTGACATTGCTTAATGCAATA
ATCGGACAGATATCGAGTCAAGCAACGTTGGCGACGAAGAAAGGGATCGATCGCCTTAATGAGCGGGAGGACGAC
CGAGAACGACTCATAGTTCTTGACTGGCTCACACCAATCGACTTCGCTATAAAACAAAGCGAAATTACGAGTGAG
CGACAATCGGGAACTGGCCAGTGGCTTCTAGACTCATCAGAGTACAAGTCTTGGGTAGAGAACGAGAACCAAACG
TTGTTCTGCCCAGGCATGCCAGGAGCTGGAAAGACAACACTGACGTCTATCGTTATTGAGCATCTTACAACTTTG
TTTCAGCGCGATAGAAATATTGGCATCGCATACCTGTATATCGAGTACAGACGACAAGCCGAACAGAAAGCTTGC
GACCTCCTCGCAAGTGTCCTCAAGCAGCTTGCGCAATCCCTATCTCCTCTACCGGAATGTTTGACGTCTCTGTGT
AGTGTTCACAAGGCTAGGCAAACAAGACCGTCATTCGAGGAGATCTTGAAGACCCTCCGTTCCCTGGCAGGTTTC
CATTCGCGAGTCTTTATCTTGGTCGACGCCCTGGACGAGTCCCGAGCCGATGGCGCCCGGGAAAAACTCCTGACC
GAACTATTCAACCTTCAGGACGCGTGTGGCGCAAACCTATTCGCAACATCGAGATCCATACCGGAGATAAGTGAA
GTATTTGTGAAAAGCCGGACTTTAGAAATTCGAGCCAACGATGCCGACGTTCGAAAATTTATTGATAGCCGTATT
TTGAATTTCAAGGCTTTCGTTCGTCAGAGCCCGGAGATACAGGAGCAGATTCGAACTAAGATTGTTCGTTCGACT
CAAGGAATGTTCCTCCTGGCCTGTTTCCATCTTGATGCCCTACAATATAAGACGTCTGTCAAGAAACTCCAAATT
GCTCTCACCAAGATACCTATAGGACGAGATGGATACGACAGTGCGTACGACGATACGATGAAGAGAATCGAAGGG
CAGCCTTCAGATCACGTAGAGCTTGCCAAACAGATTCTATCGTGGCTCACCTGCGCGAAGAGGCCGCTAAAAACC
TCGGAACTTCAGGAAGCGCTAGCTGTGGAGCTTGGTGAGCTTGAGCTTGATGAAAACAACCGTCCGGACGTCGAG
GACATGATTTCTGTCTGTGCCGGATTGGTAACGGTCGACGAAGGAGGAGACACGATCCGGCTGATCCATTACACG
ACACAAGAGTACTTGGAGCGGACCCAGTCTACTTGGTTTCCTGATGCAGAAACAGAAATTACCTCGTGCTGCATC
ACTTACCTGTCATTTTCCACCTTTGAAAATGGACTTCGGCGTTCGAACAGGCAGCTCCTGCTGTCTGATTACGCC
ACAAGATACTGGACTCACCACGCCCGACTCTGTTCACCAGACCCGAGCTTGATCTCCAGCTTCCTATCCTCGCCG
TCAAAGATGCCCGGTGTCTGCTTACTGGTAGCAGCACAGAATGGAGAGGAGGCAAGCCTATCTTGGCTATTGGAT
CGTGGCGTGGATGCAAATGTGTGCGATGAAACCTGGAAAACACCGTTGCATCACGCTGTGCTGAACTCTTGGACG
AGATGTGTCGAGCTGCTGCTTGCACGAGGTGCAAAAATAACCACAGACGTCCACAACATGACTCCCTTCCACTAC
ACTGTGTCGAAAGCAAGCGAGGAGATTGCGAAGTGCTTCGTGGACGCCGAAATACCGATCGACGTCAAGCTGGAA
AGGAAAACCTGGCAGCCAGTCTACCAAGAGGGCGAAATGCGGTACATAGCAGAGAACGAAACTCAAGTCTCCGGG
GAGGAGGAGGCTGGCGGCAGGAAAGGGCTCACAGCGTTGCACTACGCGGCCGTAACAGGAAGCCGGCGAATGACC
AAATTCTTGCTCGACCACGGAGCCGACCCGAACGCCGTCTCTGGATACGGTGAGACGCCTCTGCATCTAGCACTC
AAACGCGATCTGCACGGCGCAAAGTGGCCTGGCGCGGTTGATTGCTGGAATGACCCGGTCTGGAGAATCGAAGTC
GGCTTTGAAGTTGTGGAGTTGGCTTCCGACAGCGAGGACGAACATGCCTGGACCGGGGCCTACGTCGAGGAGCAT
AGATTCGCTGTCCTCAACCTGCTTCTGGATCATGCCTCGACCGACGTCAACGCCCAAGACGATTCTGGCGCATCC
CCCCTCCATGAGGTGATGAACAGAAACCGGGCATCTTCAACCATCATCAACAAGCTAATTGAGAGGAAAGCCAAC
GTCTCTGCGCGCAATCAGCGGGGGCAGACTCCACTACACCTGGCCTGCTGGACAGGGAATGTCGGCACAGTCGTC
ACCATGCTGGAAAATGGGGCGGATATTGCAGATGGCGACCTTGAGGGACTCAACGCCGTGCACTACGCAGCGCGA
AACAGCAGCATGGAAGTCCTTCTGCACCTCCTGGCGAATGTATGTCCTGTGGCCTTGGCCAGAAGGCGAGATAAC
CGTGGGCGAAATGCACTGCATCATCTGTTGAGCGGGAAGAAACAAGTCGACCCTGCCGTCGTTCAACATCTCATC
GACAACGGAGTCGATGCCAACGACCTCGACGACATGGGTATGTCGCCATTGGCGAATTACCTCAGCCGCTTCCCG
CCCGGACACGAACACGCGCAGGAAGTGGTCCGGCTGCTCTTCCAAGGCGGTGCAGACGCTTCCTTCAGGACTCGC
AGTGGGGGGTTGGGTTTGGTTCATCTTTACGCTCGATCCCGCAGACCGACGGTTGAACTCCTGACCATACTGGAA
AGCTCGGGCGTAAATCTGCAAATGGAAGACGACGAAAATCGTACAGTCCTACATCATTGTGCCATCTCAGGTACC
CTCACCCAAGAGGTCCTATGCTTTCTCTGCAATCAAGTAGGATTGTCAGCGCGTTCCCGCGATGTACATGGGAGA
ACACCACGACAATACGCAGCTGAAGCTGCTAAGATGGAACGCCACCCACACGTCTTTGACCCAAATCGTTGGTCT
CGAACCGAGAAAATCCTCGATAGCTTGGTCTAG
Gene >Hirsu2|7501
ATGGGCGACTTCATCGCCGTCCTCGAGCTAGTCACTAAAATCCGAAAACGTTTTGTCGGGGCTCCGAGCCAGTTC
AACGACATCTCTGCTGAGTACGTGGTCTCGGATAGAATTGATGGCTGCTGACAGCGTACTGCACAGACTCCGAAA
CCTCTGTAACATTATCCATGATGTTGATGTCATGCTGTCGGCGTGCGAGTCCGATGCCCGGCAGAAGGCAAATCT
ACAGGAAATCGCCGGCAGCTGCCACAAGGTACTTGTTGACTTGGAACAAAGACTCGACAAGTGCAGCGTACTCCA
GTCTCGCGGCGACAGTTCGGGTCGAATCTTGAAGAGATTTTGGGAGAGGCTTAAATGGGATCCGGAGGACATTCG
CGAGGTTCGAGATCGAATTATGTCGAATGTGACATTGCTTAATGCAATAATCGGACAGATATCGAGGTAGATCAT
GAGCCTGGCCCTGTTTGCTTCTCGATGGCGGTAGTCACAGACTAAGCTGGAACAGTCAAGCAACGTTGGCGACGA
AGAAAGGGATCGATCGCCTTAATGAGCGGGAGGACGACCGAGAACGACTCATAGTTCTTGACTGGCTCACACCAA
TCGACTTCGCTATAAAACAAAGCGAAATTACGAGTGAGCGACAATCGGGAACTGGCCAGTGGCTTCTAGACTCAT
CAGAGTACAAGTCTTGGGTAGAGAACGAGAACCAAACGTTGTTCTGCCCAGGCATGCCAGGAGCTGGAAAGACAA
CACTGACGTCTATCGTTATTGAGCATCTTACAACTTTGTTTCAGCGCGATAGAAATATTGGCATCGCATACCTGT
ATATCGAGTACAGACGACAAGCCGAACAGAAAGCTTGCGACCTCCTCGCAAGTGTCCTCAAGCAGCTTGCGCAAT
CCCTATCTCCTCTACCGGAATGTTTGACGTCTCTGTGTAGTGTTCACAAGGCTAGGCAAACAAGACCGTCATTCG
AGGAGATCTTGAAGACCCTCCGTTCCCTGGCAGGTTTCCATTCGCGAGTCTTTATCTTGGTCGACGCCCTGGACG
AGTCCCGAGCCGATGGCGCCCGGGAAAAACTCCTGACCGAACTATTCAACCTTCAGGACGCGTGTGGCGCAAACC
TATTCGCAACATCGAGATCCATACCGGAGATAAGTGAAGTATTTGTGAAAAGCCGGACTTTAGAAATTCGAGCCA
ACGATGCCGACGTTCGAAAATTTATTGATAGCCGTATTTTGAATTTCAAGGCTTTCGTTCGTCAGAGCCCGGAGA
TACAGGAGCAGATTCGAACTAAGATTGTTCGTTCGACTCAAGGAATGTAGGTCAAGTGTACTGGCAACCACGACA
CTGCGTTAACGCTCTCAGGTTCCTCCTGGCCTGTTTCCATCTTGATGCCCTACAATATAAGACGTCTGTCAAGAA
ACTCCAAATTGCTCTCACCAAGATACCTATAGGACGAGATGGATACGACAGTGCGTACGACGATACGATGAAGAG
AATCGAAGGGCAGCCTTCAGATCACGTAGAGCTTGCCAAACAGATTCTATCGTGGCTCACCTGCGCGAAGAGGCC
GCTAAAAACCTCGGAACTTCAGGAAGCGCTAGCTGTGGAGCTTGGTGAGCTTGAGCTTGATGAAAACAACCGTCC
GGACGTCGAGGACATGATTTCTGTCTGTGCCGGATTGGTAACGGTCGACGAAGGAGGAGACACGATCCGGCTGAT
CCATTACACGACACAAGAGTACTTGGAGCGGACCCAGTCTACTTGGTTTCCTGATGCAGAAACAGAAATTACCTC
GTGCTGCATCACTTACCTGTCATTTTCCACCTTTGAAAATGGACTTCGGCGTTCGAACAGGCAGCTCCTGCTGTC
TGATTACGCCACAAGATACTGGACTCACCACGCCCGACTCTGTTCACCAGACCCGAGCTTGATCTCCAGCTTCCT
ATCCTCGCCGTCAAAGATGCCCGGTGTCTGCTTACTGGTAGCAGCACAGAATGGAGAGGAGGCAAGCCTATCTTG
GCTATTGGATCGTGGCGTGGATGCAAATGTGTGCGATGAAACCTGGAAAACACCGTTGCATCACGCTGTGCTGAA
CTCTTGGACGAGATGTGTCGAGCTGCTGCTTGCACGAGGTGCAAAAATAACCACAGACGTCCACAACATGACTCC
CTTCCACTACACTGTGTCGAAAGCAAGCGAGGAGATTGCGAAGTGCTTCGTGGACGCCGAAATACCGATCGACGT
CAAGCTGGAAAGGAAAACCTGGCAGCCAGTCTACCAAGAGGGCGAAATGCGGTACATAGCAGAGAACGAAACTCA
AGTCTCCGGGGAGGAGGAGGCTGGCGGCAGGAAAGGGCTCACAGCGTTGCACTACGCGGCCGTAACAGGAAGCCG
GCGAATGACCAAATTCTTGCTCGACCACGGAGCCGACCCGAACGCCGTCTCTGGATACGGTGAGACGCCTCTGCA
TCTAGCACTCAAACGCGATCTGCACGGCGCAAAGTGGCCTGGCGCGGTTGATTGCTGGAATGACCCGGTCTGGAG
AATCGAAGTCGGCTTTGAAGTTGTGGAGTTGGCTTCCGACAGCGAGGACGAACATGCCTGGACCGGGGCCTACGT
CGAGGAGCATAGATTCGCTGTCCTCAACCTGCTTCTGGATCATGCCTCGACCGACGTCAACGCCCAAGACGATTC
TGGCGCATCCCCCCTCCATGAGGTGATGAACAGAAACCGGGCATCTTCAACCATCATCAACAAGCTAATTGAGAG
GAAAGCCAACGTCTCTGCGCGCAATCAGCGGGGGCAGACTCCACTACACCTGGCCTGCTGGACAGGGAATGTCGG
CACAGTCGTCACCATGCTGGAAAATGGGGCGGATATTGCAGATGGCGACCTTGAGGGACTCAACGCCGTGCACTA
CGCAGCGCGAAACAGCAGCATGGAAGTCCTTCTGCACCTCCTGGCGAATGTATGTCCTGTGGCCTTGGCCAGAAG
GCGAGATAACCGTGGGCGAAATGCACTGCATCATCTGTTGAGCGGGAAGAAACAAGTCGACCCTGCCGTCGTTCA
ACATCTCATCGACAACGGAGTCGATGCCAACGACCTCGACGACATGGGTATGTCGCCATTGGCGAATTACCTCAG
CCGCTTCCCGCCCGGACACGAACACGCGCAGGAAGTGGTCCGGCTGCTCTTCCAAGGCGGTGCAGACGCTTCCTT
CAGGACTCGCAGTGGGGGGTTGGGTTTGGTTCATCTTTACGCTCGATCCCGCAGACCGACGGTTGAACTCCTGAC
CATACTGGAAAGCTCGGGCGTAAATCTGCAAATGGAAGACGACGAAAATCGTACAGTCCTACATCATTGTGCCAT
CTCAGGTACCCTCACCCAAGAGGTCCTATGCTTTCTCTGCAATCAAGTAGGATTGTCAGCGCGTTCCCGCGATGT
ACATGGGAGAACACCACGACAATACGCAGCTGAAGCTGCTAAGATGGAACGCCACCCACACGTCTTTGACCCAAA
TCGTTGGTCTCGAACCGAGAAAATCCTCGATAGCTTGGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail