Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7495
Gene name
LocationContig_439:16022..17090
Strand+
Gene length (bp)1068
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08031 BBE Berberine and berberine like 8.8E-07 313 349

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 1 349 1.0E-17
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 37 154 1.0E-12
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 39 222 2.0E-09
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 39 246 1.0E-07

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7495
MVIHLGNLRRVEVDEANLRVAYEGGCLWSDVDGALAARGLVIDNLVSLQMVLADGSVVEASETQHPDLFWAMRGA
GSMFGVVTRFVSRAHRQGDVWSGTLVFAPDKLGQLVAVTNDLHSRDDLEGHCLALSIGYGPDGTTRALTVVPLFH
GPEAEARDYLAGLLRVEAAGSDVRMMTVARLNGLNAKFEHGLRRLMGSCNVTMPLSAAGLQETADMLWSFCDGHG
GMGTSAAIVEFFPTRKLREVPQDGTAHANRGDHYDAALSFGWADPALDDEVRQLGRRVREQIVRTTGHGASGGGG
GGGDGKAGPAGRYVNMEAEPVRPEEAYGDNVERLRGPKARWDADNVFHSWFGVAG*
Coding >Hirsu2|7495
ATGGTGATCCACCTGGGGAACCTGCGCAGGGTCGAGGTCGACGAAGCCAACCTGCGCGTGGCGTACGAGGGCGGC
TGCCTCTGGTCGGACGTGGACGGCGCCCTGGCGGCTCGCGGGCTCGTCATCGACAACCTCGTCTCGCTGCAGATG
GTGCTCGCCGACGGCTCCGTCGTCGAGGCCTCGGAGACGCAGCACCCGGACCTGTTCTGGGCGATGCGCGGGGCG
GGCTCCATGTTTGGGGTCGTGACGCGCTTCGTGTCGCGGGCGCACCGGCAGGGCGACGTCTGGAGCGGGACGCTC
GTGTTCGCGCCGGACAAGCTCGGCCAGCTGGTGGCCGTGACCAACGACTTGCACTCCCGCGACGACCTAGAGGGG
CACTGCCTGGCGCTGAGCATCGGGTACGGGCCGGACGGCACGACGCGCGCCCTGACCGTCGTGCCGCTCTTCCAC
GGCCCGGAGGCGGAGGCGCGGGACTACTTGGCCGGCCTGCTGCGCGTCGAGGCCGCGGGCTCGGACGTGCGGATG
ATGACGGTGGCGCGGCTCAACGGCCTCAACGCAAAGTTCGAACACGGGCTGCGGCGGCTGATGGGGTCGTGCAAC
GTGACGATGCCGCTGAGCGCGGCCGGCCTGCAGGAGACGGCGGACATGCTGTGGTCGTTTTGCGACGGCCACGGC
GGCATGGGCACGTCGGCGGCCATTGTCGAGTTCTTCCCCACGCGCAAGCTGCGCGAGGTGCCTCAGGACGGCACG
GCGCACGCGAACCGCGGGGACCACTACGACGCGGCGCTGTCGTTCGGGTGGGCGGACCCGGCGCTGGACGACGAG
GTGCGGCAGCTGGGCAGGAGGGTGCGCGAGCAGATTGTGCGCACCACCGGACACGGGGCTTCGGGCGGCGGCGGC
GGCGGCGGCGACGGCAAGGCGGGGCCGGCGGGCCGGTACGTCAACATGGAGGCGGAGCCGGTTCGGCCGGAGGAG
GCGTACGGCGACAACGTGGAGAGGCTGAGGGGCCCGAAGGCGCGATGGGACGCGGACAACGTGTTCCACAGCTGG
TTCGGGGTGGCGGGATGA
Transcript >Hirsu2|7495
ATGGTGATCCACCTGGGGAACCTGCGCAGGGTCGAGGTCGACGAAGCCAACCTGCGCGTGGCGTACGAGGGCGGC
TGCCTCTGGTCGGACGTGGACGGCGCCCTGGCGGCTCGCGGGCTCGTCATCGACAACCTCGTCTCGCTGCAGATG
GTGCTCGCCGACGGCTCCGTCGTCGAGGCCTCGGAGACGCAGCACCCGGACCTGTTCTGGGCGATGCGCGGGGCG
GGCTCCATGTTTGGGGTCGTGACGCGCTTCGTGTCGCGGGCGCACCGGCAGGGCGACGTCTGGAGCGGGACGCTC
GTGTTCGCGCCGGACAAGCTCGGCCAGCTGGTGGCCGTGACCAACGACTTGCACTCCCGCGACGACCTAGAGGGG
CACTGCCTGGCGCTGAGCATCGGGTACGGGCCGGACGGCACGACGCGCGCCCTGACCGTCGTGCCGCTCTTCCAC
GGCCCGGAGGCGGAGGCGCGGGACTACTTGGCCGGCCTGCTGCGCGTCGAGGCCGCGGGCTCGGACGTGCGGATG
ATGACGGTGGCGCGGCTCAACGGCCTCAACGCAAAGTTCGAACACGGGCTGCGGCGGCTGATGGGGTCGTGCAAC
GTGACGATGCCGCTGAGCGCGGCCGGCCTGCAGGAGACGGCGGACATGCTGTGGTCGTTTTGCGACGGCCACGGC
GGCATGGGCACGTCGGCGGCCATTGTCGAGTTCTTCCCCACGCGCAAGCTGCGCGAGGTGCCTCAGGACGGCACG
GCGCACGCGAACCGCGGGGACCACTACGACGCGGCGCTGTCGTTCGGGTGGGCGGACCCGGCGCTGGACGACGAG
GTGCGGCAGCTGGGCAGGAGGGTGCGCGAGCAGATTGTGCGCACCACCGGACACGGGGCTTCGGGCGGCGGCGGC
GGCGGCGGCGACGGCAAGGCGGGGCCGGCGGGCCGGTACGTCAACATGGAGGCGGAGCCGGTTCGGCCGGAGGAG
GCGTACGGCGACAACGTGGAGAGGCTGAGGGGCCCGAAGGCGCGATGGGACGCGGACAACGTGTTCCACAGCTGG
TTCGGGGTGGCGGGATGA
Gene >Hirsu2|7495
ATGGTGATCCACCTGGGGAACCTGCGCAGGGTCGAGGTCGACGAAGCCAACCTGCGCGTGGCGTACGAGGGCGGC
TGCCTCTGGTCGGACGTGGACGGCGCCCTGGCGGCTCGCGGGCTCGTCATCGACAACCTCGTCTCGCTGCAGATG
GTGCTCGCCGACGGCTCCGTCGTCGAGGCCTCGGAGACGCAGCACCCGGACCTGTTCTGGGCGATGCGCGGGGCG
GGCTCCATGTTTGGGGTCGTGACGCGCTTCGTGTCGCGGGCGCACCGGCAGGGCGACGTCTGGAGCGGGACGCTC
GTGTTCGCGCCGGACAAGCTCGGCCAGCTGGTGGCCGTGACCAACGACTTGCACTCCCGCGACGACCTAGAGGGG
CACTGCCTGGCGCTGAGCATCGGGTACGGGCCGGACGGCACGACGCGCGCCCTGACCGTCGTGCCGCTCTTCCAC
GGCCCGGAGGCGGAGGCGCGGGACTACTTGGCCGGCCTGCTGCGCGTCGAGGCCGCGGGCTCGGACGTGCGGATG
ATGACGGTGGCGCGGCTCAACGGCCTCAACGCAAAGTTCGAACACGGGCTGCGGCGGCTGATGGGGTCGTGCAAC
GTGACGATGCCGCTGAGCGCGGCCGGCCTGCAGGAGACGGCGGACATGCTGTGGTCGTTTTGCGACGGCCACGGC
GGCATGGGCACGTCGGCGGCCATTGTCGAGTTCTTCCCCACGCGCAAGCTGCGCGAGGTGCCTCAGGACGGCACG
GCGCACGCGAACCGCGGGGACCACTACGACGCGGCGCTGTCGTTCGGGTGGGCGGACCCGGCGCTGGACGACGAG
GTGCGGCAGCTGGGCAGGAGGGTGCGCGAGCAGATTGTGCGCACCACCGGACACGGGGCTTCGGGCGGCGGCGGC
GGCGGCGGCGACGGCAAGGCGGGGCCGGCGGGCCGGTACGTCAACATGGAGGCGGAGCCGGTTCGGCCGGAGGAG
GCGTACGGCGACAACGTGGAGAGGCTGAGGGGCCCGAAGGCGCGATGGGACGCGGACAACGTGTTCCACAGCTGG
TTCGGGGTGGCGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail