Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7473
Gene name
LocationContig_437:1368..2795
Strand+
Gene length (bp)1427
Transcript length (bp)1278
Coding sequence length (bp)1278
Protein length (aa) 426

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00487 FA_desaturase Fatty acid desaturase 5.8E-16 65 269
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 7.9E-14 346 412

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12618|ACO1_AJECA Acyl-CoA desaturase OS=Ajellomyces capsulatus GN=OLE1 PE=1 SV=1 39 420 7.0E-157
sp|O94523|ACO1_SCHPO Probable acyl-CoA desaturase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1281.06c PE=3 SV=1 39 420 1.0E-138
sp|P21147|ACO1_YEAST Acyl-CoA desaturase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OLE1 PE=1 SV=2 39 414 3.0E-126
sp|P13011|ACOD2_MOUSE Acyl-CoA desaturase 2 OS=Mus musculus GN=Scd2 PE=1 SV=2 41 296 2.0E-58
sp|Q6P7B9|ACOD2_RAT Acyl-CoA desaturase 2 OS=Rattus norvegicus GN=Scd2 PE=2 SV=1 41 296 7.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12618|ACO1_AJECA Acyl-CoA desaturase OS=Ajellomyces capsulatus GN=OLE1 PE=1 SV=1 39 420 7.0E-157
sp|O94523|ACO1_SCHPO Probable acyl-CoA desaturase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1281.06c PE=3 SV=1 39 420 1.0E-138
sp|P21147|ACO1_YEAST Acyl-CoA desaturase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OLE1 PE=1 SV=2 39 414 3.0E-126
sp|P13011|ACOD2_MOUSE Acyl-CoA desaturase 2 OS=Mus musculus GN=Scd2 PE=1 SV=2 41 296 2.0E-58
sp|Q6P7B9|ACOD2_RAT Acyl-CoA desaturase 2 OS=Rattus norvegicus GN=Scd2 PE=2 SV=1 41 296 7.0E-58
sp|Q64420|ACOD_MESAU Acyl-CoA desaturase OS=Mesocricetus auratus GN=SCD PE=2 SV=1 41 296 2.0E-57
sp|Q99PL7|SCD3_MOUSE Acyl-CoA desaturase 3 OS=Mus musculus GN=Scd3 PE=1 SV=1 41 296 2.0E-57
sp|P13516|ACOD1_MOUSE Acyl-CoA desaturase 1 OS=Mus musculus GN=Scd1 PE=1 SV=2 41 296 9.0E-57
sp|P07308|ACOD1_RAT Acyl-CoA desaturase 1 OS=Rattus norvegicus GN=Scd1 PE=1 SV=2 41 296 5.0E-56
sp|G5EGH6|FAT7_CAEEL Delta(9)-fatty-acid desaturase fat-7 OS=Caenorhabditis elegans GN=fat-7 PE=2 SV=1 1 326 7.0E-56
sp|O02858|ACOD_PIG Acyl-CoA desaturase (Fragment) OS=Sus scrofa GN=SCD PE=2 SV=1 41 296 2.0E-55
sp|Q95MI7|ACOD_CAPHI Acyl-CoA desaturase OS=Capra hircus GN=SCD PE=2 SV=1 41 296 5.0E-55
sp|O00767|ACOD_HUMAN Acyl-CoA desaturase OS=Homo sapiens GN=SCD PE=1 SV=2 41 296 6.0E-55
sp|O62849|ACOD_SHEEP Acyl-CoA desaturase OS=Ovis aries GN=SCD PE=2 SV=1 41 296 7.0E-55
sp|Q2KIA4|SCD5_BOVIN Stearoyl-CoA desaturase 5 OS=Bos taurus GN=SCD5 PE=2 SV=1 39 311 5.0E-54
sp|G5EGN2|FAT6_CAEEL Delta(9)-fatty-acid desaturase fat-6 OS=Caenorhabditis elegans GN=fat-6 PE=2 SV=1 64 326 8.0E-54
sp|Q86SK9|SCD5_HUMAN Stearoyl-CoA desaturase 5 OS=Homo sapiens GN=SCD5 PE=1 SV=2 39 311 2.0E-52
sp|Q6US81|ACO11_SPOLI Acyl-CoA Delta(11) desaturase OS=Spodoptera littoralis PE=1 SV=1 52 319 2.0E-52
sp|Q9TT94|ACOD_BOVIN Acyl-CoA desaturase OS=Bos taurus GN=SCD PE=2 SV=2 41 296 4.0E-51
sp|Q6T707|SCD4_MOUSE Acyl-CoA desaturase 4 OS=Mus musculus GN=Scd4 PE=1 SV=1 41 296 1.0E-50
sp|Q8ISS3|ACO11_CHORO Acyl-CoA Delta(11) desaturase OS=Choristoneura rosaceana PE=1 SV=1 2 310 4.0E-50
sp|G5ED44|FAT5_CAEEL Delta(9)-fatty-acid desaturase fat-5 OS=Caenorhabditis elegans GN=fat-5 PE=2 SV=1 64 310 2.0E-49
sp|O44390|ACO11_TRINI Acyl-CoA Delta(11) desaturase OS=Trichoplusia ni GN=D11DS PE=1 SV=2 52 329 9.0E-48
sp|Q92038|ACOD_CYPCA Acyl-CoA desaturase OS=Cyprinus carpio PE=2 SV=2 12 297 7.0E-47
sp|Q75PL7|DESAT_BOMMO (11Z)-hexadec-11-enoyl-CoA conjugase OS=Bombyx mori GN=desat1 PE=1 SV=1 52 313 3.0E-43
sp|Q9FV68|ICO5D_LIMDO Icosanoyl-CoA 5-desaturase (Fragment) OS=Limnanthes douglasii PE=1 SV=1 70 315 1.0E-30
sp|O65797|ADS1_ARATH Delta-9 acyl-lipid desaturase 1 OS=Arabidopsis thaliana GN=ADS1 PE=2 SV=1 1 312 7.0E-29
sp|Q949X0|ADS3_ARATH Palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic OS=Arabidopsis thaliana GN=ADS3 PE=2 SV=2 55 312 2.0E-28
sp|Q9SID2|ADS2_ARATH Delta-9 acyl-lipid desaturase 2 OS=Arabidopsis thaliana GN=ADS2 PE=2 SV=2 44 312 4.0E-27
sp|Q9LMI4|ADSL4_ARATH Delta-9 desaturase-like 4 protein OS=Arabidopsis thaliana GN=At1g06350 PE=2 SV=2 55 312 3.0E-26
sp|Q9LND8|ADSL2_ARATH Delta-9 desaturase-like 2 protein OS=Arabidopsis thaliana GN=At1g06100 PE=2 SV=1 55 315 8.0E-26
sp|Q9LMI3|ADSL5_ARATH Delta-9 desaturase-like 5 protein OS=Arabidopsis thaliana GN=At1g06360 PE=2 SV=1 50 312 1.0E-25
sp|Q9LND9|ADSL1_ARATH Delta-9 desaturase-like 1 protein OS=Arabidopsis thaliana GN=At1g06090 PE=2 SV=1 55 312 8.0E-23
sp|Q9LVZ3|ADS32_ARATH Probable lipid desaturase ADS3.2, chloroplastic OS=Arabidopsis thaliana GN=ADS3.2 PE=2 SV=3 72 312 5.0E-22
sp|Q9FPD5|ADSL3_ARATH Delta-9 desaturase-like 3 protein OS=Arabidopsis thaliana GN=At1g06120 PE=2 SV=1 16 312 2.0E-20
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 354 425 1.0E-07
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 354 414 4.0E-06
sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 354 405 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 68 90 22
3 100 122 22
4 181 203 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7473
MELNEPAMSLSEPGMAPSKKELVSKMRDGFGLHEACGRVNWRSVLFVFGIPLAGLALAPGTPLRWPTLLFSLVFY
SISITGITAGYHRLWAHRSYEAGTALRLWLALAGASAAQGSIRWWVRDHRAHHRYSDTDKDPYSVRDGLWHAHVG
WLLTRKDKARVGRADVSDLDADALVVWQHRHFVALLAALVVALPTLVCGLGWRDWRGGFVYGCLVRTFLVHQSTF
CVNSLAHWLGDQPYDDGSSPRDHLLTAVITFGEGYHNFHHEFPSDYRSSPVWYHWDPTKWLIAGLGLVGLARGLR
TFRGNEIEKRRLQQRHKATAKRLRSLDWGVPLESLPVLDWADFKREADEAGKQWLAIGGVVYDVAGFVDSHPGGR
AIIKTGLGRDATQWFKGGVYNHSGNAHNLLCGMRVAVLRGGMELESPHAH*
Coding >Hirsu2|7473
ATGGAGCTCAACGAGCCGGCCATGTCGCTGAGCGAGCCGGGCATGGCGCCGAGCAAGAAGGAGCTCGTGTCCAAG
ATGCGGGACGGCTTCGGCCTGCACGAGGCCTGCGGCCGCGTCAACTGGCGCTCCGTCCTCTTCGTCTTCGGCATC
CCGCTGGCCGGGCTGGCGCTCGCGCCGGGGACGCCGCTGCGGTGGCCGACGCTGCTGTTCTCGCTCGTCTTCTAC
AGCATCTCCATCACGGGCATCACCGCCGGCTATCATCGGCTCTGGGCTCACCGGTCGTACGAGGCCGGCACGGCG
CTCCGGCTGTGGCTCGCGCTGGCGGGCGCCAGCGCGGCGCAGGGCTCGATCCGCTGGTGGGTGCGCGACCACCGG
GCGCACCACCGCTACTCGGACACGGACAAGGACCCGTACTCGGTCCGGGACGGGCTCTGGCACGCCCACGTCGGC
TGGCTGCTAACGCGCAAGGACAAGGCGCGGGTCGGGCGGGCCGACGTGTCGGACCTCGACGCCGACGCGCTCGTC
GTCTGGCAGCACCGGCACTTCGTCGCCCTGCTGGCGGCGCTCGTCGTCGCGCTGCCGACGCTCGTCTGCGGCCTG
GGCTGGCGCGACTGGCGCGGCGGCTTCGTCTACGGCTGCCTCGTCCGTACGTTCCTCGTCCACCAGAGCACCTTT
TGCGTCAACTCGCTCGCCCACTGGCTGGGCGACCAGCCCTACGACGACGGCAGCTCGCCGCGCGACCACCTGCTG
ACGGCCGTCATCACCTTCGGCGAGGGCTACCACAACTTCCACCACGAGTTCCCCTCCGACTACCGCTCCTCGCCC
GTCTGGTACCACTGGGACCCGACCAAGTGGCTGATCGCCGGTCTGGGGCTCGTCGGCCTCGCCCGCGGCCTGCGC
ACCTTCAGGGGCAACGAGATCGAGAAGCGCCGGCTGCAGCAGCGCCACAAGGCCACCGCCAAGCGCCTGCGCAGC
CTCGACTGGGGCGTCCCGCTCGAGAGCCTGCCCGTCCTCGACTGGGCCGACTTCAAGCGCGAGGCCGACGAGGCC
GGCAAGCAGTGGCTGGCCATCGGCGGCGTCGTCTATGACGTCGCCGGCTTCGTCGATAGCCATCCGGGCGGCCGC
GCCATCATCAAGACCGGCCTCGGCCGCGACGCCACCCAGTGGTTCAAGGGCGGCGTCTACAACCACTCGGGCAAC
GCCCACAACCTGCTGTGCGGCATGCGCGTCGCCGTCCTGCGCGGCGGCATGGAGCTCGAGTCGCCGCATGCCCAT
TAG
Transcript >Hirsu2|7473
ATGGAGCTCAACGAGCCGGCCATGTCGCTGAGCGAGCCGGGCATGGCGCCGAGCAAGAAGGAGCTCGTGTCCAAG
ATGCGGGACGGCTTCGGCCTGCACGAGGCCTGCGGCCGCGTCAACTGGCGCTCCGTCCTCTTCGTCTTCGGCATC
CCGCTGGCCGGGCTGGCGCTCGCGCCGGGGACGCCGCTGCGGTGGCCGACGCTGCTGTTCTCGCTCGTCTTCTAC
AGCATCTCCATCACGGGCATCACCGCCGGCTATCATCGGCTCTGGGCTCACCGGTCGTACGAGGCCGGCACGGCG
CTCCGGCTGTGGCTCGCGCTGGCGGGCGCCAGCGCGGCGCAGGGCTCGATCCGCTGGTGGGTGCGCGACCACCGG
GCGCACCACCGCTACTCGGACACGGACAAGGACCCGTACTCGGTCCGGGACGGGCTCTGGCACGCCCACGTCGGC
TGGCTGCTAACGCGCAAGGACAAGGCGCGGGTCGGGCGGGCCGACGTGTCGGACCTCGACGCCGACGCGCTCGTC
GTCTGGCAGCACCGGCACTTCGTCGCCCTGCTGGCGGCGCTCGTCGTCGCGCTGCCGACGCTCGTCTGCGGCCTG
GGCTGGCGCGACTGGCGCGGCGGCTTCGTCTACGGCTGCCTCGTCCGTACGTTCCTCGTCCACCAGAGCACCTTT
TGCGTCAACTCGCTCGCCCACTGGCTGGGCGACCAGCCCTACGACGACGGCAGCTCGCCGCGCGACCACCTGCTG
ACGGCCGTCATCACCTTCGGCGAGGGCTACCACAACTTCCACCACGAGTTCCCCTCCGACTACCGCTCCTCGCCC
GTCTGGTACCACTGGGACCCGACCAAGTGGCTGATCGCCGGTCTGGGGCTCGTCGGCCTCGCCCGCGGCCTGCGC
ACCTTCAGGGGCAACGAGATCGAGAAGCGCCGGCTGCAGCAGCGCCACAAGGCCACCGCCAAGCGCCTGCGCAGC
CTCGACTGGGGCGTCCCGCTCGAGAGCCTGCCCGTCCTCGACTGGGCCGACTTCAAGCGCGAGGCCGACGAGGCC
GGCAAGCAGTGGCTGGCCATCGGCGGCGTCGTCTATGACGTCGCCGGCTTCGTCGATAGCCATCCGGGCGGCCGC
GCCATCATCAAGACCGGCCTCGGCCGCGACGCCACCCAGTGGTTCAAGGGCGGCGTCTACAACCACTCGGGCAAC
GCCCACAACCTGCTGTGCGGCATGCGCGTCGCCGTCCTGCGCGGCGGCATGGAGCTCGAGTCGCCGCATGCCCAT
TAG
Gene >Hirsu2|7473
ATGGAGCTCAACGAGCCGGCCATGTCGCTGAGCGAGCCGGGCATGGCGCCGAGCAAGAAGGAGCTCGTGTCCAAG
ATGCGGGACGGCTTCGGCCTGCACGAGGCCTGCGGCCGCGTCAACTGGCGCTCCGTCCTCTTCGTCTTCGGCATC
CCGCTGGCCGGGCTGGCGCTCGCGCCGGGGACGCCGCTGCGGTGGCCGACGCTGCTGTTCTCGCTCGTCTTCTAC
AGCATCTCCATCACGGGCATCACCGCCGGTGGGTTGCTGCCCCTATTTCCCGAGCTTGCCCCTATTCCCGAGTCT
CGCCCCTATTCCCGTCCTGGCCCCCTATCCCCCCCCCTCCCCCACTCGTCTGAATTTCAAGCAACGACAAGCTCA
CACAGCCTGTCGAAACCTCTCTCACAGGCTATCATCGGCTCTGGGCTCACCGGTCGTACGAGGCCGGCACGGCGC
TCCGGCTGTGGCTCGCGCTGGCGGGCGCCAGCGCGGCGCAGGGCTCGATCCGCTGGTGGGTGCGCGACCACCGGG
CGCACCACCGCTACTCGGACACGGACAAGGACCCGTACTCGGTCCGGGACGGGCTCTGGCACGCCCACGTCGGCT
GGCTGCTAACGCGCAAGGACAAGGCGCGGGTCGGGCGGGCCGACGTGTCGGACCTCGACGCCGACGCGCTCGTCG
TCTGGCAGCACCGGCACTTCGTCGCCCTGCTGGCGGCGCTCGTCGTCGCGCTGCCGACGCTCGTCTGCGGCCTGG
GCTGGCGCGACTGGCGCGGCGGCTTCGTCTACGGCTGCCTCGTCCGTACGTTCCTCGTCCACCAGAGCACCTTTT
GCGTCAACTCGCTCGCCCACTGGCTGGGCGACCAGCCCTACGACGACGGCAGCTCGCCGCGCGACCACCTGCTGA
CGGCCGTCATCACCTTCGGCGAGGGCTACCACAACTTCCACCACGAGTTCCCCTCCGACTACCGCTCCTCGCCCG
TCTGGTACCACTGGGACCCGACCAAGTGGCTGATCGCCGGTCTGGGGCTCGTCGGCCTCGCCCGCGGCCTGCGCA
CCTTCAGGGGCAACGAGATCGAGAAGCGCCGGCTGCAGCAGCGCCACAAGGCCACCGCCAAGCGCCTGCGCAGCC
TCGACTGGGGCGTCCCGCTCGAGAGCCTGCCCGTCCTCGACTGGGCCGACTTCAAGCGCGAGGCCGACGAGGCCG
GCAAGCAGTGGCTGGCCATCGGCGGCGTCGTCTATGACGTCGCCGGCTTCGTCGATAGCCATCCGGGCGGCCGCG
CCATCATCAAGACCGGCCTCGGCCGCGACGCCACCCAGTGGTTCAAGGGCGGCGTCTACAACCACTCGGGCAACG
CCCACAACCTGCTGTGCGGCATGCGCGTCGCCGTCCTGCGCGGCGGCATGGAGCTCGAGTCGCCGCATGCCCATT
AG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail