Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7464
Gene name
LocationContig_435:13480..16284
Strand-
Gene length (bp)2804
Transcript length (bp)2553
Coding sequence length (bp)2553
Protein length (aa) 851

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16770 RTT107_BRCT_5 Regulator of Ty1 transposition protein 107 BRCT domain 1.4E-30 603 704
PF12738 PTCB-BRCT twin BRCT domain 7.6E-20 341 403
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 8.3E-08 338 407

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10337|BRC1_SCHPO BRCT-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brc1 PE=1 SV=1 56 425 5.0E-41
sp|P38850|RT107_YEAST Regulator of Ty1 transposition protein 107 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTT107 PE=1 SV=1 53 444 5.0E-26
sp|Q10337|BRC1_SCHPO BRCT-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brc1 PE=1 SV=1 530 833 4.0E-18
sp|Q14676|MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens GN=MDC1 PE=1 SV=3 641 768 6.0E-11
sp|Q5TM68|MDC1_MACMU Mediator of DNA damage checkpoint protein 1 OS=Macaca mulatta GN=MDC1 PE=3 SV=1 641 768 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10337|BRC1_SCHPO BRCT-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brc1 PE=1 SV=1 56 425 5.0E-41
sp|P38850|RT107_YEAST Regulator of Ty1 transposition protein 107 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTT107 PE=1 SV=1 53 444 5.0E-26
sp|Q10337|BRC1_SCHPO BRCT-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brc1 PE=1 SV=1 530 833 4.0E-18
sp|Q14676|MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens GN=MDC1 PE=1 SV=3 641 768 6.0E-11
sp|Q5TM68|MDC1_MACMU Mediator of DNA damage checkpoint protein 1 OS=Macaca mulatta GN=MDC1 PE=3 SV=1 641 768 6.0E-11
sp|Q7YR40|MDC1_PANTR Mediator of DNA damage checkpoint protein 1 OS=Pan troglodytes GN=MDC1 PE=3 SV=1 641 768 7.0E-11
sp|Q767L8|MDC1_PIG Mediator of DNA damage checkpoint protein 1 OS=Sus scrofa GN=MDC1 PE=3 SV=1 608 768 4.0E-09
sp|Q5U2M8|MDC1_RAT Mediator of DNA damage checkpoint protein 1 OS=Rattus norvegicus GN=Mdc1 PE=1 SV=2 566 765 1.0E-08
sp|Q5PSV9|MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus GN=Mdc1 PE=1 SV=1 659 761 1.0E-08
sp|Q90WJ3|PAXI1_XENLA PAX-interacting protein 1 OS=Xenopus laevis GN=paxip1 PE=1 SV=1 615 758 3.0E-08
sp|Q6ZW49|PAXI1_HUMAN PAX-interacting protein 1 OS=Homo sapiens GN=PAXIP1 PE=1 SV=2 258 424 7.0E-07
sp|A0JNA8|PAXI1_BOVIN PAX-interacting protein 1 OS=Bos taurus GN=PAXIP1 PE=2 SV=1 615 758 7.0E-07
sp|Q6ZW49|PAXI1_HUMAN PAX-interacting protein 1 OS=Homo sapiens GN=PAXIP1 PE=1 SV=2 615 758 1.0E-06
sp|Q6NZQ4|PAXI1_MOUSE PAX-interacting protein 1 OS=Mus musculus GN=Paxip1 PE=1 SV=1 252 424 2.0E-06
sp|A0JNA8|PAXI1_BOVIN PAX-interacting protein 1 OS=Bos taurus GN=PAXIP1 PE=2 SV=1 251 404 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7464
MRDEGFGIFKECSVAFVPSSSLAPKLISELSDVLTDNGASICEPRRDGSIPIEGVTHIVSNTIDFPQYVESQAIM
IPVVSTQWITTSIARRKQAQPRPFSPDPRMIFSEVVVTCAGLPVMDKESIIGATMALGGQESKDATRLTTHICAL
SADDPKVALSLQRGFKGKVVLPHWFDDCFKLGKRIDEGPYLLPDPEILKKGPSDHLLIPVNANLSGATSVNPEWV
PLPPDSDGVRPPATVFQDRRVLLASDLSISSRLAKVIKEIIVHGGGRMVDDVDDCDMLICQYREGPQYVQACQSC
REVGSLSWLFYLIVHNQWRNPLHRLLHYPVPKGGIDGFPGLRITVSNYGGEARVYLENLIRACGAEFTKTMKADN
THLITARDTSEKCKAAPEWGVAVVNHLWLEESYAKCEKKQINLSKYNHFPPRTNLGEIIGQTFFDESRLRDMFYP
GGEEAMSPRAKRRRKILEAAEDNAYHRGPAEGVVIGRHEQERDFSVMRDAPGGGKAGSAAVETPLRSRRPNGGKE
NDSPSVLSTGGRSAKAKARDLLQHIAPDIALYERERKRQTKTGAPWGGKRAADLAEKEQAVRAAAKASSHQGADD
DETRRPAKKSRPSLPEVEMRIIVTAFDRWVGEKNKEDHDRRKLRDLGIQIVQEGLPCDYLVAPKVVRTVKFLCAL
ARGVTVLSTDFIDDVLETGEVPCPDDYILRDDTAEKRYNMKLQTSEARAKSNRGRLLQGVPIYCTEKVRNGPESY
RAIAEANGAIFKLYRARSGTTIKPTTAEEDGHAPPEPVYLLSGIGGEEQQIWSRFRAMAEQGNMEPRIVAPDWLL
DVAMAQQVRFDKKFLVENFHKDELR*
Coding >Hirsu2|7464
ATGAGAGACGAGGGGTTTGGCATCTTCAAGGAGTGCTCGGTCGCCTTCGTGCCGAGCAGCTCGCTGGCGCCCAAG
CTGATCAGTGAGCTGTCCGACGTCCTGACGGACAATGGCGCGTCGATATGCGAGCCGCGACGCGATGGCTCGATC
CCCATCGAGGGGGTCACGCACATCGTCTCCAACACCATCGATTTCCCTCAGTATGTCGAGTCTCAGGCCATCATG
ATCCCCGTCGTGTCGACGCAGTGGATTACCACCTCGATCGCCCGGCGCAAGCAGGCCCAGCCGCGGCCCTTCTCC
CCCGACCCCCGCATGATCTTCTCCGAGGTCGTCGTCACCTGCGCCGGCCTCCCCGTCATGGACAAGGAGAGCATC
ATCGGCGCCACCATGGCACTCGGCGGGCAGGAGAGCAAGGACGCGACCCGCCTAACCACCCACATCTGCGCCCTG
TCCGCCGACGATCCCAAGGTGGCCCTCTCGTTGCAGAGGGGCTTCAAGGGCAAGGTTGTCCTGCCGCACTGGTTC
GATGATTGCTTTAAGCTGGGCAAGCGCATAGACGAGGGGCCTTACCTGCTGCCGGACCCCGAAATCCTCAAGAAG
GGCCCCTCTGACCACCTCTTGATCCCCGTCAATGCCAATCTGTCCGGTGCCACCTCCGTCAATCCTGAATGGGTG
CCGCTGCCACCCGACAGCGACGGCGTCCGCCCTCCGGCCACCGTGTTTCAGGACCGCAGAGTCCTTCTCGCGTCC
GACCTCAGCATATCCTCTCGCCTCGCCAAGGTCATCAAGGAAATCATCGTCCACGGCGGCGGCCGGATGGTCGAC
GACGTCGACGACTGCGACATGCTCATCTGCCAGTATCGCGAGGGTCCCCAGTACGTCCAAGCGTGCCAGTCGTGC
CGGGAGGTCGGCAGCCTGTCCTGGCTCTTCTACCTCATCGTCCACAACCAGTGGCGCAACCCCCTGCACCGGCTC
CTGCACTACCCGGTCCCCAAGGGCGGCATCGACGGCTTTCCCGGGCTGCGGATCACCGTCTCCAACTACGGCGGC
GAGGCCCGCGTCTACCTGGAGAACCTCATCAGGGCCTGCGGCGCCGAGTTCACCAAGACGATGAAGGCCGATAAC
ACGCACCTCATCACGGCCCGCGACACGAGCGAGAAGTGCAAGGCCGCGCCCGAGTGGGGCGTCGCCGTCGTGAAC
CACCTCTGGCTGGAGGAGAGCTACGCCAAGTGCGAGAAGAAGCAGATCAACCTGTCCAAGTACAACCACTTCCCC
CCGCGCACGAACCTGGGCGAGATTATCGGTCAGACCTTCTTCGACGAGTCGCGGCTGCGGGACATGTTCTACCCC
GGCGGCGAGGAGGCCATGTCGCCGCGCGCCAAGCGGCGGCGGAAGATCCTCGAGGCCGCCGAGGACAACGCGTAC
CACAGGGGCCCGGCCGAGGGCGTCGTCATCGGGCGCCACGAGCAGGAGCGCGACTTCTCCGTCATGCGGGACGCG
CCCGGCGGCGGCAAGGCGGGCTCGGCGGCGGTCGAGACGCCACTGCGGTCGCGTCGGCCCAACGGCGGCAAGGAA
AACGACAGCCCCTCGGTCCTGTCCACCGGCGGCCGCAGCGCCAAGGCCAAGGCCCGCGACCTGCTGCAGCACATC
GCGCCGGACATCGCCCTCTACGAGCGCGAGAGAAAGCGGCAGACCAAGACGGGCGCTCCCTGGGGCGGGAAGCGA
GCCGCCGACCTGGCCGAGAAGGAGCAGGCCGTCAGGGCCGCGGCCAAGGCGTCGTCGCACCAGGGCGCCGACGAC
GACGAGACCAGGCGGCCGGCCAAGAAGTCCCGCCCGTCGCTGCCGGAGGTCGAGATGCGCATCATCGTGACGGCC
TTTGACCGGTGGGTCGGGGAGAAGAACAAGGAGGACCACGACAGGCGAAAACTACGTGATCTCGGAATACAGATT
GTCCAGGAGGGCCTCCCCTGCGACTACCTGGTCGCGCCCAAAGTCGTCCGCACGGTCAAGTTCCTCTGCGCCCTG
GCGCGGGGGGTCACGGTGCTGTCGACCGACTTCATCGACGACGTCCTCGAGACGGGCGAGGTCCCCTGCCCCGAC
GACTACATCCTCCGAGACGATACGGCCGAGAAGAGGTACAACATGAAGCTCCAGACGTCCGAGGCGCGGGCCAAG
TCGAACAGGGGCCGGCTGCTGCAGGGGGTCCCGATCTACTGCACGGAGAAGGTGCGCAACGGGCCCGAGAGCTAC
CGGGCCATCGCCGAGGCCAACGGCGCCATCTTCAAGCTGTACCGGGCGCGCAGCGGCACGACCATCAAGCCGACG
ACGGCGGAGGAGGACGGCCACGCGCCGCCGGAGCCGGTCTACCTCCTGAGCGGCATCGGCGGCGAGGAGCAGCAG
ATATGGTCCCGCTTCAGGGCCATGGCCGAGCAGGGTAACATGGAGCCCCGGATCGTGGCGCCCGACTGGCTCCTC
GACGTGGCCATGGCGCAGCAGGTGCGCTTCGACAAGAAGTTTCTGGTGGAAAACTTTCACAAGGACGAGTTGCGG
TGA
Transcript >Hirsu2|7464
ATGAGAGACGAGGGGTTTGGCATCTTCAAGGAGTGCTCGGTCGCCTTCGTGCCGAGCAGCTCGCTGGCGCCCAAG
CTGATCAGTGAGCTGTCCGACGTCCTGACGGACAATGGCGCGTCGATATGCGAGCCGCGACGCGATGGCTCGATC
CCCATCGAGGGGGTCACGCACATCGTCTCCAACACCATCGATTTCCCTCAGTATGTCGAGTCTCAGGCCATCATG
ATCCCCGTCGTGTCGACGCAGTGGATTACCACCTCGATCGCCCGGCGCAAGCAGGCCCAGCCGCGGCCCTTCTCC
CCCGACCCCCGCATGATCTTCTCCGAGGTCGTCGTCACCTGCGCCGGCCTCCCCGTCATGGACAAGGAGAGCATC
ATCGGCGCCACCATGGCACTCGGCGGGCAGGAGAGCAAGGACGCGACCCGCCTAACCACCCACATCTGCGCCCTG
TCCGCCGACGATCCCAAGGTGGCCCTCTCGTTGCAGAGGGGCTTCAAGGGCAAGGTTGTCCTGCCGCACTGGTTC
GATGATTGCTTTAAGCTGGGCAAGCGCATAGACGAGGGGCCTTACCTGCTGCCGGACCCCGAAATCCTCAAGAAG
GGCCCCTCTGACCACCTCTTGATCCCCGTCAATGCCAATCTGTCCGGTGCCACCTCCGTCAATCCTGAATGGGTG
CCGCTGCCACCCGACAGCGACGGCGTCCGCCCTCCGGCCACCGTGTTTCAGGACCGCAGAGTCCTTCTCGCGTCC
GACCTCAGCATATCCTCTCGCCTCGCCAAGGTCATCAAGGAAATCATCGTCCACGGCGGCGGCCGGATGGTCGAC
GACGTCGACGACTGCGACATGCTCATCTGCCAGTATCGCGAGGGTCCCCAGTACGTCCAAGCGTGCCAGTCGTGC
CGGGAGGTCGGCAGCCTGTCCTGGCTCTTCTACCTCATCGTCCACAACCAGTGGCGCAACCCCCTGCACCGGCTC
CTGCACTACCCGGTCCCCAAGGGCGGCATCGACGGCTTTCCCGGGCTGCGGATCACCGTCTCCAACTACGGCGGC
GAGGCCCGCGTCTACCTGGAGAACCTCATCAGGGCCTGCGGCGCCGAGTTCACCAAGACGATGAAGGCCGATAAC
ACGCACCTCATCACGGCCCGCGACACGAGCGAGAAGTGCAAGGCCGCGCCCGAGTGGGGCGTCGCCGTCGTGAAC
CACCTCTGGCTGGAGGAGAGCTACGCCAAGTGCGAGAAGAAGCAGATCAACCTGTCCAAGTACAACCACTTCCCC
CCGCGCACGAACCTGGGCGAGATTATCGGTCAGACCTTCTTCGACGAGTCGCGGCTGCGGGACATGTTCTACCCC
GGCGGCGAGGAGGCCATGTCGCCGCGCGCCAAGCGGCGGCGGAAGATCCTCGAGGCCGCCGAGGACAACGCGTAC
CACAGGGGCCCGGCCGAGGGCGTCGTCATCGGGCGCCACGAGCAGGAGCGCGACTTCTCCGTCATGCGGGACGCG
CCCGGCGGCGGCAAGGCGGGCTCGGCGGCGGTCGAGACGCCACTGCGGTCGCGTCGGCCCAACGGCGGCAAGGAA
AACGACAGCCCCTCGGTCCTGTCCACCGGCGGCCGCAGCGCCAAGGCCAAGGCCCGCGACCTGCTGCAGCACATC
GCGCCGGACATCGCCCTCTACGAGCGCGAGAGAAAGCGGCAGACCAAGACGGGCGCTCCCTGGGGCGGGAAGCGA
GCCGCCGACCTGGCCGAGAAGGAGCAGGCCGTCAGGGCCGCGGCCAAGGCGTCGTCGCACCAGGGCGCCGACGAC
GACGAGACCAGGCGGCCGGCCAAGAAGTCCCGCCCGTCGCTGCCGGAGGTCGAGATGCGCATCATCGTGACGGCC
TTTGACCGGTGGGTCGGGGAGAAGAACAAGGAGGACCACGACAGGCGAAAACTACGTGATCTCGGAATACAGATT
GTCCAGGAGGGCCTCCCCTGCGACTACCTGGTCGCGCCCAAAGTCGTCCGCACGGTCAAGTTCCTCTGCGCCCTG
GCGCGGGGGGTCACGGTGCTGTCGACCGACTTCATCGACGACGTCCTCGAGACGGGCGAGGTCCCCTGCCCCGAC
GACTACATCCTCCGAGACGATACGGCCGAGAAGAGGTACAACATGAAGCTCCAGACGTCCGAGGCGCGGGCCAAG
TCGAACAGGGGCCGGCTGCTGCAGGGGGTCCCGATCTACTGCACGGAGAAGGTGCGCAACGGGCCCGAGAGCTAC
CGGGCCATCGCCGAGGCCAACGGCGCCATCTTCAAGCTGTACCGGGCGCGCAGCGGCACGACCATCAAGCCGACG
ACGGCGGAGGAGGACGGCCACGCGCCGCCGGAGCCGGTCTACCTCCTGAGCGGCATCGGCGGCGAGGAGCAGCAG
ATATGGTCCCGCTTCAGGGCCATGGCCGAGCAGGGTAACATGGAGCCCCGGATCGTGGCGCCCGACTGGCTCCTC
GACGTGGCCATGGCGCAGCAGGTGCGCTTCGACAAGAAGTTTCTGGTGGAAAACTTTCACAAGGACGAGTTGCGG
TGA
Gene >Hirsu2|7464
ATGAGAGACGAGGGGTTTGGCATCTTCAAGGAGTGCTCGGTCGCCTTCGTGCCGAGCAGCTCGCTGGCGCCCAAG
CTGATCAGTGAGGTGAGCCGCGGTCTCGTCCGGTGTCCCATCTTCTTTCGTTCCCTCTTTCAACGCGGCCTGCGT
CGTTTTGCTGACGGCGAGACGCCGCAGCTGTCCGACGTCCTGACGGACAATGGCGCGTCGATATGCGAGCCGCGA
CGCGATGGCTCGATCCCCATCGAGGGGGTCACGCACATCGTCTCCAACACCATCGATTTCCCTCAGTATGTCGAG
TCTCAGGCCATCATGATCCCCGTCGTGTCGACGCAGTGGATTACCACCTCGATCGCCCGGCGCAAGCAGGCCCAG
CCGCGGCCCTTCTCCCCCGACCCCCGCATGATCTTCTCCGAGGTCGTCGTCACCTGCGCCGGCCTCCCCGTCATG
GACAAGGAGAGCATCATCGGCGCCACCATGGCACTCGGCGGGCAGGAGAGCAAGGACGCGACCCGCCTAACCACC
CACATCTGCGCCCTGTCCGCCGACGATCCCAAGGTGGCCCTCTCGTTGCAGAGGGGCTTCAAGGGCAAGGTTGTC
CTGCCGCACTGGTAAAGTTGACACTTTTTGTTTTCCCGTTCTTCCCGCATCAGGCCACTGAGCTCTTCTAACACG
TCTCGTGTCCAGGTTCGATGATTGCTTTAAGCTGGGCAAGCGCATAGACGAGGGGCCTTACCTGCTGCCGGACCC
CGAAATCCTCAAGAAGGGCCCCTCTGACCACCTCTTGATCCCCGTCAATGCCAATCTGTCCGGTGCCACCTCCGT
CAATCCTGAATGGGTGCCGCTGCCACCCGACAGCGACGGCGTCCGCCCTCCGGCCACCGTGTTTCAGGACCGCAG
AGTCCTTCTCGCGTCCGACCTCAGCATATCCTCTCGCCTCGCCAAGGTCATCAAGGAAATCATCGTCCACGGCGG
CGGCCGGATGGTCGACGACGTCGACGACTGCGACATGCTCATCTGCCAGTATCGCGAGGGTCCCCAGTACGTCCA
AGCGTGCCAGTCGTGCCGGGAGGTCGGCAGCCTGTCCTGGCTCTTCTACCTCATCGTCCACAACCAGTGGCGCAA
CCCCCTGCACCGGCTCCTGCACTACCCGGTCCCCAAGGGCGGCATCGACGGCTTTCCCGGGCTGCGGATCACCGT
CTCCAACTACGGCGGCGAGGCCCGCGTCTACCTGGAGAACCTCATCAGGGCCTGCGGCGCCGAGTTCACCAAGAC
GATGAAGGCCGATAACACGCACCTCATCACGGCCCGCGACACGAGCGAGAAGTGCAAGGCCGCGCCCGAGTGGGG
CGTCGCCGTCGTGAACCACCTCTGGCTGGAGGAGAGCTACGCCAAGTGCGAGAAGAAGCAGATCAACCTGTCCAA
GTACAACCACTTCCCCCCGCGCACGAACCTGGGCGAGATTATCGGTCAGACCTTCTTCGACGAGTCGCGGCTGCG
GGACATGTTCTACCCCGGCGGCGAGGAGGCCATGTCGCCGCGCGCCAAGCGGCGGCGGAAGATCCTCGAGGCCGC
CGAGGACAACGCGTACCACAGGGGCCCGGCCGAGGGCGTCGTCATCGGGCGCCACGAGCAGGAGCGCGACTTCTC
CGTCATGCGGGACGCGCCCGGCGGCGGCAAGGCGGGCTCGGCGGCGGTCGAGACGCCACTGCGGTCGCGTCGGCC
CAACGGCGGCAAGGAAAACGACAGCCCCTCGGTCCTGTCCACCGGCGGCCGCAGCGCCAAGGCCAAGGCCCGCGA
CCTGCTGCAGCACATCGCGCCGGACATCGCCCTCTACGAGCGCGAGAGAAAGCGGCAGACCAAGACGGGCGCTCC
CTGGGGCGGGAAGCGAGCCGCCGACCTGGCCGAGAAGGAGCAGGCCGTCAGGGCCGCGGCCAAGGCGTCGTCGCA
CCAGGGCGCCGACGACGACGAGACCAGGCGGCCGGCCAAGAAGTCCCGCCCGTCGCTGCCGGAGGTCGAGATGCG
CATCATCGTGACGGCCTTTGACCGGTGGGTCGGGGAGAAGAACAAGGAGGACCACGACAGGGTGAGTGCTCGTGC
ACCAGACCGTTCCAACACGACGTTGGCCGTTGATGCTAACTGTCCGCGCCTTTCTCTTTCTCTCGTGACAGCGAA
AACTACGTGATCTCGGAATACAGATTGTCCAGGAGGGCCTCCCCTGCGACTACCTGGTCGCGCCCAAAGTCGTCC
GCACGGTCAAGTTCCTCTGCGCCCTGGCGCGGGGGGTCACGGTGCTGTCGACCGACTTCATCGACGACGTCCTCG
AGACGGGCGAGGTCCCCTGCCCCGACGACTACATCCTCCGAGACGATACGGCCGAGAAGAGGTACAACATGAAGC
TCCAGACGTCCGAGGCGCGGGCCAAGTCGAACAGGGGCCGGCTGCTGCAGGGGGTCCCGATCTACTGCACGGAGA
AGGTGCGCAACGGGCCCGAGAGCTACCGGGCCATCGCCGAGGCCAACGGCGCCATCTTCAAGCTGTACCGGGCGC
GCAGCGGCACGACCATCAAGCCGACGACGGCGGAGGAGGACGGCCACGCGCCGCCGGAGCCGGTCTACCTCCTGA
GCGGCATCGGCGGCGAGGAGCAGCAGATATGGTCCCGCTTCAGGGCCATGGCCGAGCAGGGTAACATGGAGCCCC
GGATCGTGGCGCCCGACTGGCTCCTCGACGTGGCCATGGCGCAGCAGGTGCGCTTCGACAAGAAGTTTCTGGTGG
AAAACTTTCACAAGGACGAGTTGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail