Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7462
Gene name
LocationContig_435:8311..11673
Strand-
Gene length (bp)3362
Transcript length (bp)3291
Coding sequence length (bp)3291
Protein length (aa) 1097

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 5.7E-43 6 303
PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain 3.4E-18 678 802
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 2.0E-15 163 244
PF04324 Fer2_BFD BFD-like [2Fe-2S] binding domain 5.6E-11 465 512
PF13806 Rieske_2 Rieske-like [2Fe-2S] domain 1.5E-12 913 1012
PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain 1.3E-11 604 667
PF00355 Rieske Rieske [2Fe-2S] domain 3.0E-11 913 999

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38681|NIR_NEUCR Nitrite reductase [NAD(P)H] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-6 PE=2 SV=2 6 1066 0.0E+00
sp|P22944|NIR_EMENI Nitrite reductase [NAD(P)H] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niiA PE=3 SV=2 6 1077 0.0E+00
sp|Q06458|NIRB_KLEOX Nitrite reductase [NAD(P)H] large subunit OS=Klebsiella oxytoca GN=nasB PE=3 SV=1 8 1008 0.0E+00
sp|P08201|NIRB_ECOLI Nitrite reductase (NADH) large subunit OS=Escherichia coli (strain K12) GN=nirB PE=3 SV=4 7 877 0.0E+00
sp|P42435|NASD_BACSU Nitrite reductase [NAD(P)H] OS=Bacillus subtilis (strain 168) GN=nasD PE=2 SV=1 6 857 1.0E-128
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38681|NIR_NEUCR Nitrite reductase [NAD(P)H] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-6 PE=2 SV=2 6 1066 0.0E+00
sp|P22944|NIR_EMENI Nitrite reductase [NAD(P)H] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niiA PE=3 SV=2 6 1077 0.0E+00
sp|Q06458|NIRB_KLEOX Nitrite reductase [NAD(P)H] large subunit OS=Klebsiella oxytoca GN=nasB PE=3 SV=1 8 1008 0.0E+00
sp|P08201|NIRB_ECOLI Nitrite reductase (NADH) large subunit OS=Escherichia coli (strain K12) GN=nirB PE=3 SV=4 7 877 0.0E+00
sp|P42435|NASD_BACSU Nitrite reductase [NAD(P)H] OS=Bacillus subtilis (strain 168) GN=nasD PE=2 SV=1 6 857 1.0E-128
sp|P42433|NASB_BACSU Assimilatory nitrate reductase electron transfer subunit OS=Bacillus subtilis (strain 168) GN=nasB PE=2 SV=2 6 818 2.0E-74
sp|Q05805|SIR_DESVH Sulfite reductase, assimilatory-type OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=DVU_1597 PE=4 SV=2 602 814 3.0E-35
sp|P43504|NIR_LEPMC Nitrite reductase [NAD(P)H] (Fragment) OS=Leptosphaeria maculans GN=NIIA PE=3 SV=1 19 124 3.0E-32
sp|Q7MFY7|NORW_VIBVY Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio vulnificus (strain YJ016) GN=norW PE=3 SV=1 8 357 1.0E-25
sp|Q8D4F7|NORW_VIBVU Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio vulnificus (strain CMCP6) GN=norW PE=3 SV=1 8 357 3.0E-25
sp|Q58065|NAOX_METJA Putative NADH oxidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0649 PE=3 SV=2 9 299 1.0E-20
sp|A8GG95|NORW_SERP5 Nitric oxide reductase FlRd-NAD(+) reductase OS=Serratia proteamaculans (strain 568) GN=norW PE=3 SV=1 8 345 1.0E-19
sp|Q0VTB0|RURE_ALCBS Rubredoxin-NAD(+) reductase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rubB PE=1 SV=1 8 324 1.0E-17
sp|Q07946|BEDA_PSEPU Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase subunit OS=Pseudomonas putida GN=bedA PE=1 SV=1 6 302 9.0E-17
sp|A4WDR7|NORW_ENT38 Nitric oxide reductase FlRd-NAD(+) reductase OS=Enterobacter sp. (strain 638) GN=norW PE=3 SV=1 8 345 2.0E-16
sp|B7UHC3|NORW_ECO27 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=norW PE=3 SV=1 8 345 3.0E-16
sp|B7NSJ1|NORW_ECO7I Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=norW PE=3 SV=1 6 345 1.0E-15
sp|A0KEJ2|NORW_AERHH Nitric oxide reductase FlRd-NAD(+) reductase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=norW PE=3 SV=1 2 345 1.0E-15
sp|Q0TEG9|NORW_ECOL5 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=norW PE=3 SV=1 8 345 2.0E-15
sp|Q9UYU5|CDR_PYRAB Coenzyme A disulfide reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB14120 PE=3 SV=1 83 355 2.0E-15
sp|B1LQ29|NORW_ECOSM Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=norW PE=3 SV=1 6 345 2.0E-15
sp|Q3YYF3|NORW_SHISS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella sonnei (strain Ss046) GN=norW PE=3 SV=1 8 345 3.0E-15
sp|B7MYL1|NORW_ECO81 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O81 (strain ED1a) GN=norW PE=3 SV=1 8 345 4.0E-15
sp|Q8FEN4|NORW_ECOL6 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=norW PE=3 SV=1 8 345 4.0E-15
sp|B7LW23|NORW_ESCF3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=norW PE=3 SV=1 8 345 5.0E-15
sp|Q1R7Y9|NORW_ECOUT Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain UTI89 / UPEC) GN=norW PE=3 SV=1 8 345 5.0E-15
sp|A1AEQ1|NORW_ECOK1 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O1:K1 / APEC GN=norW PE=3 SV=1 8 345 5.0E-15
sp|B7MKI0|NORW_ECO45 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=norW PE=3 SV=1 8 345 5.0E-15
sp|Q9L4M8|RURE_PSEPU Rubredoxin-NAD(+) reductase OS=Pseudomonas putida GN=alkT PE=3 SV=1 8 308 5.0E-15
sp|B5Z372|NORW_ECO5E Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=norW PE=3 SV=1 8 345 7.0E-15
sp|Q8X850|NORW_ECO57 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 GN=norW PE=3 SV=1 8 345 7.0E-15
sp|Q32CL7|NORW_SHIDS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=norW PE=3 SV=1 8 345 2.0E-14
sp|A8A3I8|NORW_ECOHS Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O9:H4 (strain HS) GN=norW PE=3 SV=1 8 345 2.0E-14
sp|P59403|NORW_SHIFL Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri GN=norW PE=3 SV=1 8 345 2.0E-14
sp|Q0T1D6|NORW_SHIF8 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri serotype 5b (strain 8401) GN=norW PE=3 SV=1 8 345 2.0E-14
sp|B7M9E8|NORW_ECO8A Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O8 (strain IAI1) GN=norW PE=3 SV=1 8 345 2.0E-14
sp|B7LEC2|NORW_ECO55 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain 55989 / EAEC) GN=norW PE=3 SV=1 8 345 2.0E-14
sp|B5FG80|NORW_VIBFM Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio fischeri (strain MJ11) GN=norW PE=3 SV=1 8 345 3.0E-14
sp|A5W4E9|TODA_PSEP1 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todA PE=1 SV=1 8 302 3.0E-14
sp|B7N6U1|NORW_ECOLU Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=norW PE=3 SV=1 8 345 4.0E-14
sp|Q6D8S1|NORW_PECAS Nitric oxide reductase FlRd-NAD(+) reductase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=norW PE=3 SV=1 6 345 4.0E-14
sp|P37337|BPHG_BURXL Biphenyl dioxygenase system ferredoxin--NAD(+) reductase component OS=Burkholderia xenovorans (strain LB400) GN=bphG PE=3 SV=2 8 302 6.0E-14
sp|P17052|RURE_PSEOL Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovorans GN=alkT PE=1 SV=1 8 308 7.0E-14
sp|B6I697|NORW_ECOSE Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SE11) GN=norW PE=3 SV=1 8 345 1.0E-13
sp|P37596|NORW_ECOLI Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12) GN=norW PE=1 SV=3 8 345 1.0E-13
sp|B1IUW8|NORW_ECOLC Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=norW PE=3 SV=1 8 345 1.0E-13
sp|B1XCN8|NORW_ECODH Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / DH10B) GN=norW PE=3 SV=1 8 345 1.0E-13
sp|C4ZYV6|NORW_ECOBW Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=norW PE=3 SV=1 8 345 1.0E-13
sp|B7N6C9|HCAD_ECOLU 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hcaD PE=3 SV=1 6 300 1.0E-13
sp|A8ANR8|NORW_CITK8 Nitric oxide reductase FlRd-NAD(+) reductase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=norW PE=3 SV=1 8 324 1.0E-13
sp|B4TF25|NORW_SALHS Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella heidelberg (strain SL476) GN=norW PE=3 SV=1 8 324 4.0E-13
sp|B2U036|NORW_SHIB3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=norW PE=3 SV=1 8 345 4.0E-13
sp|A7ZQE0|NORW_ECO24 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=norW PE=3 SV=1 8 345 4.0E-13
sp|Q0S032|BPHA4_RHOJR Biphenyl 2,3-dioxygenase, ferredoxin reductase component OS=Rhodococcus jostii (strain RHA1) GN=bphA4 PE=1 SV=1 27 302 5.0E-13
sp|A9MFX5|NORW_SALAR Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=norW PE=3 SV=1 8 324 5.0E-13
sp|Q31X75|NORW_SHIBS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 4 (strain Sb227) GN=norW PE=3 SV=2 8 345 5.0E-13
sp|Q5XC60|NAOX_STRP6 Probable NADH oxidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0868 PE=1 SV=1 7 301 8.0E-13
sp|B1LNJ8|HCAD_ECOSM 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hcaD PE=3 SV=1 6 300 9.0E-13
sp|C0PWN3|NORW_SALPC Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi C (strain RKS4594) GN=norW PE=3 SV=1 8 324 1.0E-12
sp|Q57KT2|NORW_SALCH Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella choleraesuis (strain SC-B67) GN=norW PE=3 SV=1 8 324 1.0E-12
sp|B4TT18|NORW_SALSV Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella schwarzengrund (strain CVM19633) GN=norW PE=3 SV=1 8 324 1.0E-12
sp|Q5E3X0|NORW_VIBF1 Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=norW PE=3 SV=2 8 345 1.0E-12
sp|A9N0E0|NORW_SALPB Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=norW PE=3 SV=1 8 324 1.0E-12
sp|Q40977|MDAR_PEA Monodehydroascorbate reductase OS=Pisum sativum PE=1 SV=1 71 302 1.0E-12
sp|B5RDG6|NORW_SALG2 Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=norW PE=3 SV=1 8 324 2.0E-12
sp|Q9AL95|NROR_CLOAB NADH-rubredoxin oxidoreductase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=nroR PE=1 SV=1 7 357 2.0E-12
sp|Q9SR59|MDAR3_ARATH Monodehydroascorbate reductase 3 OS=Arabidopsis thaliana GN=MDAR3 PE=2 SV=1 36 308 2.0E-12
sp|B5QV90|NORW_SALEP Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella enteritidis PT4 (strain P125109) GN=norW PE=3 SV=1 8 324 2.0E-12
sp|Q8L3B0|PADH_AZOEV NADH-dependent phenylglyoxylate dehydrogenase subunit epsilon OS=Azoarcus evansii GN=padH PE=1 SV=1 7 307 2.0E-12
sp|Q5JGP4|CDR_THEKO Coenzyme A disulfide reductase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1299 PE=3 SV=1 83 421 2.0E-12
sp|P43494|THCD_RHOER Rhodocoxin reductase OS=Rhodococcus erythropolis GN=thcD PE=1 SV=2 7 302 2.0E-12
sp|Q8Z4C4|NORW_SALTI Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella typhi GN=norW PE=3 SV=1 8 324 3.0E-12
sp|B5F365|NORW_SALA4 Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella agona (strain SL483) GN=norW PE=3 SV=1 8 324 3.0E-12
sp|Q8ZMJ6|NORW_SALTY Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=norW PE=3 SV=1 8 324 3.0E-12
sp|A4STH3|NORW_AERS4 Nitric oxide reductase FlRd-NAD(+) reductase OS=Aeromonas salmonicida (strain A449) GN=norW PE=3 SV=1 2 345 3.0E-12
sp|A6TCX6|NORW_KLEP7 Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=norW PE=3 SV=1 8 324 4.0E-12
sp|B5FSZ2|NORW_SALDC Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella dublin (strain CT_02021853) GN=norW PE=3 SV=1 8 324 4.0E-12
sp|B4T3B2|NORW_SALNS Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella newport (strain SL254) GN=norW PE=3 SV=1 8 324 5.0E-12
sp|Q43497|MDAR_SOLLC Monodehydroascorbate reductase OS=Solanum lycopersicum GN=AFRR PE=1 SV=1 71 310 5.0E-12
sp|B7NRJ1|HCAD_ECO7I 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hcaD PE=3 SV=1 6 300 6.0E-12
sp|Q8U1M0|CDR_PYRFU Coenzyme A disulfide reductase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1186 PE=3 SV=1 104 300 6.0E-12
sp|Q4L4Y7|CDR_STAHJ Coenzyme A disulfide reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cdr PE=3 SV=1 6 299 7.0E-12
sp|B5BEP9|NORW_SALPK Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi A (strain AKU_12601) GN=norW PE=3 SV=1 8 324 9.0E-12
sp|Q5PF36|NORW_SALPA Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=norW PE=3 SV=1 8 324 9.0E-12
sp|Q10499|AIF1_SCHPO Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aif1 PE=3 SV=3 36 300 9.0E-12
sp|B5XVA0|NORW_KLEP3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae (strain 342) GN=norW PE=3 SV=1 8 324 9.0E-12
sp|B5Z115|HCAD_ECO5E 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hcaD PE=3 SV=1 6 300 1.0E-11
sp|Q8XA71|HCAD_ECO57 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 GN=hcaD PE=3 SV=1 6 300 1.0E-11
sp|B6I5B5|HCAD_ECOSE 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SE11) GN=hcaD PE=3 SV=1 6 300 2.0E-11
sp|B7LDD4|HCAD_ECO55 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain 55989 / EAEC) GN=hcaD PE=3 SV=1 6 300 2.0E-11
sp|P42454|RURE_ACIAD Rubredoxin-NAD(+) reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rubB PE=1 SV=2 112 330 3.0E-11
sp|P0C621|TODA_PSEPU Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida GN=todA PE=3 SV=1 8 282 3.0E-11
sp|P08087|BNZD_PSEPU Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida GN=bnzD PE=3 SV=3 8 282 3.0E-11
sp|D5IGG6|FDR_SPHSX Ferredoxin--NAD(P)(+) reductase fdr OS=Sphingomonas sp. GN=fdr PE=1 SV=1 35 300 3.0E-11
sp|Q9HTK9|RURE_PSEAE Rubredoxin-NAD(+) reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=alkT PE=1 SV=1 8 324 5.0E-11
sp|A2RIB7|NAOX_LACLM NADH oxidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=noxE PE=1 SV=1 7 311 9.0E-11
sp|Q49WB0|CDR_STAS1 Coenzyme A disulfide reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cdr PE=3 SV=1 87 299 1.0E-10
sp|A5IRE8|CDR_STAA9 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain JH9) GN=cdr PE=3 SV=1 64 301 3.0E-10
sp|A6U077|CDR_STAA2 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain JH1) GN=cdr PE=3 SV=1 64 301 3.0E-10
sp|Q9LK94|MDAR4_ARATH Monodehydroascorbate reductase 4, peroxisomal OS=Arabidopsis thaliana GN=MDAR4 PE=1 SV=1 38 308 4.0E-10
sp|Q3TY86|AIFM3_MOUSE Apoptosis-inducing factor 3 OS=Mus musculus GN=Aifm3 PE=1 SV=1 3 302 6.0E-10
sp|Q9GRX6|AIFM1_DICDI Apoptosis-inducing factor 1, mitochondrial OS=Dictyostelium discoideum GN=aif PE=2 SV=1 7 309 7.0E-10
sp|Q93WJ8|MDAR2_ARATH Monodehydroascorbate reductase 2 OS=Arabidopsis thaliana GN=MDAR2 PE=2 SV=1 113 302 8.0E-10
sp|Q96NN9|AIFM3_HUMAN Apoptosis-inducing factor 3 OS=Homo sapiens GN=AIFM3 PE=1 SV=1 3 302 1.0E-09
sp|Q8NXE8|CDR_STAAW Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MW2) GN=cdr PE=3 SV=3 64 301 1.0E-09
sp|Q6GAV6|CDR_STAAS Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MSSA476) GN=cdr PE=3 SV=3 64 301 1.0E-09
sp|A8Z076|CDR_STAAT Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=cdr PE=3 SV=1 64 301 1.0E-09
sp|A6QFI1|CDR_STAAE Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Newman) GN=cdr PE=3 SV=1 64 301 1.0E-09
sp|Q2FIA5|CDR_STAA3 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain USA300) GN=cdr PE=1 SV=1 64 301 1.0E-09
sp|Q5HHB4|CDR_STAAC Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain COL) GN=cdr PE=3 SV=3 64 301 1.0E-09
sp|Q7A6H1|CDR_STAAN Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain N315) GN=cdr PE=1 SV=3 64 301 2.0E-09
sp|Q99VC0|CDR_STAAM Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cdr PE=3 SV=3 64 301 2.0E-09
sp|A7X0I7|CDR_STAA1 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=cdr PE=3 SV=1 64 301 2.0E-09
sp|Q2YWW1|CDR_STAAB Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cdr PE=3 SV=1 64 301 2.0E-09
sp|O52582|CDR_STAA8 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain NCTC 8325) GN=cdr PE=1 SV=3 64 301 3.0E-09
sp|P33009|TERPA_PSESP Terpredoxin reductase OS=Pseudomonas sp. GN=terPA PE=4 SV=1 113 299 4.0E-09
sp|P16640|CAMA_PSEPU Putidaredoxin reductase OS=Pseudomonas putida GN=camA PE=1 SV=1 4 307 5.0E-09
sp|P37061|NAOX_ENTFA NADH oxidase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=nox PE=1 SV=1 7 355 7.0E-08
sp|Q58280|Y870_METJA Uncharacterized protein MJ0870 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0870 PE=3 SV=1 607 740 1.0E-07
sp|Q9JM53|AIFM1_RAT Apoptosis-inducing factor 1, mitochondrial OS=Rattus norvegicus GN=Aifm1 PE=1 SV=1 30 308 2.0E-07
sp|Q84BZ0|ANDAA_BURCE Anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Burkholderia cepacia GN=andAa PE=1 SV=1 1 299 1.0E-06
sp|Q42711|MDARS_CUCSA Monodehydroascorbate reductase, seedling isozyme OS=Cucumis sativus PE=2 SV=1 106 302 1.0E-06
sp|Q9Z0X1|AIFM1_MOUSE Apoptosis-inducing factor 1, mitochondrial OS=Mus musculus GN=Aifm1 PE=1 SV=1 36 302 1.0E-06
sp|P9WHH5|STHA_MYCTU Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sthA PE=1 SV=1 98 349 3.0E-06
sp|P9WHH4|STHA_MYCTO Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sthA PE=3 SV=1 98 349 3.0E-06
sp|A5U665|STHA_MYCTA Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=sthA PE=3 SV=1 98 349 3.0E-06
sp|C1AFH2|STHA_MYCBT Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=sthA PE=3 SV=1 98 349 3.0E-06
sp|A1KM51|STHA_MYCBP Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=sthA PE=3 SV=1 98 349 3.0E-06
sp|P66007|STHA_MYCBO Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=sthA PE=3 SV=1 98 349 3.0E-06
sp|O95831|AIFM1_HUMAN Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens GN=AIFM1 PE=1 SV=1 36 308 3.0E-06
sp|Q57971|Y551_METJA Uncharacterized protein MJ0551 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0551 PE=3 SV=1 604 740 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0020037 heme binding Yes
GO:0051537 2 iron, 2 sulfur cluster binding Yes
GO:0008942 nitrite reductase [NAD(P)H] activity Yes
GO:0016491 oxidoreductase activity Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0016661 oxidoreductase activity, acting on other nitrogenous compounds as donors No
GO:0003674 molecular_function No
GO:0098809 nitrite reductase activity No
GO:0051540 metal cluster binding No
GO:0046857 oxidoreductase activity, acting on other nitrogenous compounds as donors, with NAD or NADP as acceptor No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:1901363 heterocyclic compound binding No
GO:0046906 tetrapyrrole binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7462
MAAAPKKIVVVGLGMVGIAFIEKLLKYDARAREYSVTVLGEEPHLAYNRVGLTSFFQHRDINQLLLNPAGWYQSA
PEGALAYHVRTRVTGIVTSEKHVVCEDGEDGRILHVPYDILVLATGSGAVVPRQTPGHDARGVFVYRTIEDLNGL
VDFAARNRDTVGVVVGGGLLGLEAAKAMLDLGSFSKVNLIERNGWVLSRQLDEDAGDMVVQQIRDLGLGVALNRR
VRAVKVGGGGNLTGLVFEDGDEMDCSTVCFAIGVRARDDLARRSDIRCDERGGGIVVQDDLSTSQPDIYAIGECA
CWQGQTFGLIAPGVEMADVLAFNLTQARLHSPRTFRRPDLSTKLKLLGVEVASFGDFFADRDGPKHLPARHAKRL
QNGSQVKGLAESTVKALTYKDPFQNVYKKYIFTADGKYLLGGMMVGDTKDFVKVVPMVKGMKELDEPPGQLIVGA
KEDGGGDDLDDDCQVCSCHNVTKGDIVKCVKDGLCKDIGAIKSTTKAGTGCGGCLPLVTTIFNKTLTAMGGQVRN
HICPHFDFSRADLFNIVMAKRLTSMARVMREAGNDGESAGCEVCKPAVASILSSLWNRHVMQEPVHGLQDTNDRF
LANVQRDGTYSVVPRVPGGEITPDKLLAIGEVAKRYGLYTKITGGQRIDMFGARRQDLVAIWSRLVAAGMESGHA
YAKSLRTVKSCVGTTWCRFGIGDSVGMAVRLEERYKSIRAPHKIKGGVSGCVRECAEAQSKDFGLIATEKGFNIL
VAGNGGARPRHAELLARDVPPAEVVPILDRYLMFYIRTADRLQRTARWLEALPGGIGYLREVVLADKLGICASLE
AQMQELVDGFFDEWAEAVGDPAVAAKFRPFQNTDEGHVEAVELERERGQSRPVGWAAEPASEAFAGLRDRWTSTS
WQPVMEASHFDGADDLPNGVSATVRRGDTQLAVWRFRGRFYATQQMCPHKRAFVLSDGLLGQPPAAGLSAPSPPS
PWVSCPLHKRNFDLGDGSCTSDGALSIATFPAEARPDGLLYLELPPPRELDAALGTSRWKVRAGESGDRPFAELD
AKLRRAAGQQPQRRRRANGVWSSGGTRVGLVVTGGGGGGCGTAMDW*
Coding >Hirsu2|7462
ATGGCTGCTGCGCCCAAGAAAATAGTCGTGGTCGGGCTGGGGATGGTCGGCATCGCCTTCATCGAGAAGCTTTTG
AAATATGACGCTCGGGCGAGGGAGTACAGCGTCACGGTCCTTGGCGAGGAGCCGCATCTTGCCTACAACCGGGTC
GGGCTCACGAGCTTCTTCCAACACCGCGATATCAACCAGCTCTTGCTGAACCCTGCCGGGTGGTACCAAAGCGCG
CCAGAAGGTGCTTTGGCGTACCATGTCAGGACGAGGGTCACTGGCATCGTCACATCCGAGAAGCACGTCGTCTGC
GAAGACGGCGAGGATGGGAGAATCTTGCACGTCCCTTACGATATCCTGGTCCTCGCGACAGGCTCCGGCGCCGTA
GTGCCGCGCCAGACTCCCGGCCACGACGCGCGTGGCGTCTTCGTCTATCGCACCATCGAAGACCTGAATGGCCTT
GTCGACTTCGCGGCCCGGAACCGGGACACGGTCGGCGTCGTGGTCGGCGGCGGCCTGCTCGGACTGGAGGCCGCC
AAGGCCATGCTGGACCTCGGATCCTTCAGCAAGGTGAATCTCATCGAGCGCAACGGCTGGGTCCTGAGCCGCCAG
CTGGACGAGGACGCCGGCGACATGGTCGTCCAGCAAATCAGAGACCTCGGCCTGGGCGTGGCGCTCAACCGCAGG
GTGCGGGCCGTCAAGGTCGGCGGCGGCGGCAATCTCACCGGTCTGGTGTTCGAAGACGGAGACGAGATGGATTGC
TCGACCGTGTGTTTCGCCATCGGCGTTCGCGCCCGGGACGACCTGGCGCGCCGGTCCGACATCCGGTGCGACGAG
CGCGGCGGCGGCATCGTCGTCCAGGACGACCTGAGCACAAGCCAGCCGGACATCTACGCCATCGGAGAATGCGCC
TGCTGGCAGGGCCAGACGTTCGGCCTCATCGCGCCGGGCGTCGAAATGGCCGACGTGCTCGCCTTCAACCTGACG
CAGGCCAGGCTGCACTCCCCCCGCACCTTCAGACGGCCGGACCTCAGCACCAAGCTGAAGCTTCTCGGCGTCGAG
GTCGCCAGCTTCGGCGACTTCTTCGCAGACCGCGACGGGCCCAAGCACCTCCCGGCCCGGCACGCCAAGAGGCTC
CAGAACGGGAGCCAGGTCAAAGGCCTGGCCGAGAGCACGGTCAAGGCCCTGACGTACAAGGACCCGTTTCAGAAC
GTGTACAAGAAGTACATCTTCACGGCCGACGGCAAGTACCTCCTCGGCGGCATGATGGTCGGCGATACCAAAGAC
TTCGTCAAGGTCGTGCCCATGGTCAAGGGCATGAAGGAGCTGGACGAGCCGCCGGGGCAGCTCATCGTCGGCGCC
AAGGAGGACGGCGGGGGCGACGACCTGGACGACGATTGCCAGGTCTGCTCCTGCCACAACGTCACCAAGGGCGAC
ATCGTCAAGTGCGTCAAGGACGGGCTGTGCAAGGACATCGGGGCCATCAAGTCGACGACCAAGGCCGGCACGGGA
TGCGGCGGGTGCTTGCCGCTCGTCACCACCATCTTCAACAAGACGCTGACGGCGATGGGGGGCCAGGTCAGGAAC
CACATCTGCCCGCACTTTGACTTCTCGCGGGCCGACCTCTTCAACATCGTCATGGCCAAGCGGCTGACGTCGATG
GCGCGGGTCATGCGCGAGGCGGGCAACGACGGGGAGAGCGCGGGGTGCGAGGTCTGCAAGCCGGCCGTCGCCAGC
ATCCTCTCGTCGCTCTGGAACCGGCACGTCATGCAGGAGCCGGTCCACGGGCTGCAGGACACCAACGACCGCTTC
CTGGCCAACGTCCAGCGCGACGGCACCTACTCGGTCGTGCCACGCGTGCCCGGCGGCGAGATCACGCCCGACAAG
CTCCTCGCCATCGGCGAGGTGGCCAAGCGGTACGGCCTGTACACCAAGATCACGGGCGGGCAGCGGATCGACATG
TTCGGCGCCAGGAGGCAGGACCTCGTCGCCATCTGGAGCCGGCTCGTCGCCGCGGGCATGGAGTCGGGCCACGCG
TACGCCAAGTCGCTCCGGACGGTCAAGAGCTGCGTCGGCACGACGTGGTGCAGGTTCGGCATCGGCGACAGCGTC
GGCATGGCCGTCCGGCTCGAGGAGAGGTACAAGAGCATCCGGGCGCCGCACAAGATCAAGGGCGGCGTCAGCGGC
TGCGTGCGCGAGTGCGCCGAGGCCCAGAGTAAGGACTTCGGCCTCATCGCCACGGAGAAGGGCTTCAACATCTTG
GTCGCGGGCAACGGCGGCGCGAGGCCGCGGCACGCGGAGCTCCTGGCCAGGGACGTGCCGCCGGCCGAGGTCGTG
CCCATCCTCGACCGCTACCTGATGTTCTACATCCGCACGGCGGACAGGCTGCAGCGCACGGCCCGCTGGCTCGAG
GCGCTGCCCGGCGGCATCGGCTACCTGCGCGAGGTGGTGCTGGCGGACAAGCTGGGCATCTGCGCCTCGCTGGAG
GCGCAGATGCAGGAGCTCGTCGACGGCTTCTTCGACGAGTGGGCCGAGGCCGTCGGCGACCCGGCCGTGGCCGCC
AAGTTCCGGCCCTTCCAGAACACGGACGAGGGCCACGTCGAGGCCGTCGAGCTCGAGCGGGAGAGGGGCCAGAGC
CGGCCGGTCGGCTGGGCCGCGGAGCCGGCGTCGGAGGCCTTCGCCGGCCTGCGCGACCGGTGGACCAGCACGTCG
TGGCAGCCCGTCATGGAGGCCTCGCACTTTGACGGCGCCGACGACCTGCCCAACGGCGTCTCGGCGACGGTCAGG
CGCGGCGACACGCAGCTGGCCGTCTGGCGCTTCCGCGGCCGCTTCTACGCCACCCAGCAGATGTGCCCGCACAAG
CGGGCCTTTGTCCTGTCGGACGGCCTGCTGGGCCAGCCGCCGGCGGCAGGCCTCTCCGCGCCGTCGCCGCCGTCG
CCGTGGGTCTCGTGCCCGCTCCACAAGCGCAACTTCGACCTCGGCGACGGCTCCTGCACCTCCGACGGCGCCCTC
TCCATCGCCACCTTCCCGGCCGAGGCCCGGCCGGACGGCCTGCTGTACCTGGAGCTGCCGCCGCCGCGGGAGCTG
GACGCGGCGCTCGGCACCAGCCGCTGGAAGGTCCGCGCCGGCGAGAGCGGCGACCGGCCGTTCGCCGAGCTCGAC
GCCAAGCTCCGCCGGGCCGCCGGGCAGCAGCCGCAGCGGAGGAGGCGGGCGAACGGCGTCTGGTCGTCGGGGGGG
ACGCGGGTCGGACTGGTCGTCACGGGGGGAGGAGGCGGCGGCTGCGGAACGGCCATGGATTGGTAG
Transcript >Hirsu2|7462
ATGGCTGCTGCGCCCAAGAAAATAGTCGTGGTCGGGCTGGGGATGGTCGGCATCGCCTTCATCGAGAAGCTTTTG
AAATATGACGCTCGGGCGAGGGAGTACAGCGTCACGGTCCTTGGCGAGGAGCCGCATCTTGCCTACAACCGGGTC
GGGCTCACGAGCTTCTTCCAACACCGCGATATCAACCAGCTCTTGCTGAACCCTGCCGGGTGGTACCAAAGCGCG
CCAGAAGGTGCTTTGGCGTACCATGTCAGGACGAGGGTCACTGGCATCGTCACATCCGAGAAGCACGTCGTCTGC
GAAGACGGCGAGGATGGGAGAATCTTGCACGTCCCTTACGATATCCTGGTCCTCGCGACAGGCTCCGGCGCCGTA
GTGCCGCGCCAGACTCCCGGCCACGACGCGCGTGGCGTCTTCGTCTATCGCACCATCGAAGACCTGAATGGCCTT
GTCGACTTCGCGGCCCGGAACCGGGACACGGTCGGCGTCGTGGTCGGCGGCGGCCTGCTCGGACTGGAGGCCGCC
AAGGCCATGCTGGACCTCGGATCCTTCAGCAAGGTGAATCTCATCGAGCGCAACGGCTGGGTCCTGAGCCGCCAG
CTGGACGAGGACGCCGGCGACATGGTCGTCCAGCAAATCAGAGACCTCGGCCTGGGCGTGGCGCTCAACCGCAGG
GTGCGGGCCGTCAAGGTCGGCGGCGGCGGCAATCTCACCGGTCTGGTGTTCGAAGACGGAGACGAGATGGATTGC
TCGACCGTGTGTTTCGCCATCGGCGTTCGCGCCCGGGACGACCTGGCGCGCCGGTCCGACATCCGGTGCGACGAG
CGCGGCGGCGGCATCGTCGTCCAGGACGACCTGAGCACAAGCCAGCCGGACATCTACGCCATCGGAGAATGCGCC
TGCTGGCAGGGCCAGACGTTCGGCCTCATCGCGCCGGGCGTCGAAATGGCCGACGTGCTCGCCTTCAACCTGACG
CAGGCCAGGCTGCACTCCCCCCGCACCTTCAGACGGCCGGACCTCAGCACCAAGCTGAAGCTTCTCGGCGTCGAG
GTCGCCAGCTTCGGCGACTTCTTCGCAGACCGCGACGGGCCCAAGCACCTCCCGGCCCGGCACGCCAAGAGGCTC
CAGAACGGGAGCCAGGTCAAAGGCCTGGCCGAGAGCACGGTCAAGGCCCTGACGTACAAGGACCCGTTTCAGAAC
GTGTACAAGAAGTACATCTTCACGGCCGACGGCAAGTACCTCCTCGGCGGCATGATGGTCGGCGATACCAAAGAC
TTCGTCAAGGTCGTGCCCATGGTCAAGGGCATGAAGGAGCTGGACGAGCCGCCGGGGCAGCTCATCGTCGGCGCC
AAGGAGGACGGCGGGGGCGACGACCTGGACGACGATTGCCAGGTCTGCTCCTGCCACAACGTCACCAAGGGCGAC
ATCGTCAAGTGCGTCAAGGACGGGCTGTGCAAGGACATCGGGGCCATCAAGTCGACGACCAAGGCCGGCACGGGA
TGCGGCGGGTGCTTGCCGCTCGTCACCACCATCTTCAACAAGACGCTGACGGCGATGGGGGGCCAGGTCAGGAAC
CACATCTGCCCGCACTTTGACTTCTCGCGGGCCGACCTCTTCAACATCGTCATGGCCAAGCGGCTGACGTCGATG
GCGCGGGTCATGCGCGAGGCGGGCAACGACGGGGAGAGCGCGGGGTGCGAGGTCTGCAAGCCGGCCGTCGCCAGC
ATCCTCTCGTCGCTCTGGAACCGGCACGTCATGCAGGAGCCGGTCCACGGGCTGCAGGACACCAACGACCGCTTC
CTGGCCAACGTCCAGCGCGACGGCACCTACTCGGTCGTGCCACGCGTGCCCGGCGGCGAGATCACGCCCGACAAG
CTCCTCGCCATCGGCGAGGTGGCCAAGCGGTACGGCCTGTACACCAAGATCACGGGCGGGCAGCGGATCGACATG
TTCGGCGCCAGGAGGCAGGACCTCGTCGCCATCTGGAGCCGGCTCGTCGCCGCGGGCATGGAGTCGGGCCACGCG
TACGCCAAGTCGCTCCGGACGGTCAAGAGCTGCGTCGGCACGACGTGGTGCAGGTTCGGCATCGGCGACAGCGTC
GGCATGGCCGTCCGGCTCGAGGAGAGGTACAAGAGCATCCGGGCGCCGCACAAGATCAAGGGCGGCGTCAGCGGC
TGCGTGCGCGAGTGCGCCGAGGCCCAGAGTAAGGACTTCGGCCTCATCGCCACGGAGAAGGGCTTCAACATCTTG
GTCGCGGGCAACGGCGGCGCGAGGCCGCGGCACGCGGAGCTCCTGGCCAGGGACGTGCCGCCGGCCGAGGTCGTG
CCCATCCTCGACCGCTACCTGATGTTCTACATCCGCACGGCGGACAGGCTGCAGCGCACGGCCCGCTGGCTCGAG
GCGCTGCCCGGCGGCATCGGCTACCTGCGCGAGGTGGTGCTGGCGGACAAGCTGGGCATCTGCGCCTCGCTGGAG
GCGCAGATGCAGGAGCTCGTCGACGGCTTCTTCGACGAGTGGGCCGAGGCCGTCGGCGACCCGGCCGTGGCCGCC
AAGTTCCGGCCCTTCCAGAACACGGACGAGGGCCACGTCGAGGCCGTCGAGCTCGAGCGGGAGAGGGGCCAGAGC
CGGCCGGTCGGCTGGGCCGCGGAGCCGGCGTCGGAGGCCTTCGCCGGCCTGCGCGACCGGTGGACCAGCACGTCG
TGGCAGCCCGTCATGGAGGCCTCGCACTTTGACGGCGCCGACGACCTGCCCAACGGCGTCTCGGCGACGGTCAGG
CGCGGCGACACGCAGCTGGCCGTCTGGCGCTTCCGCGGCCGCTTCTACGCCACCCAGCAGATGTGCCCGCACAAG
CGGGCCTTTGTCCTGTCGGACGGCCTGCTGGGCCAGCCGCCGGCGGCAGGCCTCTCCGCGCCGTCGCCGCCGTCG
CCGTGGGTCTCGTGCCCGCTCCACAAGCGCAACTTCGACCTCGGCGACGGCTCCTGCACCTCCGACGGCGCCCTC
TCCATCGCCACCTTCCCGGCCGAGGCCCGGCCGGACGGCCTGCTGTACCTGGAGCTGCCGCCGCCGCGGGAGCTG
GACGCGGCGCTCGGCACCAGCCGCTGGAAGGTCCGCGCCGGCGAGAGCGGCGACCGGCCGTTCGCCGAGCTCGAC
GCCAAGCTCCGCCGGGCCGCCGGGCAGCAGCCGCAGCGGAGGAGGCGGGCGAACGGCGTCTGGTCGTCGGGGGGG
ACGCGGGTCGGACTGGTCGTCACGGGGGGAGGAGGCGGCGGCTGCGGAACGGCCATGGATTGGTAG
Gene >Hirsu2|7462
ATGGCTGCTGCGCCCAAGAAAATAGTCGTGGTCGGGCTGGGGATGGTCGGCATCGCCTTCATCGAGAAGCTTTTG
AAATATGACGCTCGGGCGAGGGAGTACAGCGTCACGGTCCTTGGCGAGGAGCCGCATCTTGCCTACAACCGGGTC
GGGCTCACGAGCTTCTTCCAACACCGCGATATCAACCAGCTCTTGCTGAACCCTGCCGGGTGGTACCAAAGCGCG
CCAGAAGGTGCTTTGGCGTACCATGTCAGGACGAGGGTCACTGGCATCGTCACATCCGAGAAGCACGTCGTCTGC
GAAGACGGCGAGGATGGGAGAATCTTGCACGTCCCTTACGATATCCTGGTCCTCGCGACAGGCTCCGGCGCCGTA
GTGCCGCGCCAGACTCCCGGCCACGACGCGCGTGGCGTCTTCGTCTATCGCACCATCGAAGACCTGAATGGCCTT
GTCGACTTCGCGGCCCGGAACCGGGACACGGTCGGCGTCGTGGTCGGCGGCGGCCTGCTCGGACTGGAGGCCGCC
AAGGCCATGCTGGACCTCGGATCCTTCAGCAAGGTGAATCTCATCGAGCGCAACGGCTGGGTCCTGAGCCGCCAG
CTGGACGAGGACGCCGGCGACATGGTCGTCCAGCAAATCAGAGACCTCGGCCTGGGCGTGGCGCTCAACCGCAGG
GTGCGGGCCGTCAAGGTCGGCGGCGGCGGCAATCTCACCGGTCTGGTGTTCGAAGACGGAGACGAGATGGATTGC
TCGACCGTGTGTTTCGCCATCGGCGTTCGCGCCCGGGACGACCTGGCGCGCCGGTCCGACATCCGGTGCGACGAG
CGCGGCGGCGGCATCGTCGTCCAGGACGACCTGAGCACAAGCCAGCCGGACATCTACGCCATCGGAGAATGCGCC
TGCTGGCAGGGCCAGACGTTCGGCCTCATCGCGCCGGGCGTCGAAATGGCCGACGTGCTCGCCTTCAACCTGACG
CAGGCCAGGCTGCACTCCCCCCGCACCTTCAGACGGCCGGACCTCAGCACCAAGCTGAAGCTTCTCGGCGTCGAG
GTCGCCAGCTTCGGCGACTTCTTCGCAGACCGCGACGGGCCCAAGCACCTCCCGGCCCGGCACGCCAAGAGGCTC
CAGAACGGGAGCCAGGTCAAAGGCCTGGCCGAGAGCACGGTCAAGGCCCTGACGTACAAGGACCCGTTTCAGAAC
GTGTACAAGAAGTACATCTTCACGGCCGACGGCAAGTACCTCCTCGGCGGCATGATGGTCGGCGATACCAAAGAC
TTCGTCAAGGTCGTGCCCATGGTCAAGGGCATGAAGGAGCTGGACGAGCCGCCGGGGCAGCTCATCGTCGGCGCC
AAGGAGGACGGCGGGGGCGACGACCTGGACGACGATTGCCAGGTCTGCTCCTGCCACAACGTCACCAAGGGCGAC
ATCGTCAAGTGCGTCAAGGACGGGCTGTGCAAGGACATCGGGGCCATCAAGTCGACGACCAAGGCCGGCACGGGA
TGCGGCGGGTGCTTGCCGCTCGTCACCACCATCTTCAACAAGACGCTGACGGCGATGGGGGGCCAGGTCAGGAAC
CACATCTGCCCGCACTTTGACTTCTCGCGGGCCGACCTCTTCAACATCGTCATGGCCAAGCGGCTGACGTCGATG
GCGCGGGTCATGCGCGAGGCGGGCAACGACGGGGAGAGCGCGGGGTGCGAGGTCTGCAAGCCGGCCGTCGCCAGC
ATCCTCTCGTCGCTCTGGAACCGGCACGTCATGCAGGAGCCGGTCCACGGGCTGCAGGACACCAACGACCGCTTC
CTGGCCAACGTCCAGCGCGACGGCACCTACTCGGTCGTGCCACGCGTGCCCGGCGGCGAGATCACGCCCGACAAG
CTCCTCGCCATCGGCGAGGTGGCCAAGCGGTACGGCCTGTACACCAAGATCACGGGCGGGCAGCGGATCGACATG
TTCGGCGCCAGGAGGCAGGACCTCGTCGCCATCTGGAGCCGGCTCGTCGCCGCGGGCATGGAGTCGGGCCACGCG
TACGCCAAGTCGCTCCGGACGGTCAAGAGCTGCGTCGGCACGACGTGGTGCAGGTTCGGCATCGGCGACAGCGTC
GGCATGGCCGTCCGGCTCGAGGAGAGGTACAAGAGCATCCGGGCGCCGCACAAGATCAAGGGCGGCGTCAGCGGC
TGCGTGCGCGAGTGCGCCGAGGCCCAGAGTAAGGAGTATGTCACCACGCATCCGCACCCACCCGACTCCCGCCAT
CATCGCCGGCTGACGCTGTTCTGTTCTCTAGCTTCGGCCTCATCGCCACGGAGAAGGGCTTCAACATCTTGGTCG
CGGGCAACGGCGGCGCGAGGCCGCGGCACGCGGAGCTCCTGGCCAGGGACGTGCCGCCGGCCGAGGTCGTGCCCA
TCCTCGACCGCTACCTGATGTTCTACATCCGCACGGCGGACAGGCTGCAGCGCACGGCCCGCTGGCTCGAGGCGC
TGCCCGGCGGCATCGGCTACCTGCGCGAGGTGGTGCTGGCGGACAAGCTGGGCATCTGCGCCTCGCTGGAGGCGC
AGATGCAGGAGCTCGTCGACGGCTTCTTCGACGAGTGGGCCGAGGCCGTCGGCGACCCGGCCGTGGCCGCCAAGT
TCCGGCCCTTCCAGAACACGGACGAGGGCCACGTCGAGGCCGTCGAGCTCGAGCGGGAGAGGGGCCAGAGCCGGC
CGGTCGGCTGGGCCGCGGAGCCGGCGTCGGAGGCCTTCGCCGGCCTGCGCGACCGGTGGACCAGCACGTCGTGGC
AGCCCGTCATGGAGGCCTCGCACTTTGACGGCGCCGACGACCTGCCCAACGGCGTCTCGGCGACGGTCAGGCGCG
GCGACACGCAGCTGGCCGTCTGGCGCTTCCGCGGCCGCTTCTACGCCACCCAGCAGATGTGCCCGCACAAGCGGG
CCTTTGTCCTGTCGGACGGCCTGCTGGGCCAGCCGCCGGCGGCAGGCCTCTCCGCGCCGTCGCCGCCGTCGCCGT
GGGTCTCGTGCCCGCTCCACAAGCGCAACTTCGACCTCGGCGACGGCTCCTGCACCTCCGACGGCGCCCTCTCCA
TCGCCACCTTCCCGGCCGAGGCCCGGCCGGACGGCCTGCTGTACCTGGAGCTGCCGCCGCCGCGGGAGCTGGACG
CGGCGCTCGGCACCAGCCGCTGGAAGGTCCGCGCCGGCGAGAGCGGCGACCGGCCGTTCGCCGAGCTCGACGCCA
AGCTCCGCCGGGCCGCCGGGCAGCAGCCGCAGCGGAGGAGGCGGGCGAACGGCGTCTGGTCGTCGGGGGGGACGC
GGGTCGGACTGGTCGTCACGGGGGGAGGAGGCGGCGGCTGCGGAACGGCCATGGATTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail