Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7460
Gene name
LocationContig_435:1821..4392
Strand-
Gene length (bp)2571
Transcript length (bp)2514
Coding sequence length (bp)2514
Protein length (aa) 838

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03835 Rad4 Rad4 transglutaminase-like domain 1.4E-30 416 529
PF10405 BHD_3 Rad4 beta-hairpin domain 3 9.1E-28 666 738
PF10403 BHD_1 Rad4 beta-hairpin domain 1 6.4E-22 535 590
PF10404 BHD_2 Rad4 beta-hairpin domain 2 1.5E-19 594 659

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 171 777 3.0E-85
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 420 776 3.0E-55
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 420 835 2.0E-52
sp|P51612|XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus GN=Xpc PE=1 SV=2 424 776 2.0E-43
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 424 776 1.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 171 777 3.0E-85
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 420 776 3.0E-55
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 420 835 2.0E-52
sp|P51612|XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus GN=Xpc PE=1 SV=2 424 776 2.0E-43
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 424 776 1.0E-41
sp|Q24595|XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster GN=Xpc PE=1 SV=2 424 776 5.0E-37
sp|Q8W489|RAD4_ARATH DNA repair protein RAD4 OS=Arabidopsis thaliana GN=RAD4 PE=1 SV=1 421 776 2.0E-33
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 103 329 4.0E-15
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 139 351 3.0E-10
sp|Q06665|RAD34_YEAST DNA repair protein RAD34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD34 PE=1 SV=1 538 776 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7460
MVGRKRAVASRSNRALRSRERNAEPDIYGQMLAEAGVTVQAPDSPERPLKRRRTGAQHQDNVQSSTKAPQQTGKA
SAGAQASGTDEEKEEEDDEELEFQDVALPKPTVQTMERDSDDDEDEEDEDIQFEDVELMTKLDESADKTPEAAEL
ELNLTAQQSSTTPTRRAGERRKPMTKEEKERRVDIHRAHLLCLLSHVARRNHWCNDPTVQEHLRSHLTDKTVAYL
NPGSHLPQFGQAESLKNGLKQAGDVWKTKFEIRERGLRRALWAEDAEQLQNYEPPSNMDSCLDRADFREAARKLQ
GSRDTGAQLYCALLRSAGVRARLVCSLQPLACVSGAPTLPKPKPKPKAPTTPTSSRSRDALANYKAMAEKTNTPP
SPGGPTARRRLGHPNATAYSFKPAPARPASQRTFDVPVTIRESHYPVYWVEVLDTGHQKWQPVDAVVLRSFWKAK
IFEPPITDKENSLCYVVAFEADGTAKDVTRRYAKAYTAKTRKLRVESVLENGDRWWRKVMKLFRGAGPSDLDQIE
NNELAGVEAREPMPRNVQDFKGHPVYALERHLRRNEVLVPGAMPSGTVGAGSRGPLEKIFRRKDVRVARSADKWY
RLGREVKPNEIPAKWLPKKARGRNSRLGIPDEREEEEAQAEAAGTPIYTIDQTELYEPPPVRNGRVPKNKFGNVE
VYVPSMIPRGAVHIVHEQATRAALIAGVDYAPALTGFQFKGRHGTAVLRGVVVAAEFEAAVRAVLDGLAALEREA
ADDRRRLAVLKTWRRLLMGLRIRERIWSGVDADERREAERRAEKQAGVGDDDEADEADDMDGASDATEEFDMVVD
EEEEGGGGFLIE*
Coding >Hirsu2|7460
ATGGTCGGCAGGAAGCGTGCTGTGGCTTCGCGAAGCAACAGGGCGCTACGTTCTCGCGAAAGAAATGCCGAGCCC
GACATCTACGGACAGATGCTGGCCGAGGCCGGGGTGACGGTGCAGGCGCCCGACTCTCCGGAACGGCCCCTGAAG
CGGCGGCGAACGGGCGCGCAACATCAGGATAATGTCCAGTCTTCTACCAAAGCCCCCCAACAAACCGGGAAAGCA
TCAGCCGGAGCACAAGCGAGTGGCACAGACGAAGAGAAGGAGGAGGAGGACGACGAGGAACTGGAATTTCAAGAT
GTCGCCTTACCGAAACCGACGGTCCAGACCATGGAACGGGACTCAGACGACGACGAAGATGAAGAAGATGAAGAT
ATTCAGTTCGAGGATGTAGAACTCATGACCAAACTGGACGAATCAGCCGACAAGACACCGGAAGCCGCCGAACTG
GAGCTCAATCTCACTGCCCAGCAGTCATCGACGACGCCGACAAGGAGAGCGGGGGAGCGGCGCAAGCCAATGACA
AAGGAGGAAAAGGAGCGCCGCGTCGACATCCATCGAGCCCATCTCCTGTGTCTGCTGTCCCACGTCGCACGCCGA
AACCATTGGTGCAACGATCCGACGGTACAGGAGCATCTGCGCTCGCATCTGACGGACAAAACGGTCGCCTATCTC
AACCCAGGGTCTCACCTGCCGCAGTTCGGGCAGGCAGAGAGCCTGAAGAATGGCCTGAAGCAAGCGGGAGACGTG
TGGAAGACCAAGTTTGAGATTCGAGAAAGGGGTCTCCGGAGGGCCCTGTGGGCCGAAGACGCCGAGCAGCTGCAG
AACTACGAGCCACCCAGCAACATGGACTCCTGTCTGGACCGTGCCGACTTTCGCGAGGCGGCCAGGAAGCTTCAA
GGATCCCGAGACACGGGGGCGCAACTGTACTGCGCCCTTCTTCGAAGCGCCGGCGTCCGCGCCCGGCTCGTCTGC
TCGCTGCAGCCCCTGGCATGCGTATCTGGGGCCCCGACGCTGCCGAAGCCGAAGCCGAAGCCGAAGGCGCCGACG
ACGCCCACCAGCAGTCGCTCTCGAGACGCGTTGGCCAATTACAAGGCCATGGCCGAGAAGACGAACACGCCCCCT
TCCCCCGGCGGGCCGACGGCGCGAAGGAGGCTGGGCCACCCGAATGCGACGGCCTACAGCTTCAAGCCGGCCCCA
GCCCGACCGGCGAGCCAGCGCACGTTCGACGTGCCCGTGACGATACGCGAGTCGCACTATCCCGTCTACTGGGTC
GAGGTGCTCGACACGGGCCACCAAAAATGGCAACCGGTCGATGCCGTCGTCCTGCGCAGCTTCTGGAAAGCCAAA
ATCTTCGAGCCCCCCATCACGGACAAGGAGAACAGCCTGTGCTACGTGGTGGCGTTCGAGGCCGACGGCACGGCC
AAGGATGTGACGAGGAGATATGCCAAGGCATACACGGCCAAGACACGCAAGCTACGTGTCGAGAGCGTGCTGGAG
AACGGCGACCGATGGTGGCGCAAGGTCATGAAGCTCTTCCGGGGCGCAGGGCCGTCGGACTTGGACCAGATCGAG
AACAACGAGCTGGCCGGGGTCGAGGCCCGCGAACCGATGCCGCGGAATGTGCAGGATTTCAAGGGCCACCCGGTC
TACGCGCTGGAGAGACATTTACGGCGAAACGAGGTGCTTGTCCCGGGGGCGATGCCGTCTGGAACGGTCGGGGCG
GGCAGCCGAGGCCCCCTGGAGAAGATTTTCCGACGAAAGGACGTCCGGGTCGCGCGGAGCGCGGACAAGTGGTAT
CGCCTGGGGCGCGAGGTGAAGCCCAACGAGATCCCGGCCAAGTGGCTGCCGAAAAAGGCGCGAGGCCGGAACTCG
CGGCTTGGGATACCGGACGAGCGGGAGGAGGAGGAAGCACAAGCGGAGGCGGCCGGGACGCCGATCTACACGATC
GACCAGACGGAGCTCTACGAGCCGCCGCCGGTACGCAACGGGCGGGTGCCCAAGAACAAGTTCGGCAACGTCGAG
GTCTACGTGCCGAGCATGATACCCCGCGGGGCCGTGCACATCGTGCACGAGCAGGCGACGCGAGCGGCGCTCATC
GCCGGCGTCGACTACGCACCGGCCCTGACGGGCTTCCAGTTCAAGGGACGGCACGGCACGGCGGTGCTCCGCGGC
GTCGTCGTCGCGGCCGAGTTCGAGGCGGCCGTGCGGGCGGTGCTCGACGGCCTGGCGGCCCTGGAGCGCGAGGCG
GCGGACGACAGGCGGCGGCTGGCCGTGCTCAAGACGTGGAGGCGGCTGCTGATGGGGCTGCGGATCCGCGAGAGG
ATCTGGAGCGGAGTGGACGCGGACGAGAGGAGGGAGGCCGAGAGGCGGGCGGAGAAGCAGGCGGGCGTGGGCGAC
GACGACGAGGCCGACGAGGCCGACGACATGGACGGGGCGAGCGACGCGACGGAGGAGTTCGACATGGTCGTTGAC
GAGGAAGAGGAGGGCGGCGGCGGATTTCTGATCGAATAG
Transcript >Hirsu2|7460
ATGGTCGGCAGGAAGCGTGCTGTGGCTTCGCGAAGCAACAGGGCGCTACGTTCTCGCGAAAGAAATGCCGAGCCC
GACATCTACGGACAGATGCTGGCCGAGGCCGGGGTGACGGTGCAGGCGCCCGACTCTCCGGAACGGCCCCTGAAG
CGGCGGCGAACGGGCGCGCAACATCAGGATAATGTCCAGTCTTCTACCAAAGCCCCCCAACAAACCGGGAAAGCA
TCAGCCGGAGCACAAGCGAGTGGCACAGACGAAGAGAAGGAGGAGGAGGACGACGAGGAACTGGAATTTCAAGAT
GTCGCCTTACCGAAACCGACGGTCCAGACCATGGAACGGGACTCAGACGACGACGAAGATGAAGAAGATGAAGAT
ATTCAGTTCGAGGATGTAGAACTCATGACCAAACTGGACGAATCAGCCGACAAGACACCGGAAGCCGCCGAACTG
GAGCTCAATCTCACTGCCCAGCAGTCATCGACGACGCCGACAAGGAGAGCGGGGGAGCGGCGCAAGCCAATGACA
AAGGAGGAAAAGGAGCGCCGCGTCGACATCCATCGAGCCCATCTCCTGTGTCTGCTGTCCCACGTCGCACGCCGA
AACCATTGGTGCAACGATCCGACGGTACAGGAGCATCTGCGCTCGCATCTGACGGACAAAACGGTCGCCTATCTC
AACCCAGGGTCTCACCTGCCGCAGTTCGGGCAGGCAGAGAGCCTGAAGAATGGCCTGAAGCAAGCGGGAGACGTG
TGGAAGACCAAGTTTGAGATTCGAGAAAGGGGTCTCCGGAGGGCCCTGTGGGCCGAAGACGCCGAGCAGCTGCAG
AACTACGAGCCACCCAGCAACATGGACTCCTGTCTGGACCGTGCCGACTTTCGCGAGGCGGCCAGGAAGCTTCAA
GGATCCCGAGACACGGGGGCGCAACTGTACTGCGCCCTTCTTCGAAGCGCCGGCGTCCGCGCCCGGCTCGTCTGC
TCGCTGCAGCCCCTGGCATGCGTATCTGGGGCCCCGACGCTGCCGAAGCCGAAGCCGAAGCCGAAGGCGCCGACG
ACGCCCACCAGCAGTCGCTCTCGAGACGCGTTGGCCAATTACAAGGCCATGGCCGAGAAGACGAACACGCCCCCT
TCCCCCGGCGGGCCGACGGCGCGAAGGAGGCTGGGCCACCCGAATGCGACGGCCTACAGCTTCAAGCCGGCCCCA
GCCCGACCGGCGAGCCAGCGCACGTTCGACGTGCCCGTGACGATACGCGAGTCGCACTATCCCGTCTACTGGGTC
GAGGTGCTCGACACGGGCCACCAAAAATGGCAACCGGTCGATGCCGTCGTCCTGCGCAGCTTCTGGAAAGCCAAA
ATCTTCGAGCCCCCCATCACGGACAAGGAGAACAGCCTGTGCTACGTGGTGGCGTTCGAGGCCGACGGCACGGCC
AAGGATGTGACGAGGAGATATGCCAAGGCATACACGGCCAAGACACGCAAGCTACGTGTCGAGAGCGTGCTGGAG
AACGGCGACCGATGGTGGCGCAAGGTCATGAAGCTCTTCCGGGGCGCAGGGCCGTCGGACTTGGACCAGATCGAG
AACAACGAGCTGGCCGGGGTCGAGGCCCGCGAACCGATGCCGCGGAATGTGCAGGATTTCAAGGGCCACCCGGTC
TACGCGCTGGAGAGACATTTACGGCGAAACGAGGTGCTTGTCCCGGGGGCGATGCCGTCTGGAACGGTCGGGGCG
GGCAGCCGAGGCCCCCTGGAGAAGATTTTCCGACGAAAGGACGTCCGGGTCGCGCGGAGCGCGGACAAGTGGTAT
CGCCTGGGGCGCGAGGTGAAGCCCAACGAGATCCCGGCCAAGTGGCTGCCGAAAAAGGCGCGAGGCCGGAACTCG
CGGCTTGGGATACCGGACGAGCGGGAGGAGGAGGAAGCACAAGCGGAGGCGGCCGGGACGCCGATCTACACGATC
GACCAGACGGAGCTCTACGAGCCGCCGCCGGTACGCAACGGGCGGGTGCCCAAGAACAAGTTCGGCAACGTCGAG
GTCTACGTGCCGAGCATGATACCCCGCGGGGCCGTGCACATCGTGCACGAGCAGGCGACGCGAGCGGCGCTCATC
GCCGGCGTCGACTACGCACCGGCCCTGACGGGCTTCCAGTTCAAGGGACGGCACGGCACGGCGGTGCTCCGCGGC
GTCGTCGTCGCGGCCGAGTTCGAGGCGGCCGTGCGGGCGGTGCTCGACGGCCTGGCGGCCCTGGAGCGCGAGGCG
GCGGACGACAGGCGGCGGCTGGCCGTGCTCAAGACGTGGAGGCGGCTGCTGATGGGGCTGCGGATCCGCGAGAGG
ATCTGGAGCGGAGTGGACGCGGACGAGAGGAGGGAGGCCGAGAGGCGGGCGGAGAAGCAGGCGGGCGTGGGCGAC
GACGACGAGGCCGACGAGGCCGACGACATGGACGGGGCGAGCGACGCGACGGAGGAGTTCGACATGGTCGTTGAC
GAGGAAGAGGAGGGCGGCGGCGGATTTCTGATCGAATAG
Gene >Hirsu2|7460
ATGGTCGGCAGGAAGCGTGCTGTGGCTTCGCGAAGCAACAGGGCGCTACGTTCTCGCGAAAGAAATGCCGAGCCC
GACATCTACGGACAGATGCTGGCCGAGGCCGGGGTGACGGTGCAGGCGCCCGACTCTCCGGAACGGCCCCTGAAG
CGGCGGCGAACGGGCGCGCAACATCAGGATAATGTCCAGTCTTCTACCAAAGCCCCCCAACAAACCGGGAAAGCA
TCAGCCGGAGCACAAGCGAGTGGCACAGACGAAGAGAAGGAGGAGGAGGACGACGAGGAACTGGAATTTCAAGAT
GTCGCCTTACCGAAACCGACGGTCCAGACCATGGAACGGGACTCAGACGACGACGAAGATGAAGAAGATGAAGAT
ATTCAGTTCGAGGATGTAGAACTCATGACCAAACTGGACGAATCAGCCGACAAGACACCGGAAGCCGCCGAACTG
GAGCTCAATCTCACTGCCCAGCAGTCATCGACGACGCCGACAAGGAGAGCGGGGGAGCGGCGCAAGCCAATGACA
AAGGAGGAAAAGGAGCGCCGCGTCGACATCCATCGAGCCCATCTCCTGTGTCTGCTGTCCCACGTCGCACGCCGA
AACCATTGGTGCAACGATCCGACGGTACAGGAGCATCTGCGCTCGCATCTGACGGACAAAACGGTCGCCTATCTC
AACCCAGGGTCTCACCTGCCGCAGTTCGGGCAGGCAGAGAGCCTGAAGAATGGCCTGAAGCAAGCGGGAGACGTG
TGGAAGACCAAGTTTGAGATTCGAGAAAGGGGTCTCCGGAGGGCCCTGTGGGCCGAAGACGCCGAGCAGCTGCAG
AACGTAGGCGTTCCCCTACTTCGGCGTCTCCTCGACCAAGCGTGCTAACGTCGGACTCAGTACGAGCCACCCAGC
AACATGGACTCCTGTCTGGACCGTGCCGACTTTCGCGAGGCGGCCAGGAAGCTTCAAGGATCCCGAGACACGGGG
GCGCAACTGTACTGCGCCCTTCTTCGAAGCGCCGGCGTCCGCGCCCGGCTCGTCTGCTCGCTGCAGCCCCTGGCA
TGCGTATCTGGGGCCCCGACGCTGCCGAAGCCGAAGCCGAAGCCGAAGGCGCCGACGACGCCCACCAGCAGTCGC
TCTCGAGACGCGTTGGCCAATTACAAGGCCATGGCCGAGAAGACGAACACGCCCCCTTCCCCCGGCGGGCCGACG
GCGCGAAGGAGGCTGGGCCACCCGAATGCGACGGCCTACAGCTTCAAGCCGGCCCCAGCCCGACCGGCGAGCCAG
CGCACGTTCGACGTGCCCGTGACGATACGCGAGTCGCACTATCCCGTCTACTGGGTCGAGGTGCTCGACACGGGC
CACCAAAAATGGCAACCGGTCGATGCCGTCGTCCTGCGCAGCTTCTGGAAAGCCAAAATCTTCGAGCCCCCCATC
ACGGACAAGGAGAACAGCCTGTGCTACGTGGTGGCGTTCGAGGCCGACGGCACGGCCAAGGATGTGACGAGGAGA
TATGCCAAGGCATACACGGCCAAGACACGCAAGCTACGTGTCGAGAGCGTGCTGGAGAACGGCGACCGATGGTGG
CGCAAGGTCATGAAGCTCTTCCGGGGCGCAGGGCCGTCGGACTTGGACCAGATCGAGAACAACGAGCTGGCCGGG
GTCGAGGCCCGCGAACCGATGCCGCGGAATGTGCAGGATTTCAAGGGCCACCCGGTCTACGCGCTGGAGAGACAT
TTACGGCGAAACGAGGTGCTTGTCCCGGGGGCGATGCCGTCTGGAACGGTCGGGGCGGGCAGCCGAGGCCCCCTG
GAGAAGATTTTCCGACGAAAGGACGTCCGGGTCGCGCGGAGCGCGGACAAGTGGTATCGCCTGGGGCGCGAGGTG
AAGCCCAACGAGATCCCGGCCAAGTGGCTGCCGAAAAAGGCGCGAGGCCGGAACTCGCGGCTTGGGATACCGGAC
GAGCGGGAGGAGGAGGAAGCACAAGCGGAGGCGGCCGGGACGCCGATCTACACGATCGACCAGACGGAGCTCTAC
GAGCCGCCGCCGGTACGCAACGGGCGGGTGCCCAAGAACAAGTTCGGCAACGTCGAGGTCTACGTGCCGAGCATG
ATACCCCGCGGGGCCGTGCACATCGTGCACGAGCAGGCGACGCGAGCGGCGCTCATCGCCGGCGTCGACTACGCA
CCGGCCCTGACGGGCTTCCAGTTCAAGGGACGGCACGGCACGGCGGTGCTCCGCGGCGTCGTCGTCGCGGCCGAG
TTCGAGGCGGCCGTGCGGGCGGTGCTCGACGGCCTGGCGGCCCTGGAGCGCGAGGCGGCGGACGACAGGCGGCGG
CTGGCCGTGCTCAAGACGTGGAGGCGGCTGCTGATGGGGCTGCGGATCCGCGAGAGGATCTGGAGCGGAGTGGAC
GCGGACGAGAGGAGGGAGGCCGAGAGGCGGGCGGAGAAGCAGGCGGGCGTGGGCGACGACGACGAGGCCGACGAG
GCCGACGACATGGACGGGGCGAGCGACGCGACGGAGGAGTTCGACATGGTCGTTGACGAGGAAGAGGAGGGCGGC
GGCGGATTTCTGATCGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail