Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7449
Gene name
LocationContig_433:14926..17032
Strand+
Gene length (bp)2106
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 4.1E-14 81 114

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 79 346 1.0E-89
sp|P42944|GZF3_YEAST Protein GZF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GZF3 PE=1 SV=1 77 130 1.0E-26
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 79 132 2.0E-25
sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL80 PE=2 SV=1 66 127 4.0E-23
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 16 130 7.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 79 346 1.0E-89
sp|P42944|GZF3_YEAST Protein GZF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GZF3 PE=1 SV=1 77 130 1.0E-26
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 79 132 2.0E-25
sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL80 PE=2 SV=1 66 127 4.0E-23
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 16 130 7.0E-21
sp|P17429|AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=areA PE=1 SV=2 54 130 2.0E-20
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 43 130 6.0E-20
sp|P78688|AREA_GIBFU Nitrogen regulatory protein areA OS=Gibberella fujikuroi GN=AREA PE=3 SV=1 68 130 9.0E-20
sp|Q01168|NUT1_MAGO7 Nitrogen regulatory protein NUT1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NUT1 PE=3 SV=1 74 130 2.0E-19
sp|P19212|NIT2_NEUCR Nitrogen catabolic enzyme regulatory protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-2 PE=1 SV=2 80 130 4.0E-19
sp|Q01582|AREA_PENCH Nitrogen regulatory protein areA OS=Penicillium chrysogenum GN=AREA PE=3 SV=1 79 130 4.0E-19
sp|O13508|AREA_PENRO Nitrogen regulatory protein areA OS=Penicillium roqueforti GN=AREA PE=3 SV=2 80 130 5.0E-19
sp|Q92269|NRFA_PENUR Nitrogen regulatory protein nrfA OS=Penicillium urticae GN=nrfA PE=3 SV=1 80 130 6.0E-19
sp|P43574|GAT1_YEAST Transcriptional regulatory protein GAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT1 PE=1 SV=1 81 133 2.0E-18
sp|Q10280|GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gaf1 PE=1 SV=2 79 130 5.0E-18
sp|Q5A432|GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAT1 PE=2 SV=1 67 130 2.0E-17
sp|P18494|GLN3_YEAST Nitrogen regulatory protein GLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN3 PE=1 SV=2 59 139 1.0E-16
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 81 131 2.0E-16
sp|Q92259|SREP_PENCH GATA factor SREP OS=Penicillium chrysogenum GN=SREP PE=3 SV=1 76 131 1.0E-15
sp|Q10134|FEP1_SCHPO Iron-sensing transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fep1 PE=1 SV=1 81 131 2.0E-15
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 81 163 3.0E-14
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 81 130 2.0E-13
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 81 130 2.0E-13
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 80 130 4.0E-13
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 81 130 4.0E-13
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 80 130 4.0E-13
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 80 130 5.0E-13
sp|Q95JA5|GATA6_PIG Transcription factor GATA-6 (Fragment) OS=Sus scrofa GN=GATA6 PE=2 SV=2 80 130 5.0E-13
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 80 130 6.0E-13
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 81 130 8.0E-13
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 80 130 8.0E-13
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 80 130 9.0E-13
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 80 130 9.0E-13
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 80 130 1.0E-12
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 80 130 1.0E-12
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 80 130 1.0E-12
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 80 130 1.0E-12
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 80 130 2.0E-12
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 81 130 3.0E-12
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 81 130 7.0E-12
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 80 130 7.0E-12
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 81 130 7.0E-12
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 80 130 1.0E-11
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 80 130 1.0E-11
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 80 130 2.0E-11
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 80 130 2.0E-11
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 80 130 2.0E-11
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 80 130 2.0E-11
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 80 130 2.0E-11
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 80 130 2.0E-11
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 80 130 2.0E-11
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 80 130 2.0E-11
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 80 130 2.0E-11
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 80 130 2.0E-11
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 81 129 3.0E-11
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 81 130 1.0E-10
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 62 125 4.0E-10
sp|Q925H1|TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus GN=Trps1 PE=1 SV=1 81 156 1.0E-09
sp|Q9UHF7|TRPS1_HUMAN Zinc finger transcription factor Trps1 OS=Homo sapiens GN=TRPS1 PE=1 SV=2 81 153 2.0E-09
sp|Q10655|ELT2_CAEEL Transcription factor elt-2 OS=Caenorhabditis elegans GN=elt-2 PE=2 SV=1 81 130 2.0E-09
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 81 135 3.0E-09
sp|Q90ZS6|TRPS1_XENLA Zinc finger transcription factor Trps1 OS=Xenopus laevis GN=trps1 PE=1 SV=1 81 156 5.0E-09
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 65 150 6.0E-09
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 81 131 6.0E-09
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 81 135 7.0E-09
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 81 135 8.0E-09
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 81 135 9.0E-09
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 81 135 9.0E-09
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 81 135 9.0E-09
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 81 135 1.0E-08
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 81 135 1.0E-08
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 81 135 1.0E-08
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 81 135 1.0E-08
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 81 135 1.0E-08
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 91 130 1.0E-08
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 91 130 1.0E-08
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 91 130 1.0E-08
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 81 135 2.0E-08
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 81 135 2.0E-08
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 81 135 2.0E-08
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 81 135 2.0E-08
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 81 135 2.0E-08
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 81 135 2.0E-08
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 81 135 2.0E-08
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 5 118 2.0E-08
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 81 118 2.0E-08
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 81 135 3.0E-08
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 81 135 3.0E-08
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 81 135 3.0E-08
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 81 118 3.0E-08
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 81 118 3.0E-08
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 81 135 4.0E-08
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 81 135 4.0E-08
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 81 135 4.0E-08
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 81 118 4.0E-08
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 42 118 4.0E-08
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 91 174 6.0E-08
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 81 118 7.0E-08
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 81 121 8.0E-08
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 81 128 8.0E-08
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 81 135 8.0E-08
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 81 112 1.0E-07
sp|Q92259|SREP_PENCH GATA factor SREP OS=Penicillium chrysogenum GN=SREP PE=3 SV=1 80 133 1.0E-07
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 81 118 1.0E-07
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 81 118 1.0E-07
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 81 130 1.0E-07
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 91 203 1.0E-07
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 91 130 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0003677 DNA binding No
GO:0003674 molecular_function No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0046914 transition metal ion binding No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0043167 ion binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7449
MEDGPHMLPPHPADPISRPSSTSTSASATLPQLPGIAALAASNAAHESPQLRATAAPQAPVHGGVSPAATSGGGG
SNLPTCQNCTTSTTPLWRRDEFGSVLCNACGLFLKLHGRPRPISLKTDVIKSRNRVKTMRPDLAPKKKQQQQQQQ
QQQNAAAAAAQAIQRATQKSANGNGDGSDSPISRTGTPSMYNHGLPSFIVDDPYQTGFGATGGADGSAGSPMNGD
RGLDSPQTHEQLIAHNSSLKTRVSELEVINELFRGRLSQLEQQEAAARRGQEVAGVEQSQLRSQVEAYKESDAQL
RAQLEDSHRRENILKRRLDELELELKAAQDALDAPEERPAKKARTEGDASVTAAAAAAAAAVAATAAAAEEHEDL
LQVKPEAEPPLEPELRAEQELVVQEPGQELEPMGESDHEAVPEGVNEEQLDEASQEPEQEPESTSTPSSA*
Coding >Hirsu2|7449
ATGGAGGACGGTCCGCACATGCTCCCGCCGCATCCTGCGGATCCGATTTCTCGACCGAGCTCGACGTCCACATCC
GCGTCGGCGACGCTCCCGCAGCTGCCCGGCATCGCGGCCCTGGCGGCCAGCAATGCGGCACACGAATCTCCACAG
TTGAGGGCCACGGCAGCACCGCAAGCGCCAGTCCACGGCGGCGTCTCACCCGCTGCTACCAGCGGCGGCGGGGGC
AGCAACCTGCCCACCTGCCAAAACTGCACAACCTCGACGACGCCCCTGTGGCGCCGGGACGAGTTTGGCTCAGTC
CTCTGCAATGCCTGCGGCCTGTTCCTCAAGCTGCACGGCCGCCCGCGGCCCATCTCGCTCAAGACCGACGTCATC
AAGAGCCGCAACCGCGTCAAGACGATGCGCCCGGATCTGGCCCCCAAGAAAAAGCAGCAGCAGCAGCAGCAGCAA
CAGCAACAGAATGCCGCCGCCGCCGCAGCGCAGGCCATCCAGCGAGCAACGCAGAAGTCGGCCAACGGAAACGGT
GACGGGTCGGACTCGCCCATCTCCCGAACGGGGACTCCTTCCATGTACAACCACGGGCTGCCGTCCTTCATAGTC
GACGACCCCTATCAGACCGGCTTCGGCGCAACGGGCGGCGCCGACGGCAGTGCCGGCTCGCCCATGAATGGGGAT
CGCGGCCTGGACTCGCCTCAGACGCATGAACAGCTCATCGCGCACAACTCCAGCCTCAAGACCAGGGTTAGCGAG
CTCGAGGTCATCAACGAGCTCTTCCGCGGCCGTCTGAGCCAGCTGGAGCAGCAGGAAGCTGCGGCACGCCGAGGG
CAGGAAGTCGCCGGGGTGGAGCAGTCGCAGCTGAGAAGCCAAGTGGAGGCCTACAAAGAGAGCGACGCTCAGCTC
CGCGCGCAACTCGAGGACAGCCACCGGCGGGAGAACATCCTGAAGCGTCGTCTGGACGAACTGGAGCTGGAGCTG
AAGGCGGCCCAAGACGCCCTGGACGCGCCGGAGGAGCGACCTGCCAAGAAGGCTCGCACGGAAGGAGACGCGAGC
GTGACGGCAGCCGCCGCCGCCGCCGCCGCCGCCGTCGCCGCCACGGCGGCGGCCGCCGAGGAGCATGAGGACTTG
CTGCAAGTCAAGCCCGAGGCGGAGCCGCCGCTGGAGCCGGAGCTTCGGGCCGAGCAAGAACTCGTTGTGCAGGAG
CCCGGGCAGGAGCTGGAGCCGATGGGGGAATCGGACCACGAGGCCGTGCCCGAGGGCGTCAACGAAGAGCAGCTG
GACGAAGCGTCACAGGAGCCCGAGCAAGAGCCCGAGTCAACTTCAACGCCTAGTTCTGCCTAG
Transcript >Hirsu2|7449
ATGGAGGACGGTCCGCACATGCTCCCGCCGCATCCTGCGGATCCGATTTCTCGACCGAGCTCGACGTCCACATCC
GCGTCGGCGACGCTCCCGCAGCTGCCCGGCATCGCGGCCCTGGCGGCCAGCAATGCGGCACACGAATCTCCACAG
TTGAGGGCCACGGCAGCACCGCAAGCGCCAGTCCACGGCGGCGTCTCACCCGCTGCTACCAGCGGCGGCGGGGGC
AGCAACCTGCCCACCTGCCAAAACTGCACAACCTCGACGACGCCCCTGTGGCGCCGGGACGAGTTTGGCTCAGTC
CTCTGCAATGCCTGCGGCCTGTTCCTCAAGCTGCACGGCCGCCCGCGGCCCATCTCGCTCAAGACCGACGTCATC
AAGAGCCGCAACCGCGTCAAGACGATGCGCCCGGATCTGGCCCCCAAGAAAAAGCAGCAGCAGCAGCAGCAGCAA
CAGCAACAGAATGCCGCCGCCGCCGCAGCGCAGGCCATCCAGCGAGCAACGCAGAAGTCGGCCAACGGAAACGGT
GACGGGTCGGACTCGCCCATCTCCCGAACGGGGACTCCTTCCATGTACAACCACGGGCTGCCGTCCTTCATAGTC
GACGACCCCTATCAGACCGGCTTCGGCGCAACGGGCGGCGCCGACGGCAGTGCCGGCTCGCCCATGAATGGGGAT
CGCGGCCTGGACTCGCCTCAGACGCATGAACAGCTCATCGCGCACAACTCCAGCCTCAAGACCAGGGTTAGCGAG
CTCGAGGTCATCAACGAGCTCTTCCGCGGCCGTCTGAGCCAGCTGGAGCAGCAGGAAGCTGCGGCACGCCGAGGG
CAGGAAGTCGCCGGGGTGGAGCAGTCGCAGCTGAGAAGCCAAGTGGAGGCCTACAAAGAGAGCGACGCTCAGCTC
CGCGCGCAACTCGAGGACAGCCACCGGCGGGAGAACATCCTGAAGCGTCGTCTGGACGAACTGGAGCTGGAGCTG
AAGGCGGCCCAAGACGCCCTGGACGCGCCGGAGGAGCGACCTGCCAAGAAGGCTCGCACGGAAGGAGACGCGAGC
GTGACGGCAGCCGCCGCCGCCGCCGCCGCCGCCGTCGCCGCCACGGCGGCGGCCGCCGAGGAGCATGAGGACTTG
CTGCAAGTCAAGCCCGAGGCGGAGCCGCCGCTGGAGCCGGAGCTTCGGGCCGAGCAAGAACTCGTTGTGCAGGAG
CCCGGGCAGGAGCTGGAGCCGATGGGGGAATCGGACCACGAGGCCGTGCCCGAGGGCGTCAACGAAGAGCAGCTG
GACGAAGCGTCACAGGAGCCCGAGCAAGAGCCCGAGTCAACTTCAACGCCTAGTTCTGCCTAG
Gene >Hirsu2|7449
ATGGAGGACGGTCCGCACATGCTCCCGCCGCATCCTGCGGATCCGATTTCTCGACCGAGCTCGACGTCCACATCC
GCGTCGGCGACGCTCCCGCAGCTGCCCGGCATCGCGGCCCTGGCGGCCAGCAATGCGGCACACGAATCTCCACAG
TTGAGGTAGGCTCGACATGATACAGACCGCACGAGGTGGACGCGTGATTCTGGAGCCGCCACTGGCTGCCCGGGG
CGGCGTCGGCGGTTCGCGCCAGGCCAGCTGCCACGGCACTCGGCGCCTCATCCATCCCTCATCTTTCACATGCCC
TTATCGGCCGCAAGACTGACGCTCGTCTCGTTTTGCAGGGCCACGGCAGCACCGCAAGCGCCAGTCCACGGCGGC
GTCTCACCCGCTGCTACCAGCGGCGGCGGGGGCAGCAACCTGGTGAGTCGCCCTGGCTCGGTCCCACGTCGCGGC
ATCCCATACCCATCCACCTCCCTCTCCTTTGCGCGGCATCCTAGGTGATATGTCGAGCCGCGGGCAAAGGCGCCT
TTGGGTTGGATCGAGGTGGAGACTCCCATCAGATCCGAGTCCTTTTGTCCACGTCGGCGGTCCTTATCGCCCGCT
ATCGCCAGACGGCCGGGCCATCACGTGCCGTATCTGCAGCGCTAGTCCGCAACGGGCAATCCCTCTCGCCTTGCT
TCCTTCCAATCAAGCCTCCGCTATCTGGTCTTATCATGCCACCTGCCAAAGAAATTTTTTGGGCTCCGTCACCTT
ATCGATCACGATATCCATCATTTATTGTGCCGCCCTTCCCCCCTTACCTACTTATCTATCCTCCGCCTCGCCTCG
CCTCCATCCCGCTCAACCGGCACCATGATGGCCTCTAACGCTTCCTCGCAGCCCACCTGCCAAAACTGCACAACC
TCGACGACGCCCCTGTGGCGCCGGGACGAGTTTGGCTCAGTCCTCTGCAATGCCTGCGGCCTGTTCCTCAAGCTG
CACGGCCGCCCGCGGCCCATCTCGCTCAAGACCGACGTCATCAAGAGCCGCAACCGCGTCAAGACGATGCGCCCG
GATCTGGCCCCCAAGAAAAAGGTGCGCGGCCCTCGGCCCTGATTCCCTCCCCCTCCCCCGGGCGTCGCCCCTTTC
TGACCTCGCGTCCAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACAGGTCCCATTCTTCCCTGCCCCGACCGAC
GCGAACCATGCTGAGACATCCGCCCAGAATGCCGCCGCCGCCGCAGCGCAGGCCATCCAGCGAGCAACGCAGAAG
TCGGCCAACGGAAACGGTGACGGGTCGGACTCGCCCATCTCCCGAACGGGGACTCCTTCCATGTACAACCACGGG
CTGCCGTCCTTCATAGTCGACGACCCCTATCAGACCGGCTTCGGCGCAACGGGCGGCGCCGACGGCAGTGCCGGC
TCGCCCATGAATGGGGATCGCGGCCTGGACTCGCCTCAGACGCATGAACAGCTCATCGCGCACAACTCCAGCCTC
AAGACCAGGGTTAGCGAGCTCGAGGTCATCAACGAGCTCTTCCGCGGCCGTCTGAGCCAGCTGGAGCAGCAGGAA
GCTGCGGCACGCCGAGGGCAGGAAGTCGCCGGGGTGGAGCAGTCGCAGCTGAGAAGCCAAGTGGAGGCCTACAAA
GAGAGCGACGCTCAGCTCCGCGCGCAACTCGAGGACAGCCACCGGCGGGAGAACATCCTGAAGCGTCGTCTGGAC
GAACTGGAGCTGGAGCTGAAGGCGGCCCAAGACGCCCTGGACGCGCCGGAGGAGCGACCTGCCAAGAAGGCTCGC
ACGGAAGGAGACGCGAGCGTGACGGCAGCCGCCGCCGCCGCCGCCGCCGCCGTCGCCGCCACGGCGGCGGCCGCC
GAGGAGCATGAGGACTTGCTGCAAGTCAAGCCCGAGGCGGAGCCGCCGCTGGAGCCGGAGCTTCGGGCCGAGCAA
GAACTCGTTGTGCAGGAGCCCGGGCAGGAGCTGGAGCCGATGGGGGAATCGGACCACGAGGCCGTGCCCGAGGGC
GTCAACGAAGAGCAGCTGGACGAAGCGTCACAGGAGCCCGAGCAAGAGCCCGAGTCAACTTCAACGCCTAGTTCT
GCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail