Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7446
Gene name
LocationContig_433:8712..9669
Strand+
Gene length (bp)957
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10173 Mit_KHE1 Mitochondrial K+-H+ exchange-related 4.4E-60 2 182

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13942|YEPC_SCHPO Uncharacterized protein C23H3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H3.12c PE=4 SV=1 1 175 1.0E-18
sp|P48569|YD183_YEAST Uncharacterized protein YDL183C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL183C PE=4 SV=1 1 252 2.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 141 163 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7446
MRLYLLPVSTRRTLLYAQRLDASPASASSRPGQRSLADKTTAWAAAKWAQWEKQESGWQRKVVDYGNHAFRRIPF
EEWGLKSVPPLSARRRDDERAGRETVQLVFPAGLVAPDRVRALALRLATERLALHRKRMVWCFVGMPATLPFVLI
PVIPNLPFFYLVYRAWSHWRAIAGGRHVQWLVENKLLLPSPSKTLDQLYGPDAPGTAAAGEDPTAPETMLLTRKQ
VRAFSNALDLPPLEIELERAIWQVERALSEQRPPAGDGQESSPTSAPPDEKRSQDEKR*
Coding >Hirsu2|7446
ATGCGCCTCTACCTCCTGCCCGTGTCGACGCGGCGCACGCTGCTGTACGCGCAGCGGCTCGACGCGTCGCCCGCC
TCGGCGTCGTCGCGGCCCGGGCAGCGCAGCCTCGCCGACAAGACGACGGCCTGGGCGGCCGCCAAGTGGGCGCAG
TGGGAGAAGCAGGAGTCGGGCTGGCAGCGCAAGGTCGTCGACTACGGCAACCACGCCTTCCGGCGCATCCCGTTC
GAGGAGTGGGGCCTCAAGTCGGTGCCGCCGCTGTCGGCCCGCCGCCGCGACGACGAGCGCGCCGGCCGCGAGACC
GTCCAGCTCGTCTTCCCCGCCGGCCTCGTCGCCCCGGACCGCGTCCGCGCCTTGGCCCTCCGCCTCGCGACCGAG
CGGCTCGCCCTACACCGGAAGCGCATGGTCTGGTGCTTCGTCGGCATGCCCGCCACTCTGCCCTTTGTGCTGATT
CCCGTAATCCCCAACCTCCCCTTCTTCTACCTCGTCTACCGCGCCTGGTCCCATTGGCGAGCCATCGCAGGCGGC
CGCCACGTCCAGTGGCTCGTCGAGAACAAGCTCCTCCTCCCCTCCCCGTCCAAGACGCTGGACCAGCTCTACGGG
CCGGACGCCCCGGGGACCGCGGCGGCGGGCGAGGACCCGACGGCCCCGGAGACGATGCTCCTCACGCGGAAGCAG
GTCCGCGCCTTCTCCAACGCCCTCGACCTTCCGCCGCTCGAGATCGAGCTCGAGCGGGCCATCTGGCAGGTCGAG
CGAGCCCTGAGCGAGCAACGCCCGCCCGCCGGCGACGGTCAGGAATCGTCGCCAACCTCTGCCCCGCCCGACGAG
AAACGTTCGCAAGACGAGAAGCGCTGA
Transcript >Hirsu2|7446
ATGCGCCTCTACCTCCTGCCCGTGTCGACGCGGCGCACGCTGCTGTACGCGCAGCGGCTCGACGCGTCGCCCGCC
TCGGCGTCGTCGCGGCCCGGGCAGCGCAGCCTCGCCGACAAGACGACGGCCTGGGCGGCCGCCAAGTGGGCGCAG
TGGGAGAAGCAGGAGTCGGGCTGGCAGCGCAAGGTCGTCGACTACGGCAACCACGCCTTCCGGCGCATCCCGTTC
GAGGAGTGGGGCCTCAAGTCGGTGCCGCCGCTGTCGGCCCGCCGCCGCGACGACGAGCGCGCCGGCCGCGAGACC
GTCCAGCTCGTCTTCCCCGCCGGCCTCGTCGCCCCGGACCGCGTCCGCGCCTTGGCCCTCCGCCTCGCGACCGAG
CGGCTCGCCCTACACCGGAAGCGCATGGTCTGGTGCTTCGTCGGCATGCCCGCCACTCTGCCCTTTGTGCTGATT
CCCGTAATCCCCAACCTCCCCTTCTTCTACCTCGTCTACCGCGCCTGGTCCCATTGGCGAGCCATCGCAGGCGGC
CGCCACGTCCAGTGGCTCGTCGAGAACAAGCTCCTCCTCCCCTCCCCGTCCAAGACGCTGGACCAGCTCTACGGG
CCGGACGCCCCGGGGACCGCGGCGGCGGGCGAGGACCCGACGGCCCCGGAGACGATGCTCCTCACGCGGAAGCAG
GTCCGCGCCTTCTCCAACGCCCTCGACCTTCCGCCGCTCGAGATCGAGCTCGAGCGGGCCATCTGGCAGGTCGAG
CGAGCCCTGAGCGAGCAACGCCCGCCCGCCGGCGACGGTCAGGAATCGTCGCCAACCTCTGCCCCGCCCGACGAG
AAACGTTCGCAAGACGAGAAGCGCTGA
Gene >Hirsu2|7446
ATGCGCCTCTACCTCCTGCCCGTGTCGACGCGGCGCACGCTGCTGTACGCGCAGCGGCTCGACGCGTCGCCCGCC
TCGGCGTCGTCGCGGCCCGGGCAGCGCAGCCTCGCCGACAAGACGACGGCCTGGGCGGCCGCCAAGTGGGCGCAG
TGGGAGAAGCAGGAGTCGGGCTGGCAGCGCAAGGTCGTCGACTACGGCAACCACGCCTTCCGGCGCATCCCGTTC
GAGGAGTGGGGCCTCAAGTCGGTGCCGCCGCTGTCGGCCCGCCGCCGCGACGACGAGCGCGCCGGCCGCGAGACC
GTCCAGCTCGTCTTCCCCGCCGGCCTCGTCGCCCCGGACCGCGTCCGCGCCTTGGCCCTCCGCCTCGCGACCGAG
CGGCTCGCCCTACACCGGAAGCGCATGGTCTGGTGCTTCGTCGGCATGCCCGCCACTCTGCCCTTTGTGCTGATT
CCCGTGTATGGACATCCCGCCCCCCTTTTACACCTCCCGCCATGTTCCGTCCAGGTCGCGGTGAAGAACAGAGAT
GGAGAAAACACTGCTGACCCCCTCCGTCTCCGCAGAATCCCCAACCTCCCCTTCTTCTACCTCGTCTACCGCGCC
TGGTCCCATTGGCGAGCCATCGCAGGCGGCCGCCACGTCCAGTGGCTCGTCGAGAACAAGCTCCTCCTCCCCTCC
CCGTCCAAGACGCTGGACCAGCTCTACGGGCCGGACGCCCCGGGGACCGCGGCGGCGGGCGAGGACCCGACGGCC
CCGGAGACGATGCTCCTCACGCGGAAGCAGGTCCGCGCCTTCTCCAACGCCCTCGACCTTCCGCCGCTCGAGATC
GAGCTCGAGCGGGCCATCTGGCAGGTCGAGCGAGCCCTGAGCGAGCAACGCCCGCCCGCCGGCGACGGTCAGGAA
TCGTCGCCAACCTCTGCCCCGCCCGACGAGAAACGTTCGCAAGACGAGAAGCGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail