Ophiocordyceps subramaniannii

General Properties

Protein ID	Hirsu2\|7434
Gene name
Location	Contig_431:12778..14079
Strand	+
Gene length (bp)	1301
Transcript length (bp)	1239
Coding sequence length (bp)	1239
Protein length (aa)	413

PFAM Domains

PFAM Domain ID	Short name	Long name	E-value	Start	End
PF00591	Glycos_transf_3	Glycosyl transferase family, a/b domain	9.7E-59	110	396
PF02885	Glycos_trans_3N	Glycosyl transferase family, helical bundle domain	1.6E-13	20	83

Swissprot hits

[Show all]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|O60122\|TRPD_SCHPO	Anthranilate phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp4 PE=3 SV=1	40	409	3.0E-64
sp\|P07285\|TRPD_YEAST	Anthranilate phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP4 PE=1 SV=1	52	410	5.0E-52
sp\|A5UMC1\|TRPD_METS3	Anthranilate phosphoribosyltransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=trpD PE=3 SV=1	18	408	5.0E-47
sp\|C4Z111\|TRPD_EUBE2	Anthranilate phosphoribosyltransferase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=trpD PE=3 SV=1	18	409	1.0E-46
sp\|A9BHQ6\|TRPD_PETMO	Anthranilate phosphoribosyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=trpD PE=3 SV=1	36	408	3.0E-46

[Show all]

[Show less]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|O60122\|TRPD_SCHPO	Anthranilate phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp4 PE=3 SV=1	40	409	3.0E-64
sp\|P07285\|TRPD_YEAST	Anthranilate phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP4 PE=1 SV=1	52	410	5.0E-52
sp\|A5UMC1\|TRPD_METS3	Anthranilate phosphoribosyltransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=trpD PE=3 SV=1	18	408	5.0E-47
sp\|C4Z111\|TRPD_EUBE2	Anthranilate phosphoribosyltransferase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=trpD PE=3 SV=1	18	409	1.0E-46
sp\|A9BHQ6\|TRPD_PETMO	Anthranilate phosphoribosyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=trpD PE=3 SV=1	36	408	3.0E-46
sp\|B5EBU6\|TRPD_GEOBB	Anthranilate phosphoribosyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=trpD PE=3 SV=1	31	409	1.0E-44
sp\|Q74AH4\|TRPD_GEOSL	Anthranilate phosphoribosyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=trpD PE=3 SV=1	31	409	2.0E-43
sp\|C6DYM5\|TRPD_GEOSM	Anthranilate phosphoribosyltransferase OS=Geobacter sp. (strain M21) GN=trpD PE=3 SV=1	31	409	3.0E-43
sp\|Q39SQ6\|TRPD_GEOMG	Anthranilate phosphoribosyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=trpD PE=3 SV=1	31	409	3.0E-43
sp\|P17170\|TRPD_LACCA	Anthranilate phosphoribosyltransferase OS=Lactobacillus casei GN=trpD PE=3 SV=1	36	351	6.0E-43
sp\|B3W6W9\|TRPD_LACCB	Anthranilate phosphoribosyltransferase OS=Lactobacillus casei (strain BL23) GN=trpD PE=3 SV=1	18	351	7.0E-43
sp\|B1Z9R9\|TRPD_METPB	Anthranilate phosphoribosyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=trpD PE=3 SV=1	109	408	8.0E-43
sp\|Q92B78\|TRPD_LISIN	Anthranilate phosphoribosyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trpD PE=3 SV=1	21	412	8.0E-43
sp\|Q1AU89\|TRPD_RUBXD	Anthranilate phosphoribosyltransferase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=trpD PE=3 SV=1	109	411	8.0E-43
sp\|Q71Z37\|TRPD_LISMF	Anthranilate phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=trpD PE=3 SV=1	21	412	1.0E-42
sp\|C1KVS8\|TRPD_LISMC	Anthranilate phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=trpD PE=3 SV=1	21	412	1.0E-42
sp\|Q1IJR5\|TRPD_KORVE	Anthranilate phosphoribosyltransferase OS=Koribacter versatilis (strain Ellin345) GN=trpD PE=3 SV=1	39	329	2.0E-42
sp\|B8DHB1\|TRPD_LISMH	Anthranilate phosphoribosyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=trpD PE=3 SV=1	21	412	3.0E-42
sp\|Q03CY0\|TRPD_LACC3	Anthranilate phosphoribosyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=trpD PE=3 SV=1	18	351	5.0E-42
sp\|A9W900\|TRPD_METEP	Anthranilate phosphoribosyltransferase OS=Methylobacterium extorquens (strain PA1) GN=trpD PE=3 SV=1	109	408	8.0E-42
sp\|B3E5V8\|TRPD_GEOLS	Anthranilate phosphoribosyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=trpD PE=3 SV=1	31	408	8.0E-42
sp\|B1XSZ2\|TRPD_POLNS	Anthranilate phosphoribosyltransferase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=trpD PE=3 SV=1	105	408	9.0E-42
sp\|Q8Y6Q3\|TRPD_LISMO	Anthranilate phosphoribosyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trpD PE=3 SV=1	21	412	1.0E-41
sp\|A4J146\|TRPD_DESRM	Anthranilate phosphoribosyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=trpD PE=3 SV=1	31	410	2.0E-41
sp\|B7KUV9\|TRPD_METC4	Anthranilate phosphoribosyltransferase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=trpD PE=3 SV=1	109	408	2.0E-41
sp\|A7INK3\|TRPD_XANP2	Anthranilate phosphoribosyltransferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=trpD PE=3 SV=1	17	411	2.0E-41
sp\|A4VHK0\|TRPD_PSEU5	Anthranilate phosphoribosyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=trpD PE=3 SV=1	16	306	2.0E-41
sp\|A9B148\|TRPD_HERA2	Anthranilate phosphoribosyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=trpD PE=3 SV=1	30	408	2.0E-41
sp\|A0AJ83\|TRPD_LISW6	Anthranilate phosphoribosyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=trpD PE=3 SV=1	18	410	3.0E-41
sp\|B3QUY6\|TRPD_CHLT3	Anthranilate phosphoribosyltransferase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=trpD PE=3 SV=1	36	405	6.0E-41
sp\|Q88WI3\|TRPD_LACPL	Anthranilate phosphoribosyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=trpD PE=3 SV=1	39	329	2.0E-40
sp\|Q5QX82\|TRPD_IDILO	Anthranilate phosphoribosyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=trpD PE=3 SV=1	110	368	2.0E-40
sp\|B2FKL2\|TRPD_STRMK	Anthranilate phosphoribosyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=trpD PE=3 SV=1	45	412	2.0E-40
sp\|B4SE13\|TRPD_PELPB	Anthranilate phosphoribosyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=trpD PE=3 SV=1	19	411	3.0E-40
sp\|O66576\|TRPD_AQUAE	Anthranilate phosphoribosyltransferase OS=Aquifex aeolicus (strain VF5) GN=trpD PE=3 SV=1	110	410	5.0E-40
sp\|Q15RZ7\|TRPD_PSEA6	Anthranilate phosphoribosyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=trpD PE=3 SV=1	20	329	6.0E-40
sp\|A1W2Z7\|TRPD_ACISJ	Anthranilate phosphoribosyltransferase OS=Acidovorax sp. (strain JS42) GN=trpD PE=3 SV=1	110	412	7.0E-40
sp\|B9MBS3\|TRPD_ACIET	Anthranilate phosphoribosyltransferase OS=Acidovorax ebreus (strain TPSY) GN=trpD PE=3 SV=1	110	412	7.0E-40
sp\|Q4ZML2\|TRPD_PSEU2	Anthranilate phosphoribosyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=trpD PE=3 SV=1	15	306	8.0E-40
sp\|B0U7Z5\|TRPD_METS4	Anthranilate phosphoribosyltransferase OS=Methylobacterium sp. (strain 4-46) GN=trpD PE=3 SV=1	18	408	1.0E-39
sp\|B8I0U9\|TRPD_CLOCE	Anthranilate phosphoribosyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=trpD PE=3 SV=1	31	408	1.0E-39
sp\|Q97EF2\|TRPD_CLOAB	Anthranilate phosphoribosyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=trpD PE=3 SV=1	47	404	2.0E-39
sp\|C0QR68\|TRPD_PERMH	Anthranilate phosphoribosyltransferase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=trpD PE=3 SV=1	18	403	3.0E-39
sp\|Q47YC2\|TRPD_COLP3	Anthranilate phosphoribosyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=trpD PE=3 SV=1	32	356	3.0E-39
sp\|A5GKM1\|TRPD_SYNPW	Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain WH7803) GN=trpD PE=3 SV=1	36	403	4.0E-39
sp\|Q3ZZ15\|TRPD_DEHMC	Anthranilate phosphoribosyltransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=trpD PE=3 SV=1	110	412	4.0E-39
sp\|Q3Z6G6\|TRPD_DEHM1	Anthranilate phosphoribosyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=trpD PE=3 SV=1	110	412	4.0E-39
sp\|C1CT54\|TRPD_STRZT	Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=trpD PE=3 SV=1	36	401	5.0E-39
sp\|B8ZN62\|TRPD_STRPJ	Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=trpD PE=3 SV=1	36	401	5.0E-39
sp\|C1CG45\|TRPD_STRZJ	Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=trpD PE=3 SV=1	36	401	5.0E-39
sp\|P67000\|TRPD_STRR6	Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=trpD PE=3 SV=1	36	401	5.0E-39
sp\|B2ISS4\|TRPD_STRPS	Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=trpD PE=3 SV=1	36	401	5.0E-39
sp\|P66999\|TRPD_STRPN	Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=trpD PE=3 SV=1	36	401	5.0E-39
sp\|B1I7T0\|TRPD_STRPI	Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=trpD PE=3 SV=1	36	401	5.0E-39
sp\|C1C969\|TRPD_STRP7	Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=trpD PE=3 SV=1	36	401	5.0E-39
sp\|Q04IY6\|TRPD_STRP2	Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=trpD PE=3 SV=1	36	401	5.0E-39
sp\|Q0C1A1\|TRPD_HYPNA	Anthranilate phosphoribosyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=trpD PE=3 SV=1	93	409	6.0E-39
sp\|B3GY52\|TRPD_ACTP7	Anthranilate phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=trpD PE=3 SV=1	37	352	7.0E-39
sp\|A9AAU1\|TRPD_METM6	Anthranilate phosphoribosyltransferase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=trpD PE=3 SV=1	50	406	7.0E-39
sp\|C1CMD6\|TRPD_STRZP	Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=trpD PE=3 SV=1	36	401	7.0E-39
sp\|B5E7M6\|TRPD_STRP4	Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=trpD PE=3 SV=1	36	401	7.0E-39
sp\|Q9YGB4\|TRPD_THEKO	Anthranilate phosphoribosyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpD PE=3 SV=1	99	373	8.0E-39
sp\|Q57686\|TRPD_METJA	Anthranilate phosphoribosyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpD PE=3 SV=1	110	409	8.0E-39
sp\|B9KXB8\|TRPD_THERP	Anthranilate phosphoribosyltransferase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=trpD PE=3 SV=1	32	328	8.0E-39
sp\|Q3AXD5\|TRPD_SYNS9	Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain CC9902) GN=trpD PE=3 SV=1	31	401	9.0E-39
sp\|A5VXL4\|TRPD_PSEP1	Anthranilate phosphoribosyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=trpD PE=3 SV=1	16	401	1.0E-38
sp\|P20575\|TRPD_PSEPU	Anthranilate phosphoribosyltransferase OS=Pseudomonas putida GN=trpD PE=3 SV=1	16	318	2.0E-38
sp\|Q88QR7\|TRPD_PSEPK	Anthranilate phosphoribosyltransferase OS=Pseudomonas putida (strain KT2440) GN=trpD PE=3 SV=1	16	401	2.0E-38
sp\|A3DDS8\|TRPD_CLOTH	Anthranilate phosphoribosyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=trpD PE=3 SV=1	18	408	2.0E-38
sp\|Q2IWB1\|TRPD_RHOP2	Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=trpD PE=3 SV=2	16	407	3.0E-38
sp\|B0K2U2\|TRPD_THEPX	Anthranilate phosphoribosyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=trpD PE=3 SV=1	122	405	3.0E-38
sp\|B0K8T3\|TRPD_THEP3	Anthranilate phosphoribosyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=trpD PE=3 SV=1	122	405	3.0E-38
sp\|A3N1G7\|TRPD_ACTP2	Anthranilate phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=trpD PE=3 SV=1	37	401	4.0E-38
sp\|A9KL44\|TRPD_CLOPH	Anthranilate phosphoribosyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=trpD PE=3 SV=1	112	408	4.0E-38
sp\|Q48NP8\|TRPD_PSE14	Anthranilate phosphoribosyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=trpD PE=3 SV=1	16	306	5.0E-38
sp\|Q03WZ9\|TRPD_LEUMM	Anthranilate phosphoribosyltransferase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=trpD PE=3 SV=1	111	349	6.0E-38
sp\|B3EMT4\|TRPD_CHLPB	Anthranilate phosphoribosyltransferase OS=Chlorobium phaeobacteroides (strain BS1) GN=trpD PE=3 SV=1	19	411	7.0E-38
sp\|Q8DVF6\|TRPD_STRMU	Anthranilate phosphoribosyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=trpD PE=3 SV=1	18	403	7.0E-38
sp\|B4S5K5\|TRPD_PROA2	Anthranilate phosphoribosyltransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=trpD PE=3 SV=1	29	411	8.0E-38
sp\|C4LC91\|TRPD_TOLAT	Anthranilate phosphoribosyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=trpD PE=3 SV=1	105	355	9.0E-38
sp\|C4ZI69\|TRPD_EUBR3	Anthranilate phosphoribosyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=trpD PE=3 SV=1	18	408	1.0E-37
sp\|B3EH38\|TRPD_CHLL2	Anthranilate phosphoribosyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=trpD PE=3 SV=1	112	412	1.0E-37
sp\|A8AW02\|TRPD_STRGC	Anthranilate phosphoribosyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=trpD PE=3 SV=1	18	403	1.0E-37
sp\|Q8D8B4\|TRPD_VIBVU	Anthranilate phosphoribosyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=trpD PE=3 SV=1	28	329	2.0E-37
sp\|Q7MM54\|TRPD_VIBVY	Anthranilate phosphoribosyltransferase OS=Vibrio vulnificus (strain YJ016) GN=trpD PE=3 SV=2	18	329	2.0E-37
sp\|Q07NF5\|TRPD_RHOP5	Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=trpD PE=3 SV=1	16	352	2.0E-37
sp\|B0BQA6\|TRPD_ACTPJ	Anthranilate phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=trpD PE=3 SV=1	37	352	2.0E-37
sp\|A4SV53\|TRPD_POLSQ	Anthranilate phosphoribosyltransferase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=trpD PE=3 SV=1	105	354	2.0E-37
sp\|Q82Y74\|TRPD_NITEU	Anthranilate phosphoribosyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=trpD PE=3 SV=1	110	412	2.0E-37
sp\|P06559\|TRPD_CORGL	Anthranilate phosphoribosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=trpD PE=3 SV=3	109	328	2.0E-37
sp\|A4QI74\|TRPD_CORGB	Anthranilate phosphoribosyltransferase OS=Corynebacterium glutamicum (strain R) GN=trpD PE=3 SV=1	109	328	2.0E-37
sp\|B0KJB2\|TRPD_PSEPG	Anthranilate phosphoribosyltransferase OS=Pseudomonas putida (strain GB-1) GN=trpD PE=3 SV=1	16	306	3.0E-37
sp\|B7HGZ8\|TRPD_BACC4	Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain B4264) GN=trpD PE=3 SV=1	99	409	3.0E-37
sp\|Q1IG00\|TRPD_PSEE4	Anthranilate phosphoribosyltransferase OS=Pseudomonas entomophila (strain L48) GN=trpD PE=3 SV=1	16	306	3.0E-37
sp\|Q88A04\|TRPD_PSESM	Anthranilate phosphoribosyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=trpD PE=3 SV=1	16	306	3.0E-37
sp\|A8ZZX1\|TRPD_DESOH	Anthranilate phosphoribosyltransferase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=trpD PE=3 SV=1	31	407	3.0E-37
sp\|Q9V1G4\|TRPD_PYRAB	Anthranilate phosphoribosyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trpD PE=3 SV=1	108	358	4.0E-37
sp\|B3PLP1\|TRPD_CELJU	Anthranilate phosphoribosyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=trpD PE=3 SV=1	16	354	4.0E-37
sp\|A8I839\|TRPD_AZOC5	Anthranilate phosphoribosyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=trpD PE=3 SV=1	18	411	4.0E-37
sp\|B4SLE9\|TRPD_STRM5	Anthranilate phosphoribosyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=trpD PE=3 SV=1	110	412	5.0E-37
sp\|Q9KCB3\|TRPD_BACHD	Anthranilate phosphoribosyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=trpD PE=3 SV=1	110	360	5.0E-37
sp\|B1JE35\|TRPD_PSEPW	Anthranilate phosphoribosyltransferase OS=Pseudomonas putida (strain W619) GN=trpD PE=3 SV=1	16	318	5.0E-37
sp\|Q67PJ9\|TRPD_SYMTH	Anthranilate phosphoribosyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=trpD PE=3 SV=1	18	329	5.0E-37
sp\|A6VNT3\|TRPD_ACTSZ	Anthranilate phosphoribosyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=trpD PE=3 SV=1	29	352	5.0E-37
sp\|Q6LPA6\|TRPD_PHOPR	Anthranilate phosphoribosyltransferase OS=Photobacterium profundum GN=trpD PE=3 SV=1	110	332	5.0E-37
sp\|Q3K5V3\|TRPD_PSEPF	Anthranilate phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=trpD PE=3 SV=1	16	310	6.0E-37
sp\|A4XZC6\|TRPD_PSEMY	Anthranilate phosphoribosyltransferase OS=Pseudomonas mendocina (strain ymp) GN=trpD PE=3 SV=1	16	407	7.0E-37
sp\|Q2JQ65\|TRPD_SYNJB	Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=trpD PE=3 SV=1	25	404	8.0E-37
sp\|B8IP99\|TRPD_METNO	Anthranilate phosphoribosyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=trpD PE=3 SV=1	18	328	8.0E-37
sp\|B1YLS1\|TRPD_EXIS2	Anthranilate phosphoribosyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=trpD PE=3 SV=1	18	401	1.0E-36
sp\|Q0AJP9\|TRPD_NITEC	Anthranilate phosphoribosyltransferase OS=Nitrosomonas eutropha (strain C91) GN=trpD PE=3 SV=1	110	410	1.0E-36
sp\|A6U9C4\|TRPD_SINMW	Anthranilate phosphoribosyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=trpD PE=3 SV=1	17	408	1.0E-36
sp\|Q6LYI4\|TRPD_METMP	Anthranilate phosphoribosyltransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=trpD PE=3 SV=1	50	406	1.0E-36
sp\|B0VUS1\|TRPD_ACIBS	Anthranilate phosphoribosyltransferase OS=Acinetobacter baumannii (strain SDF) GN=trpD PE=3 SV=1	36	355	2.0E-36
sp\|Q2K880\|TRPD_RHIEC	Anthranilate phosphoribosyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=trpD PE=3 SV=1	17	361	2.0E-36
sp\|B0VBS2\|TRPD_ACIBY	Anthranilate phosphoribosyltransferase OS=Acinetobacter baumannii (strain AYE) GN=trpD PE=3 SV=1	36	355	2.0E-36
sp\|A3M784\|TRPD_ACIBT	Anthranilate phosphoribosyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=trpD PE=3 SV=2	36	355	2.0E-36
sp\|B0UU36\|TRPD_HISS2	Anthranilate phosphoribosyltransferase OS=Histophilus somni (strain 2336) GN=trpD PE=3 SV=1	21	352	2.0E-36
sp\|A6VFU3\|TRPD_METM7	Anthranilate phosphoribosyltransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=trpD PE=3 SV=1	50	406	2.0E-36
sp\|Q6N5T0\|TRPD_RHOPA	Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=trpD PE=3 SV=1	16	407	2.0E-36
sp\|B8FA41\|TRPD_DESAA	Anthranilate phosphoribosyltransferase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=trpD PE=3 SV=1	110	409	2.0E-36
sp\|Q2JWL5\|TRPD_SYNJA	Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=trpD PE=3 SV=1	39	405	2.0E-36
sp\|Q9RTJ5\|TRPD_DEIRA	Anthranilate phosphoribosyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=trpD PE=3 SV=2	110	408	2.0E-36
sp\|Q03JB8\|TRPD_STRTD	Anthranilate phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=trpD PE=3 SV=1	31	406	2.0E-36
sp\|Q123F3\|TRPD_POLSJ	Anthranilate phosphoribosyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=trpD PE=3 SV=1	110	412	2.0E-36
sp\|A1WYT2\|TRPD_HALHL	Anthranilate phosphoribosyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=trpD PE=3 SV=1	16	411	2.0E-36
sp\|Q3ABS0\|TRPD_CARHZ	Anthranilate phosphoribosyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=trpD PE=3 SV=1	18	353	2.0E-36
sp\|A4JB68\|TRPD_BURVG	Anthranilate phosphoribosyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=trpD PE=3 SV=1	110	410	2.0E-36
sp\|Q1GHJ3\|TRPD_RUEST	Anthranilate phosphoribosyltransferase OS=Ruegeria sp. (strain TM1040) GN=trpD PE=3 SV=1	112	409	3.0E-36
sp\|Q3IKY4\|TRPD_PSEHT	Anthranilate phosphoribosyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=trpD PE=3 SV=1	107	408	3.0E-36
sp\|Q8R9M6\|TRPD_CALS4	Anthranilate phosphoribosyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=trpD PE=3 SV=1	28	400	3.0E-36
sp\|B0CGT8\|TRPD_BRUSI	Anthranilate phosphoribosyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=trpD PE=3 SV=1	17	409	3.0E-36
sp\|Q8U089\|TRPD_PYRFU	Anthranilate phosphoribosyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=trpD PE=3 SV=1	50	364	3.0E-36
sp\|B7IM73\|TRPD_BACC2	Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain G9842) GN=trpD PE=3 SV=1	99	409	3.0E-36
sp\|Q0I9N0\|TRPD_SYNS3	Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain CC9311) GN=trpD PE=3 SV=1	38	405	3.0E-36
sp\|A4SFZ6\|TRPD_CHLPM	Anthranilate phosphoribosyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=trpD PE=3 SV=1	30	329	3.0E-36
sp\|Q3B2H3\|TRPD_CHLL7	Anthranilate phosphoribosyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=trpD PE=3 SV=1	19	412	3.0E-36
sp\|B3Q6M8\|TRPD_RHOPT	Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=trpD PE=3 SV=1	16	407	4.0E-36
sp\|C3PKY4\|TRPD_CORA7	Anthranilate phosphoribosyltransferase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=trpD PE=3 SV=1	70	365	4.0E-36
sp\|Q46WU8\|TRPD_CUPPJ	Anthranilate phosphoribosyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=trpD PE=3 SV=1	48	409	4.0E-36
sp\|Q5M347\|TRPD_STRT2	Anthranilate phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=trpD PE=3 SV=1	31	406	4.0E-36
sp\|P22096\|TRPD_VIBPA	Anthranilate phosphoribosyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpD PE=3 SV=1	110	403	5.0E-36
sp\|B3Q0L2\|TRPD_RHIE6	Anthranilate phosphoribosyltransferase OS=Rhizobium etli (strain CIAT 652) GN=trpD PE=3 SV=1	17	361	5.0E-36
sp\|P94326\|TRPD_BRADU	Anthranilate phosphoribosyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=trpD PE=3 SV=1	17	408	6.0E-36
sp\|B4E7A8\|TRPD_BURCJ	Anthranilate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=trpD PE=3 SV=1	110	410	6.0E-36
sp\|A0LJ59\|TRPD_SYNFM	Anthranilate phosphoribosyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=trpD PE=3 SV=1	10	409	7.0E-36
sp\|B9M5M2\|TRPD_GEODF	Anthranilate phosphoribosyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=trpD PE=3 SV=1	31	408	7.0E-36
sp\|Q5LYI4\|TRPD_STRT1	Anthranilate phosphoribosyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=trpD PE=3 SV=1	31	406	8.0E-36
sp\|A6UW21\|TRPD_META3	Anthranilate phosphoribosyltransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=trpD PE=3 SV=2	50	401	9.0E-36
sp\|C3MCF3\|TRPD_RHISN	Anthranilate phosphoribosyltransferase OS=Rhizobium sp. (strain NGR234) GN=trpD PE=3 SV=1	17	408	9.0E-36
sp\|Q73BR0\|TRPD_BACC1	Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=trpD PE=3 SV=1	99	409	1.0E-35
sp\|C5D3D7\|TRPD_GEOSW	Anthranilate phosphoribosyltransferase OS=Geobacillus sp. (strain WCH70) GN=trpD PE=3 SV=1	105	401	1.0E-35
sp\|Q3SRJ4\|TRPD_NITWN	Anthranilate phosphoribosyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=trpD PE=3 SV=1	17	329	1.0E-35
sp\|P18261\|TRPD_BACPU	Anthranilate phosphoribosyltransferase OS=Bacillus pumilus GN=trpD PE=3 SV=1	110	356	1.0E-35
sp\|Q92PS0\|TRPD_RHIME	Anthranilate phosphoribosyltransferase OS=Rhizobium meliloti (strain 1021) GN=trpD PE=3 SV=1	109	408	1.0E-35
sp\|A7MRZ7\|TRPD_VIBCB	Anthranilate phosphoribosyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=trpD PE=3 SV=1	18	403	1.0E-35
sp\|B9LEV9\|TRPD_CHLSY	Anthranilate phosphoribosyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=trpD PE=3 SV=1	31	407	1.0E-35
sp\|A9WCH7\|TRPD_CHLAA	Anthranilate phosphoribosyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trpD PE=3 SV=1	31	407	1.0E-35
sp\|Q9Z4W9\|TRPD2_STRCO	Anthranilate phosphoribosyltransferase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpD2 PE=3 SV=1	70	354	1.0E-35
sp\|Q65TF2\|TRPD_MANSM	Anthranilate phosphoribosyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=trpD PE=3 SV=1	16	352	2.0E-35
sp\|Q845X9\|TRPD_BURM1	Anthranilate phosphoribosyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=trpD PE=3 SV=1	110	410	2.0E-35
sp\|Q9KST4\|TRPD_VIBCH	Anthranilate phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpD PE=3 SV=2	28	328	2.0E-35
sp\|A5F210\|TRPD_VIBC3	Anthranilate phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=trpD PE=3 SV=1	28	328	2.0E-35
sp\|Q0K6I1\|TRPD_CUPNH	Anthranilate phosphoribosyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=trpD PE=3 SV=2	48	409	2.0E-35
sp\|Q3A6L6\|TRPD_PELCD	Anthranilate phosphoribosyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=trpD PE=3 SV=1	30	408	2.0E-35
sp\|B2JHI7\|TRPD_BURP8	Anthranilate phosphoribosyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=trpD PE=3 SV=1	110	409	2.0E-35
sp\|A1ALX3\|TRPD_PELPD	Anthranilate phosphoribosyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=trpD PE=3 SV=1	18	409	2.0E-35
sp\|Q8UER8\|TRPD_AGRFC	Anthranilate phosphoribosyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=trpD PE=3 SV=1	17	355	3.0E-35
sp\|B1JUU6\|TRPD_BURCC	Anthranilate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=trpD PE=3 SV=1	110	409	3.0E-35
sp\|Q2Y5W9\|TRPD_NITMU	Anthranilate phosphoribosyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=trpD PE=3 SV=1	48	408	3.0E-35
sp\|A5EK24\|TRPD_BRASB	Anthranilate phosphoribosyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=trpD PE=3 SV=1	17	328	3.0E-35
sp\|B5ZPY6\|TRPD_RHILW	Anthranilate phosphoribosyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=trpD PE=3 SV=1	17	361	3.0E-35
sp\|A3CLL8\|TRPD_STRSV	Anthranilate phosphoribosyltransferase OS=Streptococcus sanguinis (strain SK36) GN=trpD PE=3 SV=1	18	403	4.0E-35
sp\|B1GZB9\|TRPD_UNCTG	Anthranilate phosphoribosyltransferase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=trpD PE=3 SV=1	39	329	4.0E-35
sp\|Q5V211\|TRPD_HALMA	Anthranilate phosphoribosyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpD PE=3 SV=1	38	404	5.0E-35
sp\|A6UP19\|TRPD_METVS	Anthranilate phosphoribosyltransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=trpD PE=3 SV=1	50	406	5.0E-35
sp\|Q3IQ38\|TRPD_NATPD	Anthranilate phosphoribosyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=trpD PE=3 SV=1	31	357	5.0E-35
sp\|Q39JZ6\|TRPD_BURL3	Anthranilate phosphoribosyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=trpD PE=3 SV=1	110	410	5.0E-35
sp\|A4SKT3\|TRPD_AERS4	Anthranilate phosphoribosyltransferase OS=Aeromonas salmonicida (strain A449) GN=trpD PE=3 SV=1	105	329	5.0E-35
sp\|A8MDL8\|TRPD_CALMQ	Anthranilate phosphoribosyltransferase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=trpD PE=3 SV=1	18	358	5.0E-35
sp\|B1M5Q2\|TRPD_METRJ	Anthranilate phosphoribosyltransferase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=trpD PE=3 SV=1	32	328	6.0E-35
sp\|B9JFD7\|TRPD_AGRRK	Anthranilate phosphoribosyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=trpD PE=3 SV=1	17	355	6.0E-35
sp\|Q1LIH4\|TRPD_CUPMC	Anthranilate phosphoribosyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=trpD PE=3 SV=2	48	409	6.0E-35
sp\|B3QM44\|TRPD_CHLP8	Anthranilate phosphoribosyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=trpD PE=3 SV=1	19	411	6.0E-35
sp\|Q9PGT6\|TRPD_XYLFA	Anthranilate phosphoribosyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=trpD PE=3 SV=1	45	364	8.0E-35
sp\|A5GES2\|TRPD_GEOUR	Anthranilate phosphoribosyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=trpD PE=3 SV=1	18	409	8.0E-35
sp\|Q084N6\|TRPD_SHEFN	Anthranilate phosphoribosyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=trpD PE=3 SV=1	36	356	8.0E-35
sp\|B1YSF6\|TRPD_BURA4	Anthranilate phosphoribosyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=trpD PE=3 SV=1	110	409	8.0E-35
sp\|P70936\|TRPD_BACMQ	Anthranilate phosphoribosyltransferase OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=trpD PE=3 SV=2	34	401	9.0E-35
sp\|Q63ED0\|TRPD_BACCZ	Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=trpD PE=3 SV=1	99	409	9.0E-35
sp\|Q8PQ48\|TRPD_XANAC	Anthranilate phosphoribosyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=trpD PE=3 SV=1	45	411	1.0E-34
sp\|A0K459\|TRPD_BURCH	Anthranilate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=trpD PE=3 SV=2	110	409	1.0E-34
sp\|Q1BSD3\|TRPD_BURCA	Anthranilate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=trpD PE=3 SV=2	110	409	1.0E-34
sp\|B8EJS2\|TRPD_METSB	Anthranilate phosphoribosyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=trpD PE=3 SV=1	18	328	1.0E-34
sp\|Q02000\|TRPD_LACLA	Anthranilate phosphoribosyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpD PE=3 SV=1	31	359	1.0E-34
sp\|A4FXH2\|TRPD_METM5	Anthranilate phosphoribosyltransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=trpD PE=3 SV=1	50	406	1.0E-34
sp\|Q4FM53\|TRPD_PELUB	Anthranilate phosphoribosyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=trpD PE=3 SV=1	112	351	1.0E-34
sp\|Q1MGE2\|TRPD_RHIL3	Anthranilate phosphoribosyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=trpD PE=3 SV=1	17	355	1.0E-34
sp\|Q2G6R1\|TRPD_NOVAD	Anthranilate phosphoribosyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=trpD PE=3 SV=1	112	396	2.0E-34
sp\|Q3BYB6\|TRPD_XANC5	Anthranilate phosphoribosyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=trpD PE=3 SV=1	45	411	2.0E-34
sp\|Q81GG8\|TRPD_BACCR	Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=trpD PE=3 SV=1	99	409	2.0E-34
sp\|Q6AMS5\|TRPD_DESPS	Anthranilate phosphoribosyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=trpD PE=3 SV=1	30	329	2.0E-34
sp\|Q136D3\|TRPD_RHOPS	Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=trpD PE=3 SV=1	16	328	2.0E-34
sp\|A5N7N7\|TRPD_CLOK5	Anthranilate phosphoribosyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=trpD PE=3 SV=1	31	408	3.0E-34
sp\|B9E148\|TRPD_CLOK1	Anthranilate phosphoribosyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=trpD PE=3 SV=1	31	408	3.0E-34
sp\|Q0BIM7\|TRPD_BURCM	Anthranilate phosphoribosyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=trpD PE=3 SV=1	110	409	3.0E-34
sp\|Q8KC17\|TRPD_CHLTE	Anthranilate phosphoribosyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trpD PE=3 SV=1	19	328	3.0E-34
sp\|A1KAT3\|TRPD_AZOSB	Anthranilate phosphoribosyltransferase OS=Azoarcus sp. (strain BH72) GN=trpD PE=3 SV=1	110	409	4.0E-34
sp\|B7JX56\|TRPD_CYAP8	Anthranilate phosphoribosyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=trpD PE=3 SV=1	110	404	4.0E-34
sp\|B4RBX4\|TRPD_PHEZH	Anthranilate phosphoribosyltransferase OS=Phenylobacterium zucineum (strain HLK1) GN=trpD PE=3 SV=1	112	358	4.0E-34
sp\|A2RK17\|TRPD_LACLM	Anthranilate phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=trpD PE=3 SV=1	31	359	5.0E-34
sp\|C3MV89\|TRPD_SULIM	Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=trpD PE=3 SV=1	16	393	5.0E-34
sp\|C4KH54\|TRPD_SULIK	Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=trpD PE=3 SV=1	16	393	5.0E-34
sp\|A9VJV9\|TRPD_BACWK	Anthranilate phosphoribosyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=trpD PE=3 SV=1	36	409	5.0E-34
sp\|A4YVD5\|TRPD_BRASO	Anthranilate phosphoribosyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=trpD PE=3 SV=2	17	328	5.0E-34
sp\|C3NE52\|TRPD_SULIY	Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=trpD PE=3 SV=1	16	393	5.0E-34
sp\|C3MPW2\|TRPD_SULIL	Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=trpD PE=3 SV=1	16	393	5.0E-34
sp\|A6LU93\|TRPD_CLOB8	Anthranilate phosphoribosyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=trpD PE=3 SV=1	24	403	6.0E-34
sp\|Q7VCJ6\|TRPD_PROMA	Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=trpD PE=3 SV=1	13	352	6.0E-34
sp\|A5GTM6\|TRPD_SYNR3	Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain RCC307) GN=trpD PE=3 SV=1	110	403	6.0E-34
sp\|C3NHL1\|TRPD_SULIN	Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=trpD PE=3 SV=1	16	393	7.0E-34
sp\|B2SL02\|TRPD_XANOP	Anthranilate phosphoribosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=trpD PE=3 SV=1	45	411	8.0E-34
sp\|Q2NYD6\|TRPD_XANOM	Anthranilate phosphoribosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=trpD PE=3 SV=1	45	411	8.0E-34
sp\|B8G5C5\|TRPD_CHLAD	Anthranilate phosphoribosyltransferase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=trpD PE=3 SV=1	31	329	8.0E-34
sp\|C1DHY8\|TRPD_AZOVD	Anthranilate phosphoribosyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=trpD PE=3 SV=1	16	306	8.0E-34
sp\|A9BS05\|TRPD_DELAS	Anthranilate phosphoribosyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=trpD PE=3 SV=1	110	412	8.0E-34
sp\|Q6HLU7\|TRPD_BACHK	Anthranilate phosphoribosyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=trpD PE=3 SV=1	99	409	9.0E-34
sp\|Q5KXU8\|TRPD_GEOKA	Anthranilate phosphoribosyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=trpD PE=3 SV=1	18	401	9.0E-34
sp\|B9IU35\|TRPD_BACCQ	Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain Q1) GN=trpD PE=3 SV=1	99	409	9.0E-34
sp\|B7I0E9\|TRPD_BACC7	Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain AH187) GN=trpD PE=3 SV=1	99	409	9.0E-34
sp\|C1ELE7\|TRPD_BACC3	Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain 03BB102) GN=trpD PE=3 SV=1	99	409	9.0E-34
sp\|B2V751\|TRPD_SULSY	Anthranilate phosphoribosyltransferase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=trpD PE=3 SV=1	112	356	1.0E-33
sp\|A0KMC8\|TRPD_AERHH	Anthranilate phosphoribosyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=trpD PE=3 SV=1	105	328	1.0E-33
sp\|B7JES7\|TRPD_BACC0	Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain AH820) GN=trpD PE=3 SV=1	99	409	1.0E-33
sp\|Q81TM1\|TRPD_BACAN	Anthranilate phosphoribosyltransferase OS=Bacillus anthracis GN=trpD PE=3 SV=1	99	409	1.0E-33
sp\|C3LAW1\|TRPD_BACAC	Anthranilate phosphoribosyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=trpD PE=3 SV=1	99	409	1.0E-33
sp\|C3P3T7\|TRPD_BACAA	Anthranilate phosphoribosyltransferase OS=Bacillus anthracis (strain A0248) GN=trpD PE=3 SV=1	99	409	1.0E-33
sp\|A0RB61\|TRPD_BACAH	Anthranilate phosphoribosyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=trpD PE=3 SV=1	99	409	1.0E-33
sp\|Q1GYF5\|TRPD_METFK	Anthranilate phosphoribosyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=trpD PE=3 SV=1	110	401	1.0E-33
sp\|P00500\|TRPD_ACIAD	Anthranilate phosphoribosyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=trpD PE=1 SV=1	29	407	1.0E-33
sp\|B0U1N9\|TRPD_XYLFM	Anthranilate phosphoribosyltransferase OS=Xylella fastidiosa (strain M12) GN=trpD PE=3 SV=1	107	364	1.0E-33
sp\|Q8TXJ5\|TRPD_METKA	Anthranilate phosphoribosyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=trpD PE=3 SV=1	30	408	1.0E-33
sp\|C3N5I8\|TRPD_SULIA	Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=trpD PE=3 SV=1	16	393	1.0E-33
sp\|A8FEK1\|TRPD_BACP2	Anthranilate phosphoribosyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=trpD PE=3 SV=1	110	356	1.0E-33
sp\|Q02YA8\|TRPD_LACLS	Anthranilate phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=trpD PE=3 SV=1	31	359	1.0E-33
sp\|Q87EX3\|TRPD_XYLFT	Anthranilate phosphoribosyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=trpD PE=3 SV=1	107	364	1.0E-33
sp\|B2I6S4\|TRPD_XYLF2	Anthranilate phosphoribosyltransferase OS=Xylella fastidiosa (strain M23) GN=trpD PE=3 SV=1	107	364	1.0E-33
sp\|Q8PD71\|TRPD_XANCP	Anthranilate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=trpD PE=1 SV=1	36	412	1.0E-33
sp\|Q4UZF9\|TRPD_XANC8	Anthranilate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=trpD PE=3 SV=1	36	412	1.0E-33
sp\|Q1QV38\|TRPD_CHRSD	Anthranilate phosphoribosyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=trpD PE=3 SV=1	44	355	1.0E-33
sp\|A9B9W1\|TRPD_PROM4	Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9211) GN=trpD PE=3 SV=1	110	355	1.0E-33
sp\|Q24SK4\|TRPD_DESHY	Anthranilate phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=trpD PE=3 SV=1	109	343	1.0E-33
sp\|A7H793\|TRPD_ANADF	Anthranilate phosphoribosyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=trpD PE=3 SV=1	18	329	2.0E-33
sp\|Q0A6E7\|TRPD_ALKEH	Anthranilate phosphoribosyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=trpD PE=3 SV=1	24	410	2.0E-33
sp\|C5BPA3\|TRPD_TERTT	Anthranilate phosphoribosyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=trpD PE=3 SV=1	16	329	2.0E-33
sp\|Q11HU2\|TRPD_CHESB	Anthranilate phosphoribosyltransferase OS=Chelativorans sp. (strain BNC1) GN=trpD PE=3 SV=1	17	408	2.0E-33
sp\|P03947\|TRPD_BACSU	Anthranilate phosphoribosyltransferase OS=Bacillus subtilis (strain 168) GN=trpD PE=3 SV=2	109	412	2.0E-33
sp\|P26924\|TRPD_AZOBR	Anthranilate phosphoribosyltransferase OS=Azospirillum brasilense GN=trpD PE=3 SV=1	16	408	3.0E-33
sp\|A9KTR5\|TRPD_SHEB9	Anthranilate phosphoribosyltransferase OS=Shewanella baltica (strain OS195) GN=trpD PE=3 SV=1	18	409	3.0E-33
sp\|Q2SUI1\|TRPD_BURTA	Anthranilate phosphoribosyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=trpD PE=3 SV=1	110	343	3.0E-33
sp\|B2IKP4\|TRPD_BEII9	Anthranilate phosphoribosyltransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=trpD PE=3 SV=1	18	329	3.0E-33
sp\|Q6NEC1\|TRPD_CORDI	Anthranilate phosphoribosyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=trpD PE=3 SV=1	109	327	3.0E-33
sp\|B0RMZ8\|TRPD_XANCB	Anthranilate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=trpD PE=3 SV=1	36	412	4.0E-33
sp\|Q1QMJ8\|TRPD_NITHX	Anthranilate phosphoribosyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=trpD PE=3 SV=1	17	328	4.0E-33
sp\|P50384\|TRPD_SULSO	Anthranilate phosphoribosyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpD PE=1 SV=1	16	348	4.0E-33
sp\|P43858\|TRPD_HAEIN	Anthranilate phosphoribosyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpD PE=3 SV=1	110	329	4.0E-33
sp\|Q3APT3\|TRPD_CHLCH	Anthranilate phosphoribosyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=trpD PE=3 SV=1	112	325	4.0E-33
sp\|Q2RIT6\|TRPD_MOOTA	Anthranilate phosphoribosyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=trpD PE=3 SV=1	36	343	5.0E-33
sp\|Q8G0F5\|TRPD_BRUSU	Anthranilate phosphoribosyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=trpD PE=3 SV=1	17	409	5.0E-33
sp\|A5UT95\|TRPD_ROSS1	Anthranilate phosphoribosyltransferase OS=Roseiflexus sp. (strain RS-1) GN=trpD PE=3 SV=1	31	329	5.0E-33
sp\|Q7TV05\|TRPD_PROMM	Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=trpD PE=3 SV=1	36	387	5.0E-33
sp\|B8GNI1\|TRPD_THISH	Anthranilate phosphoribosyltransferase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=trpD PE=3 SV=1	108	407	5.0E-33
sp\|B8F815\|TRPD_HAEPS	Anthranilate phosphoribosyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=trpD PE=3 SV=1	21	352	6.0E-33
sp\|A1B3Y5\|TRPD_PARDP	Anthranilate phosphoribosyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=trpD PE=3 SV=1	109	309	6.0E-33
sp\|A4TBH5\|TRPD_MYCGI	Anthranilate phosphoribosyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=trpD PE=3 SV=1	34	410	6.0E-33
sp\|A6TM73\|TRPD_ALKMQ	Anthranilate phosphoribosyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=trpD PE=3 SV=2	30	410	7.0E-33
sp\|A9M5F3\|TRPD_BRUC2	Anthranilate phosphoribosyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=trpD PE=3 SV=1	17	409	7.0E-33
sp\|Q112P2\|TRPD_TRIEI	Anthranilate phosphoribosyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=trpD PE=3 SV=1	105	405	7.0E-33
sp\|Q8XS00\|TRPD2_RALSO	Anthranilate phosphoribosyltransferase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=trpD2 PE=3 SV=1	48	355	7.0E-33
sp\|Q3SGS1\|TRPD_THIDA	Anthranilate phosphoribosyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=trpD PE=3 SV=1	107	409	8.0E-33
sp\|A1U6H0\|TRPD_MARHV	Anthranilate phosphoribosyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=trpD PE=3 SV=1	16	310	8.0E-33
sp\|Q8YHF7\|TRPD_BRUME	Anthranilate phosphoribosyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=trpD PE=3 SV=2	17	409	1.0E-32
sp\|C0RJB0\|TRPD_BRUMB	Anthranilate phosphoribosyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=trpD PE=3 SV=1	17	409	1.0E-32
sp\|Q57CZ9\|TRPD_BRUAB	Anthranilate phosphoribosyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=trpD PE=3 SV=1	17	409	1.0E-32
sp\|Q2YRR5\|TRPD_BRUA2	Anthranilate phosphoribosyltransferase OS=Brucella abortus (strain 2308) GN=trpD PE=3 SV=1	17	409	1.0E-32
sp\|B2S5Z0\|TRPD_BRUA1	Anthranilate phosphoribosyltransferase OS=Brucella abortus (strain S19) GN=trpD PE=3 SV=1	17	409	1.0E-32
sp\|A1RIE5\|TRPD_SHESW	Anthranilate phosphoribosyltransferase OS=Shewanella sp. (strain W3-18-1) GN=trpD PE=3 SV=1	18	409	1.0E-32
sp\|Q9X6J5\|TRPD_GEOSE	Anthranilate phosphoribosyltransferase OS=Geobacillus stearothermophilus GN=trpD PE=3 SV=1	18	328	1.0E-32
sp\|A6WPW9\|TRPD_SHEB8	Anthranilate phosphoribosyltransferase OS=Shewanella baltica (strain OS185) GN=trpD PE=3 SV=1	18	409	1.0E-32
sp\|P57856\|TRPD_PASMU	Anthranilate phosphoribosyltransferase OS=Pasteurella multocida (strain Pm70) GN=trpD PE=3 SV=1	110	329	1.0E-32
sp\|Q215B8\|TRPD_RHOPB	Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=trpD PE=3 SV=1	17	411	1.0E-32
sp\|B8FVH5\|TRPD_DESHD	Anthranilate phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=trpD PE=3 SV=1	109	343	1.0E-32
sp\|Q2RT49\|TRPD_RHORT	Anthranilate phosphoribosyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=trpD PE=3 SV=1	17	328	1.0E-32
sp\|Q0B006\|TRPD_SYNWW	Anthranilate phosphoribosyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=trpD PE=3 SV=1	110	409	1.0E-32
sp\|A1BE13\|TRPD_CHLPD	Anthranilate phosphoribosyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=trpD PE=3 SV=1	112	411	1.0E-32
sp\|A2SLH5\|TRPD_METPP	Anthranilate phosphoribosyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=trpD PE=3 SV=1	110	410	2.0E-32
sp\|A5VQR4\|TRPD_BRUO2	Anthranilate phosphoribosyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=trpD PE=3 SV=2	17	409	2.0E-32
sp\|A3D628\|TRPD_SHEB5	Anthranilate phosphoribosyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=trpD PE=3 SV=1	18	409	2.0E-32
sp\|P00905\|TRPGD_SALTY	Bifunctional protein TrpGD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpGD PE=1 SV=4	10	329	2.0E-32
sp\|P00904\|TRPGD_ECOLI	Bifunctional protein TrpGD OS=Escherichia coli (strain K12) GN=trpGD PE=1 SV=3	10	329	2.0E-32
sp\|Q8FLJ8\|TRPD_COREF	Anthranilate phosphoribosyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=trpD PE=3 SV=1	36	369	2.0E-32
sp\|P20574\|TRPD_PSEAE	Anthranilate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpD PE=3 SV=1	16	306	2.0E-32
sp\|Q02TB6\|TRPD_PSEAB	Anthranilate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=trpD PE=3 SV=1	16	306	2.0E-32
sp\|B7V608\|TRPD_PSEA8	Anthranilate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=trpD PE=3 SV=1	16	306	2.0E-32
sp\|Q5F7H5\|TRPD_NEIG1	Anthranilate phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=trpD PE=3 SV=1	29	411	3.0E-32
sp\|Q9A728\|TRPD_CAUCR	Anthranilate phosphoribosyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=trpD PE=3 SV=1	110	408	3.0E-32
sp\|B8GWP8\|TRPD_CAUCN	Anthranilate phosphoribosyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=trpD PE=3 SV=1	110	408	3.0E-32
sp\|Q5ZX98\|TRPD_LEGPH	Anthranilate phosphoribosyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=trpD PE=3 SV=1	18	346	3.0E-32
sp\|Q5X6R9\|TRPD_LEGPA	Anthranilate phosphoribosyltransferase OS=Legionella pneumophila (strain Paris) GN=trpD PE=3 SV=1	18	346	3.0E-32
sp\|A2C1X5\|TRPD_PROM1	Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=trpD PE=3 SV=1	13	405	4.0E-32
sp\|Q02166\|TRPD_ARATH	Anthranilate phosphoribosyltransferase, chloroplastic OS=Arabidopsis thaliana GN=PAT1 PE=2 SV=1	15	329	4.0E-32
sp\|A4Y843\|TRPD_SHEPC	Anthranilate phosphoribosyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=trpD PE=3 SV=1	18	409	5.0E-32
sp\|O27698\|TRPD_METTH	Anthranilate phosphoribosyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpD PE=3 SV=1	99	410	6.0E-32
sp\|A1STT2\|TRPD_PSYIN	Anthranilate phosphoribosyltransferase OS=Psychromonas ingrahamii (strain 37) GN=trpD PE=3 SV=1	17	352	6.0E-32
sp\|Q30VM1\|TRPD_DESAG	Anthranilate phosphoribosyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=trpD PE=3 SV=1	111	343	7.0E-32
sp\|Q6D4U2\|TRPD_PECAS	Anthranilate phosphoribosyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=trpD PE=3 SV=1	16	329	7.0E-32
sp\|A6VU64\|TRPD_MARMS	Anthranilate phosphoribosyltransferase OS=Marinomonas sp. (strain MWYL1) GN=trpD PE=3 SV=1	16	355	8.0E-32
sp\|A4IQ85\|TRPD_GEOTN	Anthranilate phosphoribosyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=trpD PE=3 SV=1	18	401	9.0E-32
sp\|Q5WY74\|TRPD_LEGPL	Anthranilate phosphoribosyltransferase OS=Legionella pneumophila (strain Lens) GN=trpD PE=3 SV=1	14	346	1.0E-31
sp\|Q971Z7\|TRPD_SULTO	Anthranilate phosphoribosyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=trpD PE=3 SV=1	111	355	1.0E-31
sp\|B8DM45\|TRPD_DESVM	Anthranilate phosphoribosyltransferase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=trpD PE=3 SV=1	31	303	1.0E-31
sp\|Q4QKA1\|TRPD_HAEI8	Anthranilate phosphoribosyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=trpD PE=3 SV=1	110	329	1.0E-31
sp\|B6JG28\|TRPD_OLICO	Anthranilate phosphoribosyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=trpD PE=3 SV=1	17	303	1.0E-31
sp\|A6UZF1\|TRPD_PSEA7	Anthranilate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=trpD PE=3 SV=1	16	306	1.0E-31
sp\|A5UEN6\|TRPD_HAEIG	Anthranilate phosphoribosyltransferase OS=Haemophilus influenzae (strain PittGG) GN=trpD PE=3 SV=1	110	329	1.0E-31
sp\|B2UDK8\|TRPD_RALPJ	Anthranilate phosphoribosyltransferase OS=Ralstonia pickettii (strain 12J) GN=trpD PE=3 SV=1	110	412	1.0E-31
sp\|Q12LE4\|TRPD_SHEDO	Anthranilate phosphoribosyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=trpD PE=3 SV=1	43	383	1.0E-31
sp\|Q63QH1\|TRPD_BURPS	Anthranilate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=trpD PE=3 SV=1	95	410	2.0E-31
sp\|A3NDZ2\|TRPD_BURP6	Anthranilate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 668) GN=trpD PE=3 SV=1	95	410	2.0E-31
sp\|Q3JNB1\|TRPD_BURP1	Anthranilate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=trpD PE=3 SV=1	95	410	2.0E-31
sp\|A3NZP5\|TRPD_BURP0	Anthranilate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=trpD PE=3 SV=1	95	410	2.0E-31
sp\|A1UW99\|TRPD_BURMS	Anthranilate phosphoribosyltransferase OS=Burkholderia mallei (strain SAVP1) GN=trpD PE=3 SV=1	95	410	2.0E-31
sp\|Q62DC9\|TRPD_BURMA	Anthranilate phosphoribosyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=trpD PE=3 SV=1	95	410	2.0E-31
sp\|A2RYI2\|TRPD_BURM9	Anthranilate phosphoribosyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=trpD PE=3 SV=1	95	410	2.0E-31
sp\|A3MFQ3\|TRPD_BURM7	Anthranilate phosphoribosyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=trpD PE=3 SV=1	95	410	2.0E-31
sp\|Q13TW5\|TRPD_BURXL	Anthranilate phosphoribosyltransferase OS=Burkholderia xenovorans (strain LB400) GN=trpD PE=3 SV=2	110	410	2.0E-31
sp\|Q47AC6\|TRPD_DECAR	Anthranilate phosphoribosyltransferase OS=Dechloromonas aromatica (strain RCB) GN=trpD PE=3 SV=1	45	411	2.0E-31
sp\|Q2NFE4\|TRPD_METST	Anthranilate phosphoribosyltransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=trpD PE=3 SV=1	18	409	2.0E-31
sp\|Q4J8X7\|TRPD_SULAC	Anthranilate phosphoribosyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=trpD PE=3 SV=1	36	358	2.0E-31
sp\|Q8TLP5\|TRPD_METAC	Anthranilate phosphoribosyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=trpD PE=3 SV=1	110	411	3.0E-31
sp\|A1KTN4\|TRPD_NEIMF	Anthranilate phosphoribosyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=trpD PE=3 SV=1	29	404	3.0E-31
sp\|P66995\|TRPD_NEIMB	Anthranilate phosphoribosyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=trpD PE=3 SV=1	29	404	3.0E-31
sp\|P66994\|TRPD_NEIMA	Anthranilate phosphoribosyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=trpD PE=3 SV=1	29	404	3.0E-31
sp\|A5IG81\|TRPD_LEGPC	Anthranilate phosphoribosyltransferase OS=Legionella pneumophila (strain Corby) GN=trpD PE=3 SV=1	18	346	4.0E-31
sp\|Q46L78\|TRPD_PROMT	Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=trpD PE=3 SV=1	42	359	4.0E-31
sp\|A7I4T7\|TRPD_METB6	Anthranilate phosphoribosyltransferase OS=Methanoregula boonei (strain 6A8) GN=trpD PE=3 SV=1	31	407	4.0E-31
sp\|Q163Y0\|TRPD_ROSDO	Anthranilate phosphoribosyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=trpD PE=3 SV=2	18	329	4.0E-31
sp\|Q2FKX5\|TRPD_METHJ	Anthranilate phosphoribosyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=trpD PE=3 SV=1	31	403	4.0E-31
sp\|Q21SE7\|TRPD_RHOFT	Anthranilate phosphoribosyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=trpD PE=3 SV=1	110	301	4.0E-31
sp\|Q0HK79\|TRPD_SHESM	Anthranilate phosphoribosyltransferase OS=Shewanella sp. (strain MR-4) GN=trpD PE=3 SV=1	16	409	4.0E-31
sp\|A0KVD3\|TRPD_SHESA	Anthranilate phosphoribosyltransferase OS=Shewanella sp. (strain ANA-3) GN=trpD PE=3 SV=1	17	409	5.0E-31
sp\|Q8ESU1\|TRPD_OCEIH	Anthranilate phosphoribosyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=trpD PE=3 SV=1	31	348	5.0E-31
sp\|A9M4G6\|TRPD_NEIM0	Anthranilate phosphoribosyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=trpD PE=3 SV=1	29	404	5.0E-31
sp\|Q8XVE7\|TRPD1_RALSO	Anthranilate phosphoribosyltransferase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=trpD1 PE=3 SV=1	110	409	5.0E-31
sp\|A2BWT1\|TRPD_PROM5	Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9515) GN=trpD PE=3 SV=1	41	353	6.0E-31
sp\|Q3M4T0\|TRPD_ANAVT	Anthranilate phosphoribosyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=trpD PE=3 SV=1	36	329	6.0E-31
sp\|A3PHK8\|TRPD_RHOS1	Anthranilate phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=trpD PE=3 SV=1	44	328	6.0E-31
sp\|A3QF71\|TRPD_SHELP	Anthranilate phosphoribosyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=trpD PE=3 SV=1	22	356	7.0E-31
sp\|A5WFZ6\|TRPD_PSYWF	Anthranilate phosphoribosyltransferase OS=Psychrobacter sp. (strain PRwf-1) GN=trpD PE=3 SV=1	75	407	8.0E-31
sp\|A0JX18\|TRPD_ARTS2	Anthranilate phosphoribosyltransferase OS=Arthrobacter sp. (strain FB24) GN=trpD PE=3 SV=1	40	407	9.0E-31
sp\|Q9ZFA8\|TRPD_RHOS4	Anthranilate phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=trpD PE=3 SV=1	44	328	9.0E-31
sp\|A7NL64\|TRPD_ROSCS	Anthranilate phosphoribosyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=trpD PE=3 SV=1	44	329	1.0E-30
sp\|C0ZCE2\|TRPD_BREBN	Anthranilate phosphoribosyltransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=trpD PE=3 SV=1	39	351	1.0E-30
sp\|Q98ME4\|TRPD_RHILO	Anthranilate phosphoribosyltransferase OS=Rhizobium loti (strain MAFF303099) GN=trpD PE=3 SV=1	36	408	1.0E-30
sp\|Q0HWI1\|TRPD_SHESR	Anthranilate phosphoribosyltransferase OS=Shewanella sp. (strain MR-7) GN=trpD PE=3 SV=1	16	409	1.0E-30
sp\|B9MKD0\|TRPD_CALBD	Anthranilate phosphoribosyltransferase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=trpD PE=3 SV=1	112	401	1.0E-30
sp\|A4WX68\|TRPD_RHOS5	Anthranilate phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=trpD PE=3 SV=1	40	328	1.0E-30
sp\|A4XLM7\|TRPD_CALS8	Anthranilate phosphoribosyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=trpD PE=3 SV=1	111	331	1.0E-30
sp\|A5UBZ6\|TRPD_HAEIE	Anthranilate phosphoribosyltransferase OS=Haemophilus influenzae (strain PittEE) GN=trpD PE=3 SV=1	110	329	1.0E-30
sp\|Q66AK2\|TRPD_YERPS	Anthranilate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=trpD PE=3 SV=1	110	329	2.0E-30
sp\|A4TJ65\|TRPD_YERPP	Anthranilate phosphoribosyltransferase OS=Yersinia pestis (strain Pestoides F) GN=trpD PE=3 SV=1	110	329	2.0E-30
sp\|Q1CJ26\|TRPD_YERPN	Anthranilate phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=trpD PE=3 SV=1	110	329	2.0E-30
sp\|B2K3W4\|TRPD_YERPB	Anthranilate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=trpD PE=3 SV=1	110	329	2.0E-30
sp\|Q1C7P0\|TRPD_YERPA	Anthranilate phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=trpD PE=3 SV=1	110	329	2.0E-30
sp\|Q5P2G2\|TRPD_AROAE	Anthranilate phosphoribosyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=trpD PE=3 SV=1	110	411	2.0E-30
sp\|A8LMJ6\|TRPD_DINSH	Anthranilate phosphoribosyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=trpD PE=3 SV=1	109	329	2.0E-30
sp\|A6X0L1\|TRPD_OCHA4	Anthranilate phosphoribosyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=trpD PE=3 SV=1	17	412	2.0E-30
sp\|B1JKS0\|TRPD_YERPY	Anthranilate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=trpD PE=3 SV=1	110	329	2.0E-30
sp\|A1WH74\|TRPD_VEREI	Anthranilate phosphoribosyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=trpD PE=3 SV=2	107	301	2.0E-30
sp\|Q0VMX5\|TRPD_ALCBS	Anthranilate phosphoribosyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=trpD PE=3 SV=1	29	395	2.0E-30
sp\|Q8ZEG7\|TRPD_YERPE	Anthranilate phosphoribosyltransferase OS=Yersinia pestis GN=trpD PE=3 SV=1	110	329	2.0E-30
sp\|A7FI31\|TRPD_YERP3	Anthranilate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=trpD PE=3 SV=1	110	329	2.0E-30
sp\|Q82AK1\|TRPD_STRAW	Anthranilate phosphoribosyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=trpD PE=3 SV=1	31	408	2.0E-30
sp\|O68608\|TRPD1_STRCO	Anthranilate phosphoribosyltransferase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpD1 PE=3 SV=1	108	408	2.0E-30
sp\|B9KMV1\|TRPD_RHOSK	Anthranilate phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=trpD PE=3 SV=1	44	328	2.0E-30
sp\|Q8YXQ9\|TRPD2_NOSS1	Anthranilate phosphoribosyltransferase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trpD2 PE=1 SV=1	110	329	2.0E-30
sp\|Q5WGS4\|TRPD_BACSK	Anthranilate phosphoribosyltransferase OS=Bacillus clausii (strain KSM-K16) GN=trpD PE=3 SV=1	36	329	2.0E-30
sp\|Q3J897\|TRPD_NITOC	Anthranilate phosphoribosyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=trpD PE=3 SV=1	16	408	2.0E-30
sp\|Q4JWC7\|TRPD_CORJK	Anthranilate phosphoribosyltransferase OS=Corynebacterium jeikeium (strain K411) GN=trpD PE=3 SV=1	111	404	2.0E-30
sp\|Q1GUW8\|TRPD_SPHAL	Anthranilate phosphoribosyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=trpD PE=3 SV=1	32	329	3.0E-30
sp\|B5ERI3\|TRPD_ACIF5	Anthranilate phosphoribosyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=trpD PE=3 SV=1	110	409	3.0E-30
sp\|B7JBC1\|TRPD_ACIF2	Anthranilate phosphoribosyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=trpD PE=3 SV=1	110	409	3.0E-30
sp\|P73617\|TRPD_SYNY3	Anthranilate phosphoribosyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trpD PE=3 SV=1	110	329	3.0E-30
sp\|A1SLE8\|TRPD_NOCSJ	Anthranilate phosphoribosyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=trpD PE=3 SV=1	26	350	3.0E-30
sp\|B2VKT4\|TRPD_ERWT9	Anthranilate phosphoribosyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=trpD PE=3 SV=1	21	405	3.0E-30
sp\|Q021N5\|TRPD_SOLUE	Anthranilate phosphoribosyltransferase OS=Solibacter usitatus (strain Ellin6076) GN=trpD PE=3 SV=1	40	301	3.0E-30
sp\|Q2S1Z6\|TRPD_SALRD	Anthranilate phosphoribosyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=trpD PE=3 SV=1	22	351	4.0E-30
sp\|A7HXZ5\|TRPD_PARL1	Anthranilate phosphoribosyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=trpD PE=3 SV=1	142	408	4.0E-30
sp\|Q7TTV4\|TRPD_SYNPX	Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain WH8102) GN=trpD PE=3 SV=1	110	353	4.0E-30
sp\|A3CRK8\|TRPD_METMJ	Anthranilate phosphoribosyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=trpD PE=3 SV=1	108	365	4.0E-30
sp\|Q2S999\|TRPD_HAHCH	Anthranilate phosphoribosyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=trpD PE=3 SV=1	16	401	4.0E-30
sp\|Q465F3\|TRPD_METBF	Anthranilate phosphoribosyltransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=trpD PE=3 SV=1	31	366	5.0E-30
sp\|C1D7P3\|TRPD_LARHH	Anthranilate phosphoribosyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=trpD PE=3 SV=1	36	412	5.0E-30
sp\|A1TJQ1\|TRPD_ACIAC	Anthranilate phosphoribosyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=trpD PE=3 SV=1	110	412	7.0E-30
sp\|Q8YZP8\|TRPD1_NOSS1	Anthranilate phosphoribosyltransferase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trpD1 PE=3 SV=1	110	405	1.0E-29
sp\|A8GF80\|TRPD_SERP5	Anthranilate phosphoribosyltransferase OS=Serratia proteamaculans (strain 568) GN=trpD PE=3 SV=1	110	329	1.0E-29
sp\|C6DGZ7\|TRPD_PECCP	Anthranilate phosphoribosyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=trpD PE=3 SV=1	16	329	1.0E-29
sp\|Q21MR4\|TRPD_SACD2	Anthranilate phosphoribosyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=trpD PE=3 SV=1	31	407	1.0E-29
sp\|B4EWH5\|TRPD_PROMH	Anthranilate phosphoribosyltransferase OS=Proteus mirabilis (strain HI4320) GN=trpD PE=3 SV=1	41	329	1.0E-29
sp\|A7Z619\|TRPD_BACMF	Anthranilate phosphoribosyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=trpD PE=3 SV=1	101	412	2.0E-29
sp\|Q1IZP8\|TRPD_DEIGD	Anthranilate phosphoribosyltransferase OS=Deinococcus geothermalis (strain DSM 11300) GN=trpD PE=3 SV=1	110	412	2.0E-29
sp\|Q2W3A9\|TRPD_MAGSA	Anthranilate phosphoribosyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=trpD PE=3 SV=1	109	329	2.0E-29
sp\|P30525\|TRPD_BACCA	Anthranilate phosphoribosyltransferase (Fragment) OS=Bacillus caldotenax GN=trpD PE=3 SV=1	18	282	2.0E-29
sp\|Q8PT97\|TRPD_METMA	Anthranilate phosphoribosyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=trpD PE=3 SV=1	110	366	2.0E-29
sp\|A0R048\|TRPD_MYCS2	Anthranilate phosphoribosyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=trpD PE=1 SV=1	35	396	2.0E-29
sp\|B9JX63\|TRPD_AGRVS	Anthranilate phosphoribosyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=trpD PE=3 SV=1	18	408	2.0E-29
sp\|Q49XH5\|TRPD_STAS1	Anthranilate phosphoribosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trpD PE=3 SV=1	16	358	2.0E-29
sp\|A0Q8R1\|TRPD_FRATN	Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=trpD PE=3 SV=1	16	409	2.0E-29
sp\|Q8ECV2\|TRPD_SHEON	Anthranilate phosphoribosyltransferase OS=Shewanella oneidensis (strain MR-1) GN=trpD PE=3 SV=1	17	409	3.0E-29
sp\|P52562\|TRPD_HALVD	Anthranilate phosphoribosyltransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=trpD PE=3 SV=2	50	403	3.0E-29
sp\|A2STA7\|TRPD_METLZ	Anthranilate phosphoribosyltransferase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=trpD PE=3 SV=1	29	404	4.0E-29
sp\|Q0APU5\|TRPD_MARMM	Anthranilate phosphoribosyltransferase OS=Maricaulis maris (strain MCS10) GN=trpD PE=3 SV=1	109	354	4.0E-29
sp\|Q28R66\|TRPD_JANSC	Anthranilate phosphoribosyltransferase OS=Jannaschia sp. (strain CCS1) GN=trpD PE=3 SV=1	109	328	4.0E-29
sp\|P59415\|TRPD_BUCBP	Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trpD PE=3 SV=1	112	359	5.0E-29
sp\|A5CXR3\|TRPD_VESOH	Anthranilate phosphoribosyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=trpD PE=3 SV=1	31	404	5.0E-29
sp\|Q7TU90\|TRPD_PROMP	Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=trpD PE=3 SV=1	31	353	6.0E-29
sp\|Q04ZD2\|TRPD_LEPBL	Anthranilate phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=trpD PE=3 SV=1	32	329	6.0E-29
sp\|Q04R23\|TRPD_LEPBJ	Anthranilate phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=trpD PE=3 SV=1	32	329	6.0E-29
sp\|A1TB00\|TRPD_MYCVP	Anthranilate phosphoribosyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=trpD PE=3 SV=1	34	410	6.0E-29
sp\|B0TWF2\|TRPD_FRAP2	Anthranilate phosphoribosyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=trpD PE=3 SV=1	16	329	6.0E-29
sp\|A9F0C1\|TRPD_SORC5	Anthranilate phosphoribosyltransferase OS=Sorangium cellulosum (strain So ce56) GN=trpD PE=3 SV=1	112	409	6.0E-29
sp\|A4FAC5\|TRPD_SACEN	Anthranilate phosphoribosyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=trpD PE=3 SV=1	29	329	6.0E-29
sp\|Q4K502\|TRPD_PSEF5	Anthranilate phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=trpD PE=3 SV=1	16	306	6.0E-29
sp\|Q0BTY4\|TRPD_GRABC	Anthranilate phosphoribosyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=trpD PE=3 SV=1	16	410	6.0E-29
sp\|Q5YZ21\|TRPD_NOCFA	Anthranilate phosphoribosyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=trpD PE=3 SV=1	31	349	7.0E-29
sp\|C3K308\|TRPD_PSEFS	Anthranilate phosphoribosyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=trpD PE=3 SV=1	16	348	8.0E-29
sp\|A1R6T5\|TRPD_ARTAT	Anthranilate phosphoribosyltransferase OS=Arthrobacter aurescens (strain TC1) GN=trpD PE=3 SV=1	20	403	1.0E-28
sp\|Q5N0L1\|TRPD_SYNP6	Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=trpD PE=3 SV=1	105	329	1.0E-28
sp\|Q31J09\|TRPD_THICR	Anthranilate phosphoribosyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=trpD PE=3 SV=1	44	411	1.0E-28
sp\|B8DZP4\|TRPD_DICTD	Anthranilate phosphoribosyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=trpD PE=3 SV=1	48	355	1.0E-28
sp\|A2BQY1\|TRPD_PROMS	Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain AS9601) GN=trpD PE=3 SV=1	110	400	1.0E-28
sp\|Q7N488\|TRPD_PHOLL	Anthranilate phosphoribosyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=trpD PE=3 SV=1	105	328	1.0E-28
sp\|Q31LB6\|TRPD_SYNE7	Anthranilate phosphoribosyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=trpD PE=3 SV=1	105	405	2.0E-28
sp\|A5D1S5\|TRPD_PELTS	Anthranilate phosphoribosyltransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=trpD PE=3 SV=1	110	411	2.0E-28
sp\|Q8DI76\|TRPD_THEEB	Anthranilate phosphoribosyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=trpD PE=3 SV=1	36	409	2.0E-28
sp\|Q9Y8T2\|TRPD_AERPE	Anthranilate phosphoribosyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=trpD PE=3 SV=1	110	328	2.0E-28
sp\|Q2NA97\|TRPD_ERYLH	Anthranilate phosphoribosyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=trpD PE=3 SV=1	36	328	2.0E-28
sp\|B0SYZ3\|TRPD_CAUSK	Anthranilate phosphoribosyltransferase OS=Caulobacter sp. (strain K31) GN=trpD PE=3 SV=1	110	408	2.0E-28
sp\|Q0BJW6\|TRPD_FRATO	Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=trpD PE=3 SV=2	16	409	2.0E-28
sp\|A7NF00\|TRPD_FRATF	Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=trpD PE=3 SV=2	16	409	3.0E-28
sp\|Q72PD0\|TRPD_LEPIC	Anthranilate phosphoribosyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=trpD PE=3 SV=1	41	269	3.0E-28
sp\|Q8F708\|TRPD_LEPIN	Anthranilate phosphoribosyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=trpD PE=3 SV=1	41	269	3.0E-28
sp\|Q18FI8\|TRPD_HALWD	Anthranilate phosphoribosyltransferase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=trpD PE=3 SV=1	36	403	3.0E-28
sp\|B5YD05\|TRPD_DICT6	Anthranilate phosphoribosyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=trpD PE=3 SV=1	48	353	4.0E-28
sp\|A0PTM6\|TRPD_MYCUA	Anthranilate phosphoribosyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=trpD PE=3 SV=1	20	396	4.0E-28
sp\|B2HGW0\|TRPD_MYCMM	Anthranilate phosphoribosyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=trpD PE=3 SV=1	20	396	4.0E-28
sp\|P57367\|TRPD_BUCAI	Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trpD PE=3 SV=1	110	409	4.0E-28
sp\|B8D972\|TRPD_BUCA5	Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=trpD PE=3 SV=1	110	409	4.0E-28
sp\|B8D7H6\|TRPD_BUCAT	Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=trpD PE=3 SV=1	110	409	5.0E-28
sp\|Q6AFI7\|TRPD_LEIXX	Anthranilate phosphoribosyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=trpD PE=3 SV=1	31	407	6.0E-28
sp\|B1VZR5\|TRPD_STRGG	Anthranilate phosphoribosyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=trpD PE=3 SV=1	31	349	6.0E-28
sp\|A1S7I0\|TRPD_SHEAM	Anthranilate phosphoribosyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=trpD PE=3 SV=1	17	329	6.0E-28
sp\|B2SEF6\|TRPD_FRATM	Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=trpD PE=3 SV=1	16	409	6.0E-28
sp\|Q2NT50\|TRPD_SODGM	Anthranilate phosphoribosyltransferase OS=Sodalis glossinidius (strain morsitans) GN=trpD PE=3 SV=1	110	329	7.0E-28
sp\|A0LTH9\|TRPD_ACIC1	Anthranilate phosphoribosyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=trpD PE=3 SV=1	23	346	7.0E-28
sp\|Q7NGU2\|TRPD_GLOVI	Anthranilate phosphoribosyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=trpD PE=3 SV=1	68	344	9.0E-28
sp\|O28668\|TRPCD_ARCFU	Tryptophan biosynthesis protein TrpCD OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpCD PE=3 SV=1	108	348	9.0E-28
sp\|A8ACG6\|TRPD_IGNH4	Anthranilate phosphoribosyltransferase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=trpD PE=3 SV=1	47	311	1.0E-27
sp\|A4J0E5\|TRPD_FRATW	Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=trpD PE=3 SV=2	16	329	1.0E-27
sp\|Q0SHN1\|TRPD_RHOJR	Anthranilate phosphoribosyltransferase OS=Rhodococcus jostii (strain RHA1) GN=trpD PE=3 SV=1	10	343	2.0E-27
sp\|B8JAL5\|TRPD_ANAD2	Anthranilate phosphoribosyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=trpD PE=3 SV=1	18	329	2.0E-27
sp\|C1AU95\|TRPD_RHOOB	Anthranilate phosphoribosyltransferase OS=Rhodococcus opacus (strain B4) GN=trpD PE=3 SV=1	10	343	2.0E-27
sp\|B8GJ30\|TRPD_METPE	Anthranilate phosphoribosyltransferase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=trpD PE=3 SV=1	38	407	2.0E-27
sp\|A6SUH6\|TRPD_JANMA	Anthranilate phosphoribosyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=trpD PE=3 SV=1	110	301	2.0E-27
sp\|Q4L676\|TRPD_STAHJ	Anthranilate phosphoribosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trpD PE=3 SV=1	22	349	3.0E-27
sp\|P83827\|TRPD_THETH	Anthranilate phosphoribosyltransferase OS=Thermus thermophilus GN=trpD PE=1 SV=1	106	329	3.0E-27
sp\|Q5SH88\|TRPD_THET8	Anthranilate phosphoribosyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=trpD PE=1 SV=1	106	329	3.0E-27
sp\|Q72HJ6\|TRPD_THET2	Anthranilate phosphoribosyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=trpD PE=3 SV=1	106	329	3.0E-27
sp\|B1I3Z8\|TRPD_DESAP	Anthranilate phosphoribosyltransferase OS=Desulforudis audaxviator (strain MP104C) GN=trpD PE=3 SV=1	18	328	3.0E-27
sp\|P26925\|TRPD_METTM	Anthranilate phosphoribosyltransferase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=trpD PE=3 SV=1	36	410	4.0E-27
sp\|O68426\|TRPD_BUCDN	Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Diuraphis noxia GN=trpD PE=3 SV=1	110	352	5.0E-27
sp\|Q822W6\|TRPD_CHLCV	Anthranilate phosphoribosyltransferase OS=Chlamydophila caviae (strain GPIC) GN=trpD PE=3 SV=1	68	403	6.0E-27
sp\|A4X9Z2\|TRPD_SALTO	Anthranilate phosphoribosyltransferase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=trpD PE=3 SV=1	36	410	7.0E-27
sp\|B4UHD1\|TRPD_ANASK	Anthranilate phosphoribosyltransferase OS=Anaeromyxobacter sp. (strain K) GN=trpD PE=3 SV=1	18	329	8.0E-27
sp\|B1Y7I3\|TRPD_LEPCP	Anthranilate phosphoribosyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=trpD PE=3 SV=1	107	408	8.0E-27
sp\|A3PCQ4\|TRPD_PROM0	Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9301) GN=trpD PE=3 SV=1	110	400	9.0E-27
sp\|A8G4M3\|TRPD_PROM2	Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9215) GN=trpD PE=3 SV=1	110	409	1.0E-26
sp\|Q2IGV6\|TRPD_ANADE	Anthranilate phosphoribosyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=trpD PE=3 SV=1	18	329	1.0E-26
sp\|Q47R55\|TRPD_THEFY	Anthranilate phosphoribosyltransferase OS=Thermobifida fusca (strain YX) GN=trpD PE=3 SV=1	40	301	1.0E-26
sp\|Q31B38\|TRPD_PROM9	Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9312) GN=trpD PE=3 SV=1	41	400	1.0E-26
sp\|Q7NW17\|TRPD_CHRVO	Anthranilate phosphoribosyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=trpD PE=3 SV=1	36	410	1.0E-26
sp\|Q5LRH8\|TRPD_RUEPO	Anthranilate phosphoribosyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=trpD PE=3 SV=1	36	328	2.0E-26
sp\|A4YHE2\|TRPD_METS5	Anthranilate phosphoribosyltransferase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=trpD PE=3 SV=1	125	354	2.0E-26
sp\|Q73YM4\|TRPD_MYCPA	Anthranilate phosphoribosyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=trpD PE=3 SV=1	12	396	2.0E-26
sp\|P66998\|TRPD_STAAW	Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=trpD PE=3 SV=1	106	403	2.0E-26
sp\|Q6G9J0\|TRPD_STAAS	Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=trpD PE=3 SV=1	106	403	2.0E-26
sp\|P66997\|TRPD_STAAN	Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=trpD PE=3 SV=1	106	403	2.0E-26
sp\|P66996\|TRPD_STAAM	Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trpD PE=3 SV=1	106	403	2.0E-26
sp\|A5ISQ1\|TRPD_STAA9	Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain JH9) GN=trpD PE=3 SV=1	106	403	2.0E-26
sp\|A6U1J1\|TRPD_STAA2	Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain JH1) GN=trpD PE=3 SV=1	106	403	2.0E-26

[Show less]

GO

GO Term	Description	Terminal node
GO:0016757	glycosyltransferase activity	Yes
GO:0003674	molecular_function	No
GO:0003824	catalytic activity	No
GO:0016740	transferase activity	No

SignalP

[Help with interpreting these statistics]

SignalP signal predicted	Location (based on Ymax)	D score (significance: > 0.45)
No	1 - 11	0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequence	Sequence
Locus	Download genbank file of locus The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein	>Hirsu2\|7434 MASVPIGSGQDGLPPVDIKPLLTKLWPVNSDVDPGEIAEAISHFFTNQVTEAQTASLLMALHFTGMDLRADVLAR CAHAMMHAAAPIPLDELGAVLEGRARREGDYRGGLCDIVGTGGDSHNTFNISTTSSIIASALLLVSKHGNRASTS KSGSADMVNCMKPRAPVISAVRPDTLAKVYSRTNYSFLFAPVFHTGMRYVAPIRRQLPWRTIFNNLGPLANPVDG VLEARVIGVGRRELGPPFCEALRSAGCRKALIVCGEEELDEISCAGPTLCWMLKEASDGGQVEMEHFKIEPRDFG VGSHPLSQVSPGMEAVENAGILKRILCGELADDDPLVEFVLINTAALFVVSGICEADRSDMGHGDDGQVVTERGP AGQRWKEGVRRAKWAIKSGEAWKQWQAFVDVTNEIAA*
Coding	>Hirsu2\|7434 ATGGCCTCTGTCCCCATCGGCTCCGGGCAGGATGGGCTCCCGCCCGTCGACATCAAGCCATTGTTGACCAAGCTG TGGCCGGTCAACTCGGACGTCGACCCGGGCGAGATTGCCGAGGCCATCTCGCACTTTTTCACCAACCAGGTGACG GAGGCCCAGACGGCCTCGCTGCTGATGGCGCTTCACTTCACCGGCATGGACCTGCGCGCCGACGTCCTGGCCCGG TGTGCGCATGCCATGATGCACGCCGCGGCGCCGATCCCGCTCGACGAGCTCGGCGCCGTCCTCGAGGGCCGGGCC AGGAGGGAAGGCGACTACCGGGGCGGACTGTGCGACATCGTCGGCACCGGCGGCGACTCGCACAACACCTTCAAC ATCAGCACCACGTCCTCCATCATCGCCTCCGCCCTGCTCCTCGTCTCCAAGCACGGGAACAGGGCCAGCACGTCC AAGTCGGGCAGCGCCGACATGGTCAACTGCATGAAGCCGCGGGCGCCCGTCATCAGCGCCGTCAGGCCCGACACG CTGGCCAAGGTGTACTCGCGCACCAACTACAGCTTCCTCTTCGCCCCCGTCTTCCACACGGGCATGCGATACGTG GCCCCCATCCGCCGGCAGCTTCCCTGGCGGACCATCTTCAACAACCTGGGGCCCCTGGCCAACCCGGTCGACGGC GTGCTGGAGGCGCGGGTCATTGGCGTCGGCAGACGGGAGCTGGGGCCGCCCTTTTGCGAGGCGCTCAGGAGCGCC GGCTGCCGCAAGGCGCTGATTGTGTGCGGAGAGGAGGAGCTGGACGAGATCAGCTGCGCGGGCCCGACGCTCTGC TGGATGCTCAAGGAGGCGTCCGACGGCGGCCAGGTCGAGATGGAGCACTTCAAGATCGAGCCCCGTGATTTCGGG GTCGGGTCCCATCCGCTCAGCCAGGTATCGCCCGGGATGGAGGCGGTCGAGAACGCGGGCATCCTGAAGCGCATC CTGTGCGGCGAACTGGCCGACGACGACCCCCTGGTGGAGTTCGTCCTCATCAACACGGCCGCCCTCTTCGTCGTC TCCGGCATCTGCGAAGCGGACCGCAGCGACATGGGGCACGGAGACGACGGACAGGTCGTGACGGAGCGGGGGCCG GCCGGCCAGCGCTGGAAAGAAGGCGTGAGGAGGGCCAAGTGGGCGATCAAGAGCGGCGAGGCCTGGAAACAGTGG CAGGCCTTTGTGGACGTGACCAACGAGATTGCTGCGTAG
Transcript	>Hirsu2\|7434 ATGGCCTCTGTCCCCATCGGCTCCGGGCAGGATGGGCTCCCGCCCGTCGACATCAAGCCATTGTTGACCAAGCTG TGGCCGGTCAACTCGGACGTCGACCCGGGCGAGATTGCCGAGGCCATCTCGCACTTTTTCACCAACCAGGTGACG GAGGCCCAGACGGCCTCGCTGCTGATGGCGCTTCACTTCACCGGCATGGACCTGCGCGCCGACGTCCTGGCCCGG TGTGCGCATGCCATGATGCACGCCGCGGCGCCGATCCCGCTCGACGAGCTCGGCGCCGTCCTCGAGGGCCGGGCC AGGAGGGAAGGCGACTACCGGGGCGGACTGTGCGACATCGTCGGCACCGGCGGCGACTCGCACAACACCTTCAAC ATCAGCACCACGTCCTCCATCATCGCCTCCGCCCTGCTCCTCGTCTCCAAGCACGGGAACAGGGCCAGCACGTCC AAGTCGGGCAGCGCCGACATGGTCAACTGCATGAAGCCGCGGGCGCCCGTCATCAGCGCCGTCAGGCCCGACACG CTGGCCAAGGTGTACTCGCGCACCAACTACAGCTTCCTCTTCGCCCCCGTCTTCCACACGGGCATGCGATACGTG GCCCCCATCCGCCGGCAGCTTCCCTGGCGGACCATCTTCAACAACCTGGGGCCCCTGGCCAACCCGGTCGACGGC GTGCTGGAGGCGCGGGTCATTGGCGTCGGCAGACGGGAGCTGGGGCCGCCCTTTTGCGAGGCGCTCAGGAGCGCC GGCTGCCGCAAGGCGCTGATTGTGTGCGGAGAGGAGGAGCTGGACGAGATCAGCTGCGCGGGCCCGACGCTCTGC TGGATGCTCAAGGAGGCGTCCGACGGCGGCCAGGTCGAGATGGAGCACTTCAAGATCGAGCCCCGTGATTTCGGG GTCGGGTCCCATCCGCTCAGCCAGGTATCGCCCGGGATGGAGGCGGTCGAGAACGCGGGCATCCTGAAGCGCATC CTGTGCGGCGAACTGGCCGACGACGACCCCCTGGTGGAGTTCGTCCTCATCAACACGGCCGCCCTCTTCGTCGTC TCCGGCATCTGCGAAGCGGACCGCAGCGACATGGGGCACGGAGACGACGGACAGGTCGTGACGGAGCGGGGGCCG GCCGGCCAGCGCTGGAAAGAAGGCGTGAGGAGGGCCAAGTGGGCGATCAAGAGCGGCGAGGCCTGGAAACAGTGG CAGGCCTTTGTGGACGTGACCAACGAGATTGCTGCGTAG
Gene	>Hirsu2\|7434 ATGGCCTCTGTCCCCATCGGCTCCGGGCAGGATGGGCTCCCGCCCGTCGACATCAAGCCATTGTTGACCAAGCTG TGGCCGGTCAACTCGGACGTCGACCCGGGCGAGATTGCCGAGGCCATCTCGCACTTTTTCACCAACCAGGTGACG GAGGCCCAGACGGCCTCGCTGCTGATGGCGCTTCACTTCACCGGCATGGACCTGCGCGCCGACGTCCTGGCCCGG TGTGCGCATGCCATGATGCACGCCGCGGCGCCGATCCCGCTCGACGAGCTCGGCGCCGTCCTCGAGGGCCGGGCC AGGAGGGAAGGCGACTACCGGGGCGGACTGGTAAGGCGCCCGGCGGCCGTGCCACGAGTCGGCGACTGTGACTGA TGGGGACTGGCTGGCAGTGCGACATCGTCGGCACCGGCGGCGACTCGCACAACACCTTCAACATCAGCACCACGT CCTCCATCATCGCCTCCGCCCTGCTCCTCGTCTCCAAGCACGGGAACAGGGCCAGCACGTCCAAGTCGGGCAGCG CCGACATGGTCAACTGCATGAAGCCGCGGGCGCCCGTCATCAGCGCCGTCAGGCCCGACACGCTGGCCAAGGTGT ACTCGCGCACCAACTACAGCTTCCTCTTCGCCCCCGTCTTCCACACGGGCATGCGATACGTGGCCCCCATCCGCC GGCAGCTTCCCTGGCGGACCATCTTCAACAACCTGGGGCCCCTGGCCAACCCGGTCGACGGCGTGCTGGAGGCGC GGGTCATTGGCGTCGGCAGACGGGAGCTGGGGCCGCCCTTTTGCGAGGCGCTCAGGAGCGCCGGCTGCCGCAAGG CGCTGATTGTGTGCGGAGAGGAGGAGCTGGACGAGATCAGCTGCGCGGGCCCGACGCTCTGCTGGATGCTCAAGG AGGCGTCCGACGGCGGCCAGGTCGAGATGGAGCACTTCAAGATCGAGCCCCGTGATTTCGGGGTCGGGTCCCATC CGCTCAGCCAGGTATCGCCCGGGATGGAGGCGGTCGAGAACGCGGGCATCCTGAAGCGCATCCTGTGCGGCGAAC TGGCCGACGACGACCCCCTGGTGGAGTTCGTCCTCATCAACACGGCCGCCCTCTTCGTCGTCTCCGGCATCTGCG AAGCGGACCGCAGCGACATGGGGCACGGAGACGACGGACAGGTCGTGACGGAGCGGGGGCCGGCCGGCCAGCGCT GGAAAGAAGGCGTGAGGAGGGCCAAGTGGGCGATCAAGAGCGGCGAGGCCTGGAAACAGTGGCAGGCCTTTGTGG ACGTGACCAACGAGATTGCTGCGTAG

Fungal Genomics

General Properties

PFAM Domains

Swissprot hits

GO

SignalP

Transmembrane Domains

Transcription Factor Class

Expression data

Sequences