Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7434
Gene name
LocationContig_431:12778..14079
Strand+
Gene length (bp)1301
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain 5.7E-59 110 396
PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain 2.4E-13 20 83

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60122|TRPD_SCHPO Anthranilate phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp4 PE=3 SV=1 40 409 3.0E-64
sp|P07285|TRPD_YEAST Anthranilate phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP4 PE=1 SV=1 52 410 5.0E-52
sp|A5UMC1|TRPD_METS3 Anthranilate phosphoribosyltransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=trpD PE=3 SV=1 18 408 5.0E-47
sp|C4Z111|TRPD_EUBE2 Anthranilate phosphoribosyltransferase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=trpD PE=3 SV=1 18 409 1.0E-46
sp|A9BHQ6|TRPD_PETMO Anthranilate phosphoribosyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=trpD PE=3 SV=1 36 408 3.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60122|TRPD_SCHPO Anthranilate phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp4 PE=3 SV=1 40 409 3.0E-64
sp|P07285|TRPD_YEAST Anthranilate phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP4 PE=1 SV=1 52 410 5.0E-52
sp|A5UMC1|TRPD_METS3 Anthranilate phosphoribosyltransferase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=trpD PE=3 SV=1 18 408 5.0E-47
sp|C4Z111|TRPD_EUBE2 Anthranilate phosphoribosyltransferase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=trpD PE=3 SV=1 18 409 1.0E-46
sp|A9BHQ6|TRPD_PETMO Anthranilate phosphoribosyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=trpD PE=3 SV=1 36 408 3.0E-46
sp|B5EBU6|TRPD_GEOBB Anthranilate phosphoribosyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=trpD PE=3 SV=1 31 409 1.0E-44
sp|Q74AH4|TRPD_GEOSL Anthranilate phosphoribosyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=trpD PE=3 SV=1 31 409 2.0E-43
sp|C6DYM5|TRPD_GEOSM Anthranilate phosphoribosyltransferase OS=Geobacter sp. (strain M21) GN=trpD PE=3 SV=1 31 409 3.0E-43
sp|Q39SQ6|TRPD_GEOMG Anthranilate phosphoribosyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=trpD PE=3 SV=1 31 409 3.0E-43
sp|P17170|TRPD_LACCA Anthranilate phosphoribosyltransferase OS=Lactobacillus casei GN=trpD PE=3 SV=1 36 351 6.0E-43
sp|B3W6W9|TRPD_LACCB Anthranilate phosphoribosyltransferase OS=Lactobacillus casei (strain BL23) GN=trpD PE=3 SV=1 18 351 7.0E-43
sp|B1Z9R9|TRPD_METPB Anthranilate phosphoribosyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=trpD PE=3 SV=1 109 408 8.0E-43
sp|Q92B78|TRPD_LISIN Anthranilate phosphoribosyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trpD PE=3 SV=1 21 412 8.0E-43
sp|Q1AU89|TRPD_RUBXD Anthranilate phosphoribosyltransferase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=trpD PE=3 SV=1 109 411 8.0E-43
sp|Q71Z37|TRPD_LISMF Anthranilate phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=trpD PE=3 SV=1 21 412 1.0E-42
sp|C1KVS8|TRPD_LISMC Anthranilate phosphoribosyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=trpD PE=3 SV=1 21 412 1.0E-42
sp|Q1IJR5|TRPD_KORVE Anthranilate phosphoribosyltransferase OS=Koribacter versatilis (strain Ellin345) GN=trpD PE=3 SV=1 39 329 2.0E-42
sp|B8DHB1|TRPD_LISMH Anthranilate phosphoribosyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=trpD PE=3 SV=1 21 412 3.0E-42
sp|Q03CY0|TRPD_LACC3 Anthranilate phosphoribosyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=trpD PE=3 SV=1 18 351 5.0E-42
sp|A9W900|TRPD_METEP Anthranilate phosphoribosyltransferase OS=Methylobacterium extorquens (strain PA1) GN=trpD PE=3 SV=1 109 408 8.0E-42
sp|B3E5V8|TRPD_GEOLS Anthranilate phosphoribosyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=trpD PE=3 SV=1 31 408 8.0E-42
sp|B1XSZ2|TRPD_POLNS Anthranilate phosphoribosyltransferase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=trpD PE=3 SV=1 105 408 9.0E-42
sp|Q8Y6Q3|TRPD_LISMO Anthranilate phosphoribosyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trpD PE=3 SV=1 21 412 1.0E-41
sp|A4J146|TRPD_DESRM Anthranilate phosphoribosyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=trpD PE=3 SV=1 31 410 2.0E-41
sp|B7KUV9|TRPD_METC4 Anthranilate phosphoribosyltransferase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=trpD PE=3 SV=1 109 408 2.0E-41
sp|A7INK3|TRPD_XANP2 Anthranilate phosphoribosyltransferase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=trpD PE=3 SV=1 17 411 2.0E-41
sp|A4VHK0|TRPD_PSEU5 Anthranilate phosphoribosyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=trpD PE=3 SV=1 16 306 2.0E-41
sp|A9B148|TRPD_HERA2 Anthranilate phosphoribosyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=trpD PE=3 SV=1 30 408 2.0E-41
sp|A0AJ83|TRPD_LISW6 Anthranilate phosphoribosyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=trpD PE=3 SV=1 18 410 3.0E-41
sp|B3QUY6|TRPD_CHLT3 Anthranilate phosphoribosyltransferase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=trpD PE=3 SV=1 36 405 6.0E-41
sp|Q88WI3|TRPD_LACPL Anthranilate phosphoribosyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=trpD PE=3 SV=1 39 329 2.0E-40
sp|Q5QX82|TRPD_IDILO Anthranilate phosphoribosyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=trpD PE=3 SV=1 110 368 2.0E-40
sp|B2FKL2|TRPD_STRMK Anthranilate phosphoribosyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=trpD PE=3 SV=1 45 412 2.0E-40
sp|B4SE13|TRPD_PELPB Anthranilate phosphoribosyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=trpD PE=3 SV=1 19 411 3.0E-40
sp|O66576|TRPD_AQUAE Anthranilate phosphoribosyltransferase OS=Aquifex aeolicus (strain VF5) GN=trpD PE=3 SV=1 110 410 5.0E-40
sp|Q15RZ7|TRPD_PSEA6 Anthranilate phosphoribosyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=trpD PE=3 SV=1 20 329 6.0E-40
sp|A1W2Z7|TRPD_ACISJ Anthranilate phosphoribosyltransferase OS=Acidovorax sp. (strain JS42) GN=trpD PE=3 SV=1 110 412 7.0E-40
sp|B9MBS3|TRPD_ACIET Anthranilate phosphoribosyltransferase OS=Acidovorax ebreus (strain TPSY) GN=trpD PE=3 SV=1 110 412 7.0E-40
sp|Q4ZML2|TRPD_PSEU2 Anthranilate phosphoribosyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=trpD PE=3 SV=1 15 306 8.0E-40
sp|B0U7Z5|TRPD_METS4 Anthranilate phosphoribosyltransferase OS=Methylobacterium sp. (strain 4-46) GN=trpD PE=3 SV=1 18 408 1.0E-39
sp|B8I0U9|TRPD_CLOCE Anthranilate phosphoribosyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=trpD PE=3 SV=1 31 408 1.0E-39
sp|Q97EF2|TRPD_CLOAB Anthranilate phosphoribosyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=trpD PE=3 SV=1 47 404 2.0E-39
sp|C0QR68|TRPD_PERMH Anthranilate phosphoribosyltransferase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=trpD PE=3 SV=1 18 403 3.0E-39
sp|Q47YC2|TRPD_COLP3 Anthranilate phosphoribosyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=trpD PE=3 SV=1 32 356 3.0E-39
sp|A5GKM1|TRPD_SYNPW Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain WH7803) GN=trpD PE=3 SV=1 36 403 4.0E-39
sp|Q3ZZ15|TRPD_DEHMC Anthranilate phosphoribosyltransferase OS=Dehalococcoides mccartyi (strain CBDB1) GN=trpD PE=3 SV=1 110 412 4.0E-39
sp|Q3Z6G6|TRPD_DEHM1 Anthranilate phosphoribosyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=trpD PE=3 SV=1 110 412 4.0E-39
sp|C1CT54|TRPD_STRZT Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=trpD PE=3 SV=1 36 401 5.0E-39
sp|B8ZN62|TRPD_STRPJ Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=trpD PE=3 SV=1 36 401 5.0E-39
sp|C1CG45|TRPD_STRZJ Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=trpD PE=3 SV=1 36 401 5.0E-39
sp|P67000|TRPD_STRR6 Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=trpD PE=3 SV=1 36 401 5.0E-39
sp|B2ISS4|TRPD_STRPS Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=trpD PE=3 SV=1 36 401 5.0E-39
sp|P66999|TRPD_STRPN Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=trpD PE=3 SV=1 36 401 5.0E-39
sp|B1I7T0|TRPD_STRPI Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=trpD PE=3 SV=1 36 401 5.0E-39
sp|C1C969|TRPD_STRP7 Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=trpD PE=3 SV=1 36 401 5.0E-39
sp|Q04IY6|TRPD_STRP2 Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=trpD PE=3 SV=1 36 401 5.0E-39
sp|Q0C1A1|TRPD_HYPNA Anthranilate phosphoribosyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=trpD PE=3 SV=1 93 409 6.0E-39
sp|B3GY52|TRPD_ACTP7 Anthranilate phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=trpD PE=3 SV=1 37 352 7.0E-39
sp|A9AAU1|TRPD_METM6 Anthranilate phosphoribosyltransferase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=trpD PE=3 SV=1 50 406 7.0E-39
sp|C1CMD6|TRPD_STRZP Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=trpD PE=3 SV=1 36 401 7.0E-39
sp|B5E7M6|TRPD_STRP4 Anthranilate phosphoribosyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=trpD PE=3 SV=1 36 401 7.0E-39
sp|Q9YGB4|TRPD_THEKO Anthranilate phosphoribosyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpD PE=3 SV=1 99 373 8.0E-39
sp|Q57686|TRPD_METJA Anthranilate phosphoribosyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpD PE=3 SV=1 110 409 8.0E-39
sp|B9KXB8|TRPD_THERP Anthranilate phosphoribosyltransferase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=trpD PE=3 SV=1 32 328 8.0E-39
sp|Q3AXD5|TRPD_SYNS9 Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain CC9902) GN=trpD PE=3 SV=1 31 401 9.0E-39
sp|A5VXL4|TRPD_PSEP1 Anthranilate phosphoribosyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=trpD PE=3 SV=1 16 401 1.0E-38
sp|P20575|TRPD_PSEPU Anthranilate phosphoribosyltransferase OS=Pseudomonas putida GN=trpD PE=3 SV=1 16 318 2.0E-38
sp|Q88QR7|TRPD_PSEPK Anthranilate phosphoribosyltransferase OS=Pseudomonas putida (strain KT2440) GN=trpD PE=3 SV=1 16 401 2.0E-38
sp|A3DDS8|TRPD_CLOTH Anthranilate phosphoribosyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=trpD PE=3 SV=1 18 408 2.0E-38
sp|Q2IWB1|TRPD_RHOP2 Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=trpD PE=3 SV=2 16 407 3.0E-38
sp|B0K2U2|TRPD_THEPX Anthranilate phosphoribosyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=trpD PE=3 SV=1 122 405 3.0E-38
sp|B0K8T3|TRPD_THEP3 Anthranilate phosphoribosyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=trpD PE=3 SV=1 122 405 3.0E-38
sp|A3N1G7|TRPD_ACTP2 Anthranilate phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=trpD PE=3 SV=1 37 401 4.0E-38
sp|A9KL44|TRPD_CLOPH Anthranilate phosphoribosyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=trpD PE=3 SV=1 112 408 4.0E-38
sp|Q48NP8|TRPD_PSE14 Anthranilate phosphoribosyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=trpD PE=3 SV=1 16 306 5.0E-38
sp|Q03WZ9|TRPD_LEUMM Anthranilate phosphoribosyltransferase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=trpD PE=3 SV=1 111 349 6.0E-38
sp|B3EMT4|TRPD_CHLPB Anthranilate phosphoribosyltransferase OS=Chlorobium phaeobacteroides (strain BS1) GN=trpD PE=3 SV=1 19 411 7.0E-38
sp|Q8DVF6|TRPD_STRMU Anthranilate phosphoribosyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=trpD PE=3 SV=1 18 403 7.0E-38
sp|B4S5K5|TRPD_PROA2 Anthranilate phosphoribosyltransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=trpD PE=3 SV=1 29 411 8.0E-38
sp|C4LC91|TRPD_TOLAT Anthranilate phosphoribosyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=trpD PE=3 SV=1 105 355 9.0E-38
sp|C4ZI69|TRPD_EUBR3 Anthranilate phosphoribosyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=trpD PE=3 SV=1 18 408 1.0E-37
sp|B3EH38|TRPD_CHLL2 Anthranilate phosphoribosyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=trpD PE=3 SV=1 112 412 1.0E-37
sp|A8AW02|TRPD_STRGC Anthranilate phosphoribosyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=trpD PE=3 SV=1 18 403 1.0E-37
sp|Q8D8B4|TRPD_VIBVU Anthranilate phosphoribosyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=trpD PE=3 SV=1 28 329 2.0E-37
sp|Q7MM54|TRPD_VIBVY Anthranilate phosphoribosyltransferase OS=Vibrio vulnificus (strain YJ016) GN=trpD PE=3 SV=2 18 329 2.0E-37
sp|Q07NF5|TRPD_RHOP5 Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=trpD PE=3 SV=1 16 352 2.0E-37
sp|B0BQA6|TRPD_ACTPJ Anthranilate phosphoribosyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=trpD PE=3 SV=1 37 352 2.0E-37
sp|A4SV53|TRPD_POLSQ Anthranilate phosphoribosyltransferase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=trpD PE=3 SV=1 105 354 2.0E-37
sp|Q82Y74|TRPD_NITEU Anthranilate phosphoribosyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=trpD PE=3 SV=1 110 412 2.0E-37
sp|P06559|TRPD_CORGL Anthranilate phosphoribosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=trpD PE=3 SV=3 109 328 2.0E-37
sp|A4QI74|TRPD_CORGB Anthranilate phosphoribosyltransferase OS=Corynebacterium glutamicum (strain R) GN=trpD PE=3 SV=1 109 328 2.0E-37
sp|B0KJB2|TRPD_PSEPG Anthranilate phosphoribosyltransferase OS=Pseudomonas putida (strain GB-1) GN=trpD PE=3 SV=1 16 306 3.0E-37
sp|B7HGZ8|TRPD_BACC4 Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain B4264) GN=trpD PE=3 SV=1 99 409 3.0E-37
sp|Q1IG00|TRPD_PSEE4 Anthranilate phosphoribosyltransferase OS=Pseudomonas entomophila (strain L48) GN=trpD PE=3 SV=1 16 306 3.0E-37
sp|Q88A04|TRPD_PSESM Anthranilate phosphoribosyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=trpD PE=3 SV=1 16 306 3.0E-37
sp|A8ZZX1|TRPD_DESOH Anthranilate phosphoribosyltransferase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=trpD PE=3 SV=1 31 407 3.0E-37
sp|Q9V1G4|TRPD_PYRAB Anthranilate phosphoribosyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trpD PE=3 SV=1 108 358 4.0E-37
sp|B3PLP1|TRPD_CELJU Anthranilate phosphoribosyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=trpD PE=3 SV=1 16 354 4.0E-37
sp|A8I839|TRPD_AZOC5 Anthranilate phosphoribosyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=trpD PE=3 SV=1 18 411 4.0E-37
sp|B4SLE9|TRPD_STRM5 Anthranilate phosphoribosyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=trpD PE=3 SV=1 110 412 5.0E-37
sp|Q9KCB3|TRPD_BACHD Anthranilate phosphoribosyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=trpD PE=3 SV=1 110 360 5.0E-37
sp|B1JE35|TRPD_PSEPW Anthranilate phosphoribosyltransferase OS=Pseudomonas putida (strain W619) GN=trpD PE=3 SV=1 16 318 5.0E-37
sp|Q67PJ9|TRPD_SYMTH Anthranilate phosphoribosyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=trpD PE=3 SV=1 18 329 5.0E-37
sp|A6VNT3|TRPD_ACTSZ Anthranilate phosphoribosyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=trpD PE=3 SV=1 29 352 5.0E-37
sp|Q6LPA6|TRPD_PHOPR Anthranilate phosphoribosyltransferase OS=Photobacterium profundum GN=trpD PE=3 SV=1 110 332 5.0E-37
sp|Q3K5V3|TRPD_PSEPF Anthranilate phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=trpD PE=3 SV=1 16 310 6.0E-37
sp|A4XZC6|TRPD_PSEMY Anthranilate phosphoribosyltransferase OS=Pseudomonas mendocina (strain ymp) GN=trpD PE=3 SV=1 16 407 7.0E-37
sp|Q2JQ65|TRPD_SYNJB Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=trpD PE=3 SV=1 25 404 8.0E-37
sp|B8IP99|TRPD_METNO Anthranilate phosphoribosyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=trpD PE=3 SV=1 18 328 8.0E-37
sp|B1YLS1|TRPD_EXIS2 Anthranilate phosphoribosyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=trpD PE=3 SV=1 18 401 1.0E-36
sp|Q0AJP9|TRPD_NITEC Anthranilate phosphoribosyltransferase OS=Nitrosomonas eutropha (strain C91) GN=trpD PE=3 SV=1 110 410 1.0E-36
sp|A6U9C4|TRPD_SINMW Anthranilate phosphoribosyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=trpD PE=3 SV=1 17 408 1.0E-36
sp|Q6LYI4|TRPD_METMP Anthranilate phosphoribosyltransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=trpD PE=3 SV=1 50 406 1.0E-36
sp|B0VUS1|TRPD_ACIBS Anthranilate phosphoribosyltransferase OS=Acinetobacter baumannii (strain SDF) GN=trpD PE=3 SV=1 36 355 2.0E-36
sp|Q2K880|TRPD_RHIEC Anthranilate phosphoribosyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=trpD PE=3 SV=1 17 361 2.0E-36
sp|B0VBS2|TRPD_ACIBY Anthranilate phosphoribosyltransferase OS=Acinetobacter baumannii (strain AYE) GN=trpD PE=3 SV=1 36 355 2.0E-36
sp|A3M784|TRPD_ACIBT Anthranilate phosphoribosyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=trpD PE=3 SV=2 36 355 2.0E-36
sp|B0UU36|TRPD_HISS2 Anthranilate phosphoribosyltransferase OS=Histophilus somni (strain 2336) GN=trpD PE=3 SV=1 21 352 2.0E-36
sp|A6VFU3|TRPD_METM7 Anthranilate phosphoribosyltransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=trpD PE=3 SV=1 50 406 2.0E-36
sp|Q6N5T0|TRPD_RHOPA Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=trpD PE=3 SV=1 16 407 2.0E-36
sp|B8FA41|TRPD_DESAA Anthranilate phosphoribosyltransferase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=trpD PE=3 SV=1 110 409 2.0E-36
sp|Q2JWL5|TRPD_SYNJA Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=trpD PE=3 SV=1 39 405 2.0E-36
sp|Q9RTJ5|TRPD_DEIRA Anthranilate phosphoribosyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=trpD PE=3 SV=2 110 408 2.0E-36
sp|Q03JB8|TRPD_STRTD Anthranilate phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=trpD PE=3 SV=1 31 406 2.0E-36
sp|Q123F3|TRPD_POLSJ Anthranilate phosphoribosyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=trpD PE=3 SV=1 110 412 2.0E-36
sp|A1WYT2|TRPD_HALHL Anthranilate phosphoribosyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=trpD PE=3 SV=1 16 411 2.0E-36
sp|Q3ABS0|TRPD_CARHZ Anthranilate phosphoribosyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=trpD PE=3 SV=1 18 353 2.0E-36
sp|A4JB68|TRPD_BURVG Anthranilate phosphoribosyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=trpD PE=3 SV=1 110 410 2.0E-36
sp|Q1GHJ3|TRPD_RUEST Anthranilate phosphoribosyltransferase OS=Ruegeria sp. (strain TM1040) GN=trpD PE=3 SV=1 112 409 3.0E-36
sp|Q3IKY4|TRPD_PSEHT Anthranilate phosphoribosyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=trpD PE=3 SV=1 107 408 3.0E-36
sp|Q8R9M6|TRPD_CALS4 Anthranilate phosphoribosyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=trpD PE=3 SV=1 28 400 3.0E-36
sp|B0CGT8|TRPD_BRUSI Anthranilate phosphoribosyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=trpD PE=3 SV=1 17 409 3.0E-36
sp|Q8U089|TRPD_PYRFU Anthranilate phosphoribosyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=trpD PE=3 SV=1 50 364 3.0E-36
sp|B7IM73|TRPD_BACC2 Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain G9842) GN=trpD PE=3 SV=1 99 409 3.0E-36
sp|Q0I9N0|TRPD_SYNS3 Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain CC9311) GN=trpD PE=3 SV=1 38 405 3.0E-36
sp|A4SFZ6|TRPD_CHLPM Anthranilate phosphoribosyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=trpD PE=3 SV=1 30 329 3.0E-36
sp|Q3B2H3|TRPD_CHLL7 Anthranilate phosphoribosyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=trpD PE=3 SV=1 19 412 3.0E-36
sp|B3Q6M8|TRPD_RHOPT Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=trpD PE=3 SV=1 16 407 4.0E-36
sp|C3PKY4|TRPD_CORA7 Anthranilate phosphoribosyltransferase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=trpD PE=3 SV=1 70 365 4.0E-36
sp|Q46WU8|TRPD_CUPPJ Anthranilate phosphoribosyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=trpD PE=3 SV=1 48 409 4.0E-36
sp|Q5M347|TRPD_STRT2 Anthranilate phosphoribosyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=trpD PE=3 SV=1 31 406 4.0E-36
sp|P22096|TRPD_VIBPA Anthranilate phosphoribosyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpD PE=3 SV=1 110 403 5.0E-36
sp|B3Q0L2|TRPD_RHIE6 Anthranilate phosphoribosyltransferase OS=Rhizobium etli (strain CIAT 652) GN=trpD PE=3 SV=1 17 361 5.0E-36
sp|P94326|TRPD_BRADU Anthranilate phosphoribosyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=trpD PE=3 SV=1 17 408 6.0E-36
sp|B4E7A8|TRPD_BURCJ Anthranilate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=trpD PE=3 SV=1 110 410 6.0E-36
sp|A0LJ59|TRPD_SYNFM Anthranilate phosphoribosyltransferase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=trpD PE=3 SV=1 10 409 7.0E-36
sp|B9M5M2|TRPD_GEODF Anthranilate phosphoribosyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=trpD PE=3 SV=1 31 408 7.0E-36
sp|Q5LYI4|TRPD_STRT1 Anthranilate phosphoribosyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=trpD PE=3 SV=1 31 406 8.0E-36
sp|A6UW21|TRPD_META3 Anthranilate phosphoribosyltransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=trpD PE=3 SV=2 50 401 9.0E-36
sp|C3MCF3|TRPD_RHISN Anthranilate phosphoribosyltransferase OS=Rhizobium sp. (strain NGR234) GN=trpD PE=3 SV=1 17 408 9.0E-36
sp|Q73BR0|TRPD_BACC1 Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=trpD PE=3 SV=1 99 409 1.0E-35
sp|C5D3D7|TRPD_GEOSW Anthranilate phosphoribosyltransferase OS=Geobacillus sp. (strain WCH70) GN=trpD PE=3 SV=1 105 401 1.0E-35
sp|Q3SRJ4|TRPD_NITWN Anthranilate phosphoribosyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=trpD PE=3 SV=1 17 329 1.0E-35
sp|P18261|TRPD_BACPU Anthranilate phosphoribosyltransferase OS=Bacillus pumilus GN=trpD PE=3 SV=1 110 356 1.0E-35
sp|Q92PS0|TRPD_RHIME Anthranilate phosphoribosyltransferase OS=Rhizobium meliloti (strain 1021) GN=trpD PE=3 SV=1 109 408 1.0E-35
sp|A7MRZ7|TRPD_VIBCB Anthranilate phosphoribosyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=trpD PE=3 SV=1 18 403 1.0E-35
sp|B9LEV9|TRPD_CHLSY Anthranilate phosphoribosyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=trpD PE=3 SV=1 31 407 1.0E-35
sp|A9WCH7|TRPD_CHLAA Anthranilate phosphoribosyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trpD PE=3 SV=1 31 407 1.0E-35
sp|Q9Z4W9|TRPD2_STRCO Anthranilate phosphoribosyltransferase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpD2 PE=3 SV=1 70 354 1.0E-35
sp|Q65TF2|TRPD_MANSM Anthranilate phosphoribosyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=trpD PE=3 SV=1 16 352 2.0E-35
sp|Q845X9|TRPD_BURM1 Anthranilate phosphoribosyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=trpD PE=3 SV=1 110 410 2.0E-35
sp|Q9KST4|TRPD_VIBCH Anthranilate phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpD PE=3 SV=2 28 328 2.0E-35
sp|A5F210|TRPD_VIBC3 Anthranilate phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=trpD PE=3 SV=1 28 328 2.0E-35
sp|Q0K6I1|TRPD_CUPNH Anthranilate phosphoribosyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=trpD PE=3 SV=2 48 409 2.0E-35
sp|Q3A6L6|TRPD_PELCD Anthranilate phosphoribosyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=trpD PE=3 SV=1 30 408 2.0E-35
sp|B2JHI7|TRPD_BURP8 Anthranilate phosphoribosyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=trpD PE=3 SV=1 110 409 2.0E-35
sp|A1ALX3|TRPD_PELPD Anthranilate phosphoribosyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=trpD PE=3 SV=1 18 409 2.0E-35
sp|Q8UER8|TRPD_AGRFC Anthranilate phosphoribosyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=trpD PE=3 SV=1 17 355 3.0E-35
sp|B1JUU6|TRPD_BURCC Anthranilate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=trpD PE=3 SV=1 110 409 3.0E-35
sp|Q2Y5W9|TRPD_NITMU Anthranilate phosphoribosyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=trpD PE=3 SV=1 48 408 3.0E-35
sp|A5EK24|TRPD_BRASB Anthranilate phosphoribosyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=trpD PE=3 SV=1 17 328 3.0E-35
sp|B5ZPY6|TRPD_RHILW Anthranilate phosphoribosyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=trpD PE=3 SV=1 17 361 3.0E-35
sp|A3CLL8|TRPD_STRSV Anthranilate phosphoribosyltransferase OS=Streptococcus sanguinis (strain SK36) GN=trpD PE=3 SV=1 18 403 4.0E-35
sp|B1GZB9|TRPD_UNCTG Anthranilate phosphoribosyltransferase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=trpD PE=3 SV=1 39 329 4.0E-35
sp|Q5V211|TRPD_HALMA Anthranilate phosphoribosyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpD PE=3 SV=1 38 404 5.0E-35
sp|A6UP19|TRPD_METVS Anthranilate phosphoribosyltransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=trpD PE=3 SV=1 50 406 5.0E-35
sp|Q3IQ38|TRPD_NATPD Anthranilate phosphoribosyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=trpD PE=3 SV=1 31 357 5.0E-35
sp|Q39JZ6|TRPD_BURL3 Anthranilate phosphoribosyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=trpD PE=3 SV=1 110 410 5.0E-35
sp|A4SKT3|TRPD_AERS4 Anthranilate phosphoribosyltransferase OS=Aeromonas salmonicida (strain A449) GN=trpD PE=3 SV=1 105 329 5.0E-35
sp|A8MDL8|TRPD_CALMQ Anthranilate phosphoribosyltransferase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=trpD PE=3 SV=1 18 358 5.0E-35
sp|B1M5Q2|TRPD_METRJ Anthranilate phosphoribosyltransferase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=trpD PE=3 SV=1 32 328 6.0E-35
sp|B9JFD7|TRPD_AGRRK Anthranilate phosphoribosyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=trpD PE=3 SV=1 17 355 6.0E-35
sp|Q1LIH4|TRPD_CUPMC Anthranilate phosphoribosyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=trpD PE=3 SV=2 48 409 6.0E-35
sp|B3QM44|TRPD_CHLP8 Anthranilate phosphoribosyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=trpD PE=3 SV=1 19 411 6.0E-35
sp|Q9PGT6|TRPD_XYLFA Anthranilate phosphoribosyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=trpD PE=3 SV=1 45 364 8.0E-35
sp|A5GES2|TRPD_GEOUR Anthranilate phosphoribosyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=trpD PE=3 SV=1 18 409 8.0E-35
sp|Q084N6|TRPD_SHEFN Anthranilate phosphoribosyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=trpD PE=3 SV=1 36 356 8.0E-35
sp|B1YSF6|TRPD_BURA4 Anthranilate phosphoribosyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=trpD PE=3 SV=1 110 409 8.0E-35
sp|P70936|TRPD_BACMQ Anthranilate phosphoribosyltransferase OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=trpD PE=3 SV=2 34 401 9.0E-35
sp|Q63ED0|TRPD_BACCZ Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=trpD PE=3 SV=1 99 409 9.0E-35
sp|Q8PQ48|TRPD_XANAC Anthranilate phosphoribosyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=trpD PE=3 SV=1 45 411 1.0E-34
sp|A0K459|TRPD_BURCH Anthranilate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=trpD PE=3 SV=2 110 409 1.0E-34
sp|Q1BSD3|TRPD_BURCA Anthranilate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=trpD PE=3 SV=2 110 409 1.0E-34
sp|B8EJS2|TRPD_METSB Anthranilate phosphoribosyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=trpD PE=3 SV=1 18 328 1.0E-34
sp|Q02000|TRPD_LACLA Anthranilate phosphoribosyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpD PE=3 SV=1 31 359 1.0E-34
sp|A4FXH2|TRPD_METM5 Anthranilate phosphoribosyltransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=trpD PE=3 SV=1 50 406 1.0E-34
sp|Q4FM53|TRPD_PELUB Anthranilate phosphoribosyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=trpD PE=3 SV=1 112 351 1.0E-34
sp|Q1MGE2|TRPD_RHIL3 Anthranilate phosphoribosyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=trpD PE=3 SV=1 17 355 1.0E-34
sp|Q2G6R1|TRPD_NOVAD Anthranilate phosphoribosyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=trpD PE=3 SV=1 112 396 2.0E-34
sp|Q3BYB6|TRPD_XANC5 Anthranilate phosphoribosyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=trpD PE=3 SV=1 45 411 2.0E-34
sp|Q81GG8|TRPD_BACCR Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=trpD PE=3 SV=1 99 409 2.0E-34
sp|Q6AMS5|TRPD_DESPS Anthranilate phosphoribosyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=trpD PE=3 SV=1 30 329 2.0E-34
sp|Q136D3|TRPD_RHOPS Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=trpD PE=3 SV=1 16 328 2.0E-34
sp|A5N7N7|TRPD_CLOK5 Anthranilate phosphoribosyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=trpD PE=3 SV=1 31 408 3.0E-34
sp|B9E148|TRPD_CLOK1 Anthranilate phosphoribosyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=trpD PE=3 SV=1 31 408 3.0E-34
sp|Q0BIM7|TRPD_BURCM Anthranilate phosphoribosyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=trpD PE=3 SV=1 110 409 3.0E-34
sp|Q8KC17|TRPD_CHLTE Anthranilate phosphoribosyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trpD PE=3 SV=1 19 328 3.0E-34
sp|A1KAT3|TRPD_AZOSB Anthranilate phosphoribosyltransferase OS=Azoarcus sp. (strain BH72) GN=trpD PE=3 SV=1 110 409 4.0E-34
sp|B7JX56|TRPD_CYAP8 Anthranilate phosphoribosyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=trpD PE=3 SV=1 110 404 4.0E-34
sp|B4RBX4|TRPD_PHEZH Anthranilate phosphoribosyltransferase OS=Phenylobacterium zucineum (strain HLK1) GN=trpD PE=3 SV=1 112 358 4.0E-34
sp|A2RK17|TRPD_LACLM Anthranilate phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=trpD PE=3 SV=1 31 359 5.0E-34
sp|C3MV89|TRPD_SULIM Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=trpD PE=3 SV=1 16 393 5.0E-34
sp|C4KH54|TRPD_SULIK Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=trpD PE=3 SV=1 16 393 5.0E-34
sp|A9VJV9|TRPD_BACWK Anthranilate phosphoribosyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=trpD PE=3 SV=1 36 409 5.0E-34
sp|A4YVD5|TRPD_BRASO Anthranilate phosphoribosyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=trpD PE=3 SV=2 17 328 5.0E-34
sp|C3NE52|TRPD_SULIY Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=trpD PE=3 SV=1 16 393 5.0E-34
sp|C3MPW2|TRPD_SULIL Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=trpD PE=3 SV=1 16 393 5.0E-34
sp|A6LU93|TRPD_CLOB8 Anthranilate phosphoribosyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=trpD PE=3 SV=1 24 403 6.0E-34
sp|Q7VCJ6|TRPD_PROMA Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=trpD PE=3 SV=1 13 352 6.0E-34
sp|A5GTM6|TRPD_SYNR3 Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain RCC307) GN=trpD PE=3 SV=1 110 403 6.0E-34
sp|C3NHL1|TRPD_SULIN Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=trpD PE=3 SV=1 16 393 7.0E-34
sp|B2SL02|TRPD_XANOP Anthranilate phosphoribosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=trpD PE=3 SV=1 45 411 8.0E-34
sp|Q2NYD6|TRPD_XANOM Anthranilate phosphoribosyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=trpD PE=3 SV=1 45 411 8.0E-34
sp|B8G5C5|TRPD_CHLAD Anthranilate phosphoribosyltransferase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=trpD PE=3 SV=1 31 329 8.0E-34
sp|C1DHY8|TRPD_AZOVD Anthranilate phosphoribosyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=trpD PE=3 SV=1 16 306 8.0E-34
sp|A9BS05|TRPD_DELAS Anthranilate phosphoribosyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=trpD PE=3 SV=1 110 412 8.0E-34
sp|Q6HLU7|TRPD_BACHK Anthranilate phosphoribosyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=trpD PE=3 SV=1 99 409 9.0E-34
sp|Q5KXU8|TRPD_GEOKA Anthranilate phosphoribosyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=trpD PE=3 SV=1 18 401 9.0E-34
sp|B9IU35|TRPD_BACCQ Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain Q1) GN=trpD PE=3 SV=1 99 409 9.0E-34
sp|B7I0E9|TRPD_BACC7 Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain AH187) GN=trpD PE=3 SV=1 99 409 9.0E-34
sp|C1ELE7|TRPD_BACC3 Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain 03BB102) GN=trpD PE=3 SV=1 99 409 9.0E-34
sp|B2V751|TRPD_SULSY Anthranilate phosphoribosyltransferase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=trpD PE=3 SV=1 112 356 1.0E-33
sp|A0KMC8|TRPD_AERHH Anthranilate phosphoribosyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=trpD PE=3 SV=1 105 328 1.0E-33
sp|B7JES7|TRPD_BACC0 Anthranilate phosphoribosyltransferase OS=Bacillus cereus (strain AH820) GN=trpD PE=3 SV=1 99 409 1.0E-33
sp|Q81TM1|TRPD_BACAN Anthranilate phosphoribosyltransferase OS=Bacillus anthracis GN=trpD PE=3 SV=1 99 409 1.0E-33
sp|C3LAW1|TRPD_BACAC Anthranilate phosphoribosyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=trpD PE=3 SV=1 99 409 1.0E-33
sp|C3P3T7|TRPD_BACAA Anthranilate phosphoribosyltransferase OS=Bacillus anthracis (strain A0248) GN=trpD PE=3 SV=1 99 409 1.0E-33
sp|A0RB61|TRPD_BACAH Anthranilate phosphoribosyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=trpD PE=3 SV=1 99 409 1.0E-33
sp|Q1GYF5|TRPD_METFK Anthranilate phosphoribosyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=trpD PE=3 SV=1 110 401 1.0E-33
sp|P00500|TRPD_ACIAD Anthranilate phosphoribosyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=trpD PE=1 SV=1 29 407 1.0E-33
sp|B0U1N9|TRPD_XYLFM Anthranilate phosphoribosyltransferase OS=Xylella fastidiosa (strain M12) GN=trpD PE=3 SV=1 107 364 1.0E-33
sp|Q8TXJ5|TRPD_METKA Anthranilate phosphoribosyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=trpD PE=3 SV=1 30 408 1.0E-33
sp|C3N5I8|TRPD_SULIA Anthranilate phosphoribosyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=trpD PE=3 SV=1 16 393 1.0E-33
sp|A8FEK1|TRPD_BACP2 Anthranilate phosphoribosyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=trpD PE=3 SV=1 110 356 1.0E-33
sp|Q02YA8|TRPD_LACLS Anthranilate phosphoribosyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=trpD PE=3 SV=1 31 359 1.0E-33
sp|Q87EX3|TRPD_XYLFT Anthranilate phosphoribosyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=trpD PE=3 SV=1 107 364 1.0E-33
sp|B2I6S4|TRPD_XYLF2 Anthranilate phosphoribosyltransferase OS=Xylella fastidiosa (strain M23) GN=trpD PE=3 SV=1 107 364 1.0E-33
sp|Q8PD71|TRPD_XANCP Anthranilate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=trpD PE=1 SV=1 36 412 1.0E-33
sp|Q4UZF9|TRPD_XANC8 Anthranilate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=trpD PE=3 SV=1 36 412 1.0E-33
sp|Q1QV38|TRPD_CHRSD Anthranilate phosphoribosyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=trpD PE=3 SV=1 44 355 1.0E-33
sp|A9B9W1|TRPD_PROM4 Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9211) GN=trpD PE=3 SV=1 110 355 1.0E-33
sp|Q24SK4|TRPD_DESHY Anthranilate phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=trpD PE=3 SV=1 109 343 1.0E-33
sp|A7H793|TRPD_ANADF Anthranilate phosphoribosyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=trpD PE=3 SV=1 18 329 2.0E-33
sp|Q0A6E7|TRPD_ALKEH Anthranilate phosphoribosyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=trpD PE=3 SV=1 24 410 2.0E-33
sp|C5BPA3|TRPD_TERTT Anthranilate phosphoribosyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=trpD PE=3 SV=1 16 329 2.0E-33
sp|Q11HU2|TRPD_CHESB Anthranilate phosphoribosyltransferase OS=Chelativorans sp. (strain BNC1) GN=trpD PE=3 SV=1 17 408 2.0E-33
sp|P03947|TRPD_BACSU Anthranilate phosphoribosyltransferase OS=Bacillus subtilis (strain 168) GN=trpD PE=3 SV=2 109 412 2.0E-33
sp|P26924|TRPD_AZOBR Anthranilate phosphoribosyltransferase OS=Azospirillum brasilense GN=trpD PE=3 SV=1 16 408 3.0E-33
sp|A9KTR5|TRPD_SHEB9 Anthranilate phosphoribosyltransferase OS=Shewanella baltica (strain OS195) GN=trpD PE=3 SV=1 18 409 3.0E-33
sp|Q2SUI1|TRPD_BURTA Anthranilate phosphoribosyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=trpD PE=3 SV=1 110 343 3.0E-33
sp|B2IKP4|TRPD_BEII9 Anthranilate phosphoribosyltransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=trpD PE=3 SV=1 18 329 3.0E-33
sp|Q6NEC1|TRPD_CORDI Anthranilate phosphoribosyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=trpD PE=3 SV=1 109 327 3.0E-33
sp|B0RMZ8|TRPD_XANCB Anthranilate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=trpD PE=3 SV=1 36 412 4.0E-33
sp|Q1QMJ8|TRPD_NITHX Anthranilate phosphoribosyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=trpD PE=3 SV=1 17 328 4.0E-33
sp|P50384|TRPD_SULSO Anthranilate phosphoribosyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpD PE=1 SV=1 16 348 4.0E-33
sp|P43858|TRPD_HAEIN Anthranilate phosphoribosyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpD PE=3 SV=1 110 329 4.0E-33
sp|Q3APT3|TRPD_CHLCH Anthranilate phosphoribosyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=trpD PE=3 SV=1 112 325 4.0E-33
sp|Q2RIT6|TRPD_MOOTA Anthranilate phosphoribosyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=trpD PE=3 SV=1 36 343 5.0E-33
sp|Q8G0F5|TRPD_BRUSU Anthranilate phosphoribosyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=trpD PE=3 SV=1 17 409 5.0E-33
sp|A5UT95|TRPD_ROSS1 Anthranilate phosphoribosyltransferase OS=Roseiflexus sp. (strain RS-1) GN=trpD PE=3 SV=1 31 329 5.0E-33
sp|Q7TV05|TRPD_PROMM Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=trpD PE=3 SV=1 36 387 5.0E-33
sp|B8GNI1|TRPD_THISH Anthranilate phosphoribosyltransferase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=trpD PE=3 SV=1 108 407 5.0E-33
sp|B8F815|TRPD_HAEPS Anthranilate phosphoribosyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=trpD PE=3 SV=1 21 352 6.0E-33
sp|A1B3Y5|TRPD_PARDP Anthranilate phosphoribosyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=trpD PE=3 SV=1 109 309 6.0E-33
sp|A4TBH5|TRPD_MYCGI Anthranilate phosphoribosyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=trpD PE=3 SV=1 34 410 6.0E-33
sp|A6TM73|TRPD_ALKMQ Anthranilate phosphoribosyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=trpD PE=3 SV=2 30 410 7.0E-33
sp|A9M5F3|TRPD_BRUC2 Anthranilate phosphoribosyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=trpD PE=3 SV=1 17 409 7.0E-33
sp|Q112P2|TRPD_TRIEI Anthranilate phosphoribosyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=trpD PE=3 SV=1 105 405 7.0E-33
sp|Q8XS00|TRPD2_RALSO Anthranilate phosphoribosyltransferase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=trpD2 PE=3 SV=1 48 355 7.0E-33
sp|Q3SGS1|TRPD_THIDA Anthranilate phosphoribosyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=trpD PE=3 SV=1 107 409 8.0E-33
sp|A1U6H0|TRPD_MARHV Anthranilate phosphoribosyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=trpD PE=3 SV=1 16 310 8.0E-33
sp|Q8YHF7|TRPD_BRUME Anthranilate phosphoribosyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=trpD PE=3 SV=2 17 409 1.0E-32
sp|C0RJB0|TRPD_BRUMB Anthranilate phosphoribosyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=trpD PE=3 SV=1 17 409 1.0E-32
sp|Q57CZ9|TRPD_BRUAB Anthranilate phosphoribosyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=trpD PE=3 SV=1 17 409 1.0E-32
sp|Q2YRR5|TRPD_BRUA2 Anthranilate phosphoribosyltransferase OS=Brucella abortus (strain 2308) GN=trpD PE=3 SV=1 17 409 1.0E-32
sp|B2S5Z0|TRPD_BRUA1 Anthranilate phosphoribosyltransferase OS=Brucella abortus (strain S19) GN=trpD PE=3 SV=1 17 409 1.0E-32
sp|A1RIE5|TRPD_SHESW Anthranilate phosphoribosyltransferase OS=Shewanella sp. (strain W3-18-1) GN=trpD PE=3 SV=1 18 409 1.0E-32
sp|Q9X6J5|TRPD_GEOSE Anthranilate phosphoribosyltransferase OS=Geobacillus stearothermophilus GN=trpD PE=3 SV=1 18 328 1.0E-32
sp|A6WPW9|TRPD_SHEB8 Anthranilate phosphoribosyltransferase OS=Shewanella baltica (strain OS185) GN=trpD PE=3 SV=1 18 409 1.0E-32
sp|P57856|TRPD_PASMU Anthranilate phosphoribosyltransferase OS=Pasteurella multocida (strain Pm70) GN=trpD PE=3 SV=1 110 329 1.0E-32
sp|Q215B8|TRPD_RHOPB Anthranilate phosphoribosyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=trpD PE=3 SV=1 17 411 1.0E-32
sp|B8FVH5|TRPD_DESHD Anthranilate phosphoribosyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=trpD PE=3 SV=1 109 343 1.0E-32
sp|Q2RT49|TRPD_RHORT Anthranilate phosphoribosyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=trpD PE=3 SV=1 17 328 1.0E-32
sp|Q0B006|TRPD_SYNWW Anthranilate phosphoribosyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=trpD PE=3 SV=1 110 409 1.0E-32
sp|A1BE13|TRPD_CHLPD Anthranilate phosphoribosyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=trpD PE=3 SV=1 112 411 1.0E-32
sp|A2SLH5|TRPD_METPP Anthranilate phosphoribosyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=trpD PE=3 SV=1 110 410 2.0E-32
sp|A5VQR4|TRPD_BRUO2 Anthranilate phosphoribosyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=trpD PE=3 SV=2 17 409 2.0E-32
sp|A3D628|TRPD_SHEB5 Anthranilate phosphoribosyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=trpD PE=3 SV=1 18 409 2.0E-32
sp|P00905|TRPGD_SALTY Bifunctional protein TrpGD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpGD PE=1 SV=4 10 329 2.0E-32
sp|P00904|TRPGD_ECOLI Bifunctional protein TrpGD OS=Escherichia coli (strain K12) GN=trpGD PE=1 SV=3 10 329 2.0E-32
sp|Q8FLJ8|TRPD_COREF Anthranilate phosphoribosyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=trpD PE=3 SV=1 36 369 2.0E-32
sp|P20574|TRPD_PSEAE Anthranilate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpD PE=3 SV=1 16 306 2.0E-32
sp|Q02TB6|TRPD_PSEAB Anthranilate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=trpD PE=3 SV=1 16 306 2.0E-32
sp|B7V608|TRPD_PSEA8 Anthranilate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=trpD PE=3 SV=1 16 306 2.0E-32
sp|Q5F7H5|TRPD_NEIG1 Anthranilate phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=trpD PE=3 SV=1 29 411 3.0E-32
sp|Q9A728|TRPD_CAUCR Anthranilate phosphoribosyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=trpD PE=3 SV=1 110 408 3.0E-32
sp|B8GWP8|TRPD_CAUCN Anthranilate phosphoribosyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=trpD PE=3 SV=1 110 408 3.0E-32
sp|Q5ZX98|TRPD_LEGPH Anthranilate phosphoribosyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=trpD PE=3 SV=1 18 346 3.0E-32
sp|Q5X6R9|TRPD_LEGPA Anthranilate phosphoribosyltransferase OS=Legionella pneumophila (strain Paris) GN=trpD PE=3 SV=1 18 346 3.0E-32
sp|A2C1X5|TRPD_PROM1 Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=trpD PE=3 SV=1 13 405 4.0E-32
sp|Q02166|TRPD_ARATH Anthranilate phosphoribosyltransferase, chloroplastic OS=Arabidopsis thaliana GN=PAT1 PE=2 SV=1 15 329 4.0E-32
sp|A4Y843|TRPD_SHEPC Anthranilate phosphoribosyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=trpD PE=3 SV=1 18 409 5.0E-32
sp|O27698|TRPD_METTH Anthranilate phosphoribosyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpD PE=3 SV=1 99 410 6.0E-32
sp|A1STT2|TRPD_PSYIN Anthranilate phosphoribosyltransferase OS=Psychromonas ingrahamii (strain 37) GN=trpD PE=3 SV=1 17 352 6.0E-32
sp|Q30VM1|TRPD_DESAG Anthranilate phosphoribosyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=trpD PE=3 SV=1 111 343 7.0E-32
sp|Q6D4U2|TRPD_PECAS Anthranilate phosphoribosyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=trpD PE=3 SV=1 16 329 7.0E-32
sp|A6VU64|TRPD_MARMS Anthranilate phosphoribosyltransferase OS=Marinomonas sp. (strain MWYL1) GN=trpD PE=3 SV=1 16 355 8.0E-32
sp|A4IQ85|TRPD_GEOTN Anthranilate phosphoribosyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=trpD PE=3 SV=1 18 401 9.0E-32
sp|Q5WY74|TRPD_LEGPL Anthranilate phosphoribosyltransferase OS=Legionella pneumophila (strain Lens) GN=trpD PE=3 SV=1 14 346 1.0E-31
sp|Q971Z7|TRPD_SULTO Anthranilate phosphoribosyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=trpD PE=3 SV=1 111 355 1.0E-31
sp|B8DM45|TRPD_DESVM Anthranilate phosphoribosyltransferase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=trpD PE=3 SV=1 31 303 1.0E-31
sp|Q4QKA1|TRPD_HAEI8 Anthranilate phosphoribosyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=trpD PE=3 SV=1 110 329 1.0E-31
sp|B6JG28|TRPD_OLICO Anthranilate phosphoribosyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=trpD PE=3 SV=1 17 303 1.0E-31
sp|A6UZF1|TRPD_PSEA7 Anthranilate phosphoribosyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=trpD PE=3 SV=1 16 306 1.0E-31
sp|A5UEN6|TRPD_HAEIG Anthranilate phosphoribosyltransferase OS=Haemophilus influenzae (strain PittGG) GN=trpD PE=3 SV=1 110 329 1.0E-31
sp|B2UDK8|TRPD_RALPJ Anthranilate phosphoribosyltransferase OS=Ralstonia pickettii (strain 12J) GN=trpD PE=3 SV=1 110 412 1.0E-31
sp|Q12LE4|TRPD_SHEDO Anthranilate phosphoribosyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=trpD PE=3 SV=1 43 383 1.0E-31
sp|Q63QH1|TRPD_BURPS Anthranilate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=trpD PE=3 SV=1 95 410 2.0E-31
sp|A3NDZ2|TRPD_BURP6 Anthranilate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 668) GN=trpD PE=3 SV=1 95 410 2.0E-31
sp|Q3JNB1|TRPD_BURP1 Anthranilate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=trpD PE=3 SV=1 95 410 2.0E-31
sp|A3NZP5|TRPD_BURP0 Anthranilate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=trpD PE=3 SV=1 95 410 2.0E-31
sp|A1UW99|TRPD_BURMS Anthranilate phosphoribosyltransferase OS=Burkholderia mallei (strain SAVP1) GN=trpD PE=3 SV=1 95 410 2.0E-31
sp|Q62DC9|TRPD_BURMA Anthranilate phosphoribosyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=trpD PE=3 SV=1 95 410 2.0E-31
sp|A2RYI2|TRPD_BURM9 Anthranilate phosphoribosyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=trpD PE=3 SV=1 95 410 2.0E-31
sp|A3MFQ3|TRPD_BURM7 Anthranilate phosphoribosyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=trpD PE=3 SV=1 95 410 2.0E-31
sp|Q13TW5|TRPD_BURXL Anthranilate phosphoribosyltransferase OS=Burkholderia xenovorans (strain LB400) GN=trpD PE=3 SV=2 110 410 2.0E-31
sp|Q47AC6|TRPD_DECAR Anthranilate phosphoribosyltransferase OS=Dechloromonas aromatica (strain RCB) GN=trpD PE=3 SV=1 45 411 2.0E-31
sp|Q2NFE4|TRPD_METST Anthranilate phosphoribosyltransferase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=trpD PE=3 SV=1 18 409 2.0E-31
sp|Q4J8X7|TRPD_SULAC Anthranilate phosphoribosyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=trpD PE=3 SV=1 36 358 2.0E-31
sp|Q8TLP5|TRPD_METAC Anthranilate phosphoribosyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=trpD PE=3 SV=1 110 411 3.0E-31
sp|A1KTN4|TRPD_NEIMF Anthranilate phosphoribosyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=trpD PE=3 SV=1 29 404 3.0E-31
sp|P66995|TRPD_NEIMB Anthranilate phosphoribosyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=trpD PE=3 SV=1 29 404 3.0E-31
sp|P66994|TRPD_NEIMA Anthranilate phosphoribosyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=trpD PE=3 SV=1 29 404 3.0E-31
sp|A5IG81|TRPD_LEGPC Anthranilate phosphoribosyltransferase OS=Legionella pneumophila (strain Corby) GN=trpD PE=3 SV=1 18 346 4.0E-31
sp|Q46L78|TRPD_PROMT Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=trpD PE=3 SV=1 42 359 4.0E-31
sp|A7I4T7|TRPD_METB6 Anthranilate phosphoribosyltransferase OS=Methanoregula boonei (strain 6A8) GN=trpD PE=3 SV=1 31 407 4.0E-31
sp|Q163Y0|TRPD_ROSDO Anthranilate phosphoribosyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=trpD PE=3 SV=2 18 329 4.0E-31
sp|Q2FKX5|TRPD_METHJ Anthranilate phosphoribosyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=trpD PE=3 SV=1 31 403 4.0E-31
sp|Q21SE7|TRPD_RHOFT Anthranilate phosphoribosyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=trpD PE=3 SV=1 110 301 4.0E-31
sp|Q0HK79|TRPD_SHESM Anthranilate phosphoribosyltransferase OS=Shewanella sp. (strain MR-4) GN=trpD PE=3 SV=1 16 409 4.0E-31
sp|A0KVD3|TRPD_SHESA Anthranilate phosphoribosyltransferase OS=Shewanella sp. (strain ANA-3) GN=trpD PE=3 SV=1 17 409 5.0E-31
sp|Q8ESU1|TRPD_OCEIH Anthranilate phosphoribosyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=trpD PE=3 SV=1 31 348 5.0E-31
sp|A9M4G6|TRPD_NEIM0 Anthranilate phosphoribosyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=trpD PE=3 SV=1 29 404 5.0E-31
sp|Q8XVE7|TRPD1_RALSO Anthranilate phosphoribosyltransferase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=trpD1 PE=3 SV=1 110 409 5.0E-31
sp|A2BWT1|TRPD_PROM5 Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9515) GN=trpD PE=3 SV=1 41 353 6.0E-31
sp|Q3M4T0|TRPD_ANAVT Anthranilate phosphoribosyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=trpD PE=3 SV=1 36 329 6.0E-31
sp|A3PHK8|TRPD_RHOS1 Anthranilate phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=trpD PE=3 SV=1 44 328 6.0E-31
sp|A3QF71|TRPD_SHELP Anthranilate phosphoribosyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=trpD PE=3 SV=1 22 356 7.0E-31
sp|A5WFZ6|TRPD_PSYWF Anthranilate phosphoribosyltransferase OS=Psychrobacter sp. (strain PRwf-1) GN=trpD PE=3 SV=1 75 407 8.0E-31
sp|A0JX18|TRPD_ARTS2 Anthranilate phosphoribosyltransferase OS=Arthrobacter sp. (strain FB24) GN=trpD PE=3 SV=1 40 407 9.0E-31
sp|Q9ZFA8|TRPD_RHOS4 Anthranilate phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=trpD PE=3 SV=1 44 328 9.0E-31
sp|A7NL64|TRPD_ROSCS Anthranilate phosphoribosyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=trpD PE=3 SV=1 44 329 1.0E-30
sp|C0ZCE2|TRPD_BREBN Anthranilate phosphoribosyltransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=trpD PE=3 SV=1 39 351 1.0E-30
sp|Q98ME4|TRPD_RHILO Anthranilate phosphoribosyltransferase OS=Rhizobium loti (strain MAFF303099) GN=trpD PE=3 SV=1 36 408 1.0E-30
sp|Q0HWI1|TRPD_SHESR Anthranilate phosphoribosyltransferase OS=Shewanella sp. (strain MR-7) GN=trpD PE=3 SV=1 16 409 1.0E-30
sp|B9MKD0|TRPD_CALBD Anthranilate phosphoribosyltransferase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=trpD PE=3 SV=1 112 401 1.0E-30
sp|A4WX68|TRPD_RHOS5 Anthranilate phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=trpD PE=3 SV=1 40 328 1.0E-30
sp|A4XLM7|TRPD_CALS8 Anthranilate phosphoribosyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=trpD PE=3 SV=1 111 331 1.0E-30
sp|A5UBZ6|TRPD_HAEIE Anthranilate phosphoribosyltransferase OS=Haemophilus influenzae (strain PittEE) GN=trpD PE=3 SV=1 110 329 1.0E-30
sp|Q66AK2|TRPD_YERPS Anthranilate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=trpD PE=3 SV=1 110 329 2.0E-30
sp|A4TJ65|TRPD_YERPP Anthranilate phosphoribosyltransferase OS=Yersinia pestis (strain Pestoides F) GN=trpD PE=3 SV=1 110 329 2.0E-30
sp|Q1CJ26|TRPD_YERPN Anthranilate phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=trpD PE=3 SV=1 110 329 2.0E-30
sp|B2K3W4|TRPD_YERPB Anthranilate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=trpD PE=3 SV=1 110 329 2.0E-30
sp|Q1C7P0|TRPD_YERPA Anthranilate phosphoribosyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=trpD PE=3 SV=1 110 329 2.0E-30
sp|Q5P2G2|TRPD_AROAE Anthranilate phosphoribosyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=trpD PE=3 SV=1 110 411 2.0E-30
sp|A8LMJ6|TRPD_DINSH Anthranilate phosphoribosyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=trpD PE=3 SV=1 109 329 2.0E-30
sp|A6X0L1|TRPD_OCHA4 Anthranilate phosphoribosyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=trpD PE=3 SV=1 17 412 2.0E-30
sp|B1JKS0|TRPD_YERPY Anthranilate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=trpD PE=3 SV=1 110 329 2.0E-30
sp|A1WH74|TRPD_VEREI Anthranilate phosphoribosyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=trpD PE=3 SV=2 107 301 2.0E-30
sp|Q0VMX5|TRPD_ALCBS Anthranilate phosphoribosyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=trpD PE=3 SV=1 29 395 2.0E-30
sp|Q8ZEG7|TRPD_YERPE Anthranilate phosphoribosyltransferase OS=Yersinia pestis GN=trpD PE=3 SV=1 110 329 2.0E-30
sp|A7FI31|TRPD_YERP3 Anthranilate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=trpD PE=3 SV=1 110 329 2.0E-30
sp|Q82AK1|TRPD_STRAW Anthranilate phosphoribosyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=trpD PE=3 SV=1 31 408 2.0E-30
sp|O68608|TRPD1_STRCO Anthranilate phosphoribosyltransferase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpD1 PE=3 SV=1 108 408 2.0E-30
sp|B9KMV1|TRPD_RHOSK Anthranilate phosphoribosyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=trpD PE=3 SV=1 44 328 2.0E-30
sp|Q8YXQ9|TRPD2_NOSS1 Anthranilate phosphoribosyltransferase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trpD2 PE=1 SV=1 110 329 2.0E-30
sp|Q5WGS4|TRPD_BACSK Anthranilate phosphoribosyltransferase OS=Bacillus clausii (strain KSM-K16) GN=trpD PE=3 SV=1 36 329 2.0E-30
sp|Q3J897|TRPD_NITOC Anthranilate phosphoribosyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=trpD PE=3 SV=1 16 408 2.0E-30
sp|Q4JWC7|TRPD_CORJK Anthranilate phosphoribosyltransferase OS=Corynebacterium jeikeium (strain K411) GN=trpD PE=3 SV=1 111 404 2.0E-30
sp|Q1GUW8|TRPD_SPHAL Anthranilate phosphoribosyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=trpD PE=3 SV=1 32 329 3.0E-30
sp|B5ERI3|TRPD_ACIF5 Anthranilate phosphoribosyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=trpD PE=3 SV=1 110 409 3.0E-30
sp|B7JBC1|TRPD_ACIF2 Anthranilate phosphoribosyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=trpD PE=3 SV=1 110 409 3.0E-30
sp|P73617|TRPD_SYNY3 Anthranilate phosphoribosyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trpD PE=3 SV=1 110 329 3.0E-30
sp|A1SLE8|TRPD_NOCSJ Anthranilate phosphoribosyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=trpD PE=3 SV=1 26 350 3.0E-30
sp|B2VKT4|TRPD_ERWT9 Anthranilate phosphoribosyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=trpD PE=3 SV=1 21 405 3.0E-30
sp|Q021N5|TRPD_SOLUE Anthranilate phosphoribosyltransferase OS=Solibacter usitatus (strain Ellin6076) GN=trpD PE=3 SV=1 40 301 3.0E-30
sp|Q2S1Z6|TRPD_SALRD Anthranilate phosphoribosyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=trpD PE=3 SV=1 22 351 4.0E-30
sp|A7HXZ5|TRPD_PARL1 Anthranilate phosphoribosyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=trpD PE=3 SV=1 142 408 4.0E-30
sp|Q7TTV4|TRPD_SYNPX Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain WH8102) GN=trpD PE=3 SV=1 110 353 4.0E-30
sp|A3CRK8|TRPD_METMJ Anthranilate phosphoribosyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=trpD PE=3 SV=1 108 365 4.0E-30
sp|Q2S999|TRPD_HAHCH Anthranilate phosphoribosyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=trpD PE=3 SV=1 16 401 4.0E-30
sp|Q465F3|TRPD_METBF Anthranilate phosphoribosyltransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=trpD PE=3 SV=1 31 366 5.0E-30
sp|C1D7P3|TRPD_LARHH Anthranilate phosphoribosyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=trpD PE=3 SV=1 36 412 5.0E-30
sp|A1TJQ1|TRPD_ACIAC Anthranilate phosphoribosyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=trpD PE=3 SV=1 110 412 7.0E-30
sp|Q8YZP8|TRPD1_NOSS1 Anthranilate phosphoribosyltransferase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trpD1 PE=3 SV=1 110 405 1.0E-29
sp|A8GF80|TRPD_SERP5 Anthranilate phosphoribosyltransferase OS=Serratia proteamaculans (strain 568) GN=trpD PE=3 SV=1 110 329 1.0E-29
sp|C6DGZ7|TRPD_PECCP Anthranilate phosphoribosyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=trpD PE=3 SV=1 16 329 1.0E-29
sp|Q21MR4|TRPD_SACD2 Anthranilate phosphoribosyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=trpD PE=3 SV=1 31 407 1.0E-29
sp|B4EWH5|TRPD_PROMH Anthranilate phosphoribosyltransferase OS=Proteus mirabilis (strain HI4320) GN=trpD PE=3 SV=1 41 329 1.0E-29
sp|A7Z619|TRPD_BACMF Anthranilate phosphoribosyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=trpD PE=3 SV=1 101 412 2.0E-29
sp|Q1IZP8|TRPD_DEIGD Anthranilate phosphoribosyltransferase OS=Deinococcus geothermalis (strain DSM 11300) GN=trpD PE=3 SV=1 110 412 2.0E-29
sp|Q2W3A9|TRPD_MAGSA Anthranilate phosphoribosyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=trpD PE=3 SV=1 109 329 2.0E-29
sp|P30525|TRPD_BACCA Anthranilate phosphoribosyltransferase (Fragment) OS=Bacillus caldotenax GN=trpD PE=3 SV=1 18 282 2.0E-29
sp|Q8PT97|TRPD_METMA Anthranilate phosphoribosyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=trpD PE=3 SV=1 110 366 2.0E-29
sp|A0R048|TRPD_MYCS2 Anthranilate phosphoribosyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=trpD PE=1 SV=1 35 396 2.0E-29
sp|B9JX63|TRPD_AGRVS Anthranilate phosphoribosyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=trpD PE=3 SV=1 18 408 2.0E-29
sp|Q49XH5|TRPD_STAS1 Anthranilate phosphoribosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trpD PE=3 SV=1 16 358 2.0E-29
sp|A0Q8R1|TRPD_FRATN Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=trpD PE=3 SV=1 16 409 2.0E-29
sp|Q8ECV2|TRPD_SHEON Anthranilate phosphoribosyltransferase OS=Shewanella oneidensis (strain MR-1) GN=trpD PE=3 SV=1 17 409 3.0E-29
sp|P52562|TRPD_HALVD Anthranilate phosphoribosyltransferase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=trpD PE=3 SV=2 50 403 3.0E-29
sp|A2STA7|TRPD_METLZ Anthranilate phosphoribosyltransferase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=trpD PE=3 SV=1 29 404 4.0E-29
sp|Q0APU5|TRPD_MARMM Anthranilate phosphoribosyltransferase OS=Maricaulis maris (strain MCS10) GN=trpD PE=3 SV=1 109 354 4.0E-29
sp|Q28R66|TRPD_JANSC Anthranilate phosphoribosyltransferase OS=Jannaschia sp. (strain CCS1) GN=trpD PE=3 SV=1 109 328 4.0E-29
sp|P59415|TRPD_BUCBP Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trpD PE=3 SV=1 112 359 5.0E-29
sp|A5CXR3|TRPD_VESOH Anthranilate phosphoribosyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=trpD PE=3 SV=1 31 404 5.0E-29
sp|Q7TU90|TRPD_PROMP Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=trpD PE=3 SV=1 31 353 6.0E-29
sp|Q04ZD2|TRPD_LEPBL Anthranilate phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=trpD PE=3 SV=1 32 329 6.0E-29
sp|Q04R23|TRPD_LEPBJ Anthranilate phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=trpD PE=3 SV=1 32 329 6.0E-29
sp|A1TB00|TRPD_MYCVP Anthranilate phosphoribosyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=trpD PE=3 SV=1 34 410 6.0E-29
sp|B0TWF2|TRPD_FRAP2 Anthranilate phosphoribosyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=trpD PE=3 SV=1 16 329 6.0E-29
sp|A9F0C1|TRPD_SORC5 Anthranilate phosphoribosyltransferase OS=Sorangium cellulosum (strain So ce56) GN=trpD PE=3 SV=1 112 409 6.0E-29
sp|A4FAC5|TRPD_SACEN Anthranilate phosphoribosyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=trpD PE=3 SV=1 29 329 6.0E-29
sp|Q4K502|TRPD_PSEF5 Anthranilate phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=trpD PE=3 SV=1 16 306 6.0E-29
sp|Q0BTY4|TRPD_GRABC Anthranilate phosphoribosyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=trpD PE=3 SV=1 16 410 6.0E-29
sp|Q5YZ21|TRPD_NOCFA Anthranilate phosphoribosyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=trpD PE=3 SV=1 31 349 7.0E-29
sp|C3K308|TRPD_PSEFS Anthranilate phosphoribosyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=trpD PE=3 SV=1 16 348 8.0E-29
sp|A1R6T5|TRPD_ARTAT Anthranilate phosphoribosyltransferase OS=Arthrobacter aurescens (strain TC1) GN=trpD PE=3 SV=1 20 403 1.0E-28
sp|Q5N0L1|TRPD_SYNP6 Anthranilate phosphoribosyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=trpD PE=3 SV=1 105 329 1.0E-28
sp|Q31J09|TRPD_THICR Anthranilate phosphoribosyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=trpD PE=3 SV=1 44 411 1.0E-28
sp|B8DZP4|TRPD_DICTD Anthranilate phosphoribosyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=trpD PE=3 SV=1 48 355 1.0E-28
sp|A2BQY1|TRPD_PROMS Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain AS9601) GN=trpD PE=3 SV=1 110 400 1.0E-28
sp|Q7N488|TRPD_PHOLL Anthranilate phosphoribosyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=trpD PE=3 SV=1 105 328 1.0E-28
sp|Q31LB6|TRPD_SYNE7 Anthranilate phosphoribosyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=trpD PE=3 SV=1 105 405 2.0E-28
sp|A5D1S5|TRPD_PELTS Anthranilate phosphoribosyltransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=trpD PE=3 SV=1 110 411 2.0E-28
sp|Q8DI76|TRPD_THEEB Anthranilate phosphoribosyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=trpD PE=3 SV=1 36 409 2.0E-28
sp|Q9Y8T2|TRPD_AERPE Anthranilate phosphoribosyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=trpD PE=3 SV=1 110 328 2.0E-28
sp|Q2NA97|TRPD_ERYLH Anthranilate phosphoribosyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=trpD PE=3 SV=1 36 328 2.0E-28
sp|B0SYZ3|TRPD_CAUSK Anthranilate phosphoribosyltransferase OS=Caulobacter sp. (strain K31) GN=trpD PE=3 SV=1 110 408 2.0E-28
sp|Q0BJW6|TRPD_FRATO Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=trpD PE=3 SV=2 16 409 2.0E-28
sp|A7NF00|TRPD_FRATF Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=trpD PE=3 SV=2 16 409 3.0E-28
sp|Q72PD0|TRPD_LEPIC Anthranilate phosphoribosyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=trpD PE=3 SV=1 41 269 3.0E-28
sp|Q8F708|TRPD_LEPIN Anthranilate phosphoribosyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=trpD PE=3 SV=1 41 269 3.0E-28
sp|Q18FI8|TRPD_HALWD Anthranilate phosphoribosyltransferase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=trpD PE=3 SV=1 36 403 3.0E-28
sp|B5YD05|TRPD_DICT6 Anthranilate phosphoribosyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=trpD PE=3 SV=1 48 353 4.0E-28
sp|A0PTM6|TRPD_MYCUA Anthranilate phosphoribosyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=trpD PE=3 SV=1 20 396 4.0E-28
sp|B2HGW0|TRPD_MYCMM Anthranilate phosphoribosyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=trpD PE=3 SV=1 20 396 4.0E-28
sp|P57367|TRPD_BUCAI Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trpD PE=3 SV=1 110 409 4.0E-28
sp|B8D972|TRPD_BUCA5 Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=trpD PE=3 SV=1 110 409 4.0E-28
sp|B8D7H6|TRPD_BUCAT Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=trpD PE=3 SV=1 110 409 5.0E-28
sp|Q6AFI7|TRPD_LEIXX Anthranilate phosphoribosyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=trpD PE=3 SV=1 31 407 6.0E-28
sp|B1VZR5|TRPD_STRGG Anthranilate phosphoribosyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=trpD PE=3 SV=1 31 349 6.0E-28
sp|A1S7I0|TRPD_SHEAM Anthranilate phosphoribosyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=trpD PE=3 SV=1 17 329 6.0E-28
sp|B2SEF6|TRPD_FRATM Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=trpD PE=3 SV=1 16 409 6.0E-28
sp|Q2NT50|TRPD_SODGM Anthranilate phosphoribosyltransferase OS=Sodalis glossinidius (strain morsitans) GN=trpD PE=3 SV=1 110 329 7.0E-28
sp|A0LTH9|TRPD_ACIC1 Anthranilate phosphoribosyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=trpD PE=3 SV=1 23 346 7.0E-28
sp|Q7NGU2|TRPD_GLOVI Anthranilate phosphoribosyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=trpD PE=3 SV=1 68 344 9.0E-28
sp|O28668|TRPCD_ARCFU Tryptophan biosynthesis protein TrpCD OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpCD PE=3 SV=1 108 348 9.0E-28
sp|A8ACG6|TRPD_IGNH4 Anthranilate phosphoribosyltransferase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=trpD PE=3 SV=1 47 311 1.0E-27
sp|A4J0E5|TRPD_FRATW Anthranilate phosphoribosyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=trpD PE=3 SV=2 16 329 1.0E-27
sp|Q0SHN1|TRPD_RHOJR Anthranilate phosphoribosyltransferase OS=Rhodococcus jostii (strain RHA1) GN=trpD PE=3 SV=1 10 343 2.0E-27
sp|B8JAL5|TRPD_ANAD2 Anthranilate phosphoribosyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=trpD PE=3 SV=1 18 329 2.0E-27
sp|C1AU95|TRPD_RHOOB Anthranilate phosphoribosyltransferase OS=Rhodococcus opacus (strain B4) GN=trpD PE=3 SV=1 10 343 2.0E-27
sp|B8GJ30|TRPD_METPE Anthranilate phosphoribosyltransferase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=trpD PE=3 SV=1 38 407 2.0E-27
sp|A6SUH6|TRPD_JANMA Anthranilate phosphoribosyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=trpD PE=3 SV=1 110 301 2.0E-27
sp|Q4L676|TRPD_STAHJ Anthranilate phosphoribosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trpD PE=3 SV=1 22 349 3.0E-27
sp|P83827|TRPD_THETH Anthranilate phosphoribosyltransferase OS=Thermus thermophilus GN=trpD PE=1 SV=1 106 329 3.0E-27
sp|Q5SH88|TRPD_THET8 Anthranilate phosphoribosyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=trpD PE=1 SV=1 106 329 3.0E-27
sp|Q72HJ6|TRPD_THET2 Anthranilate phosphoribosyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=trpD PE=3 SV=1 106 329 3.0E-27
sp|B1I3Z8|TRPD_DESAP Anthranilate phosphoribosyltransferase OS=Desulforudis audaxviator (strain MP104C) GN=trpD PE=3 SV=1 18 328 3.0E-27
sp|P26925|TRPD_METTM Anthranilate phosphoribosyltransferase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=trpD PE=3 SV=1 36 410 4.0E-27
sp|O68426|TRPD_BUCDN Anthranilate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Diuraphis noxia GN=trpD PE=3 SV=1 110 352 5.0E-27
sp|Q822W6|TRPD_CHLCV Anthranilate phosphoribosyltransferase OS=Chlamydophila caviae (strain GPIC) GN=trpD PE=3 SV=1 68 403 6.0E-27
sp|A4X9Z2|TRPD_SALTO Anthranilate phosphoribosyltransferase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=trpD PE=3 SV=1 36 410 7.0E-27
sp|B4UHD1|TRPD_ANASK Anthranilate phosphoribosyltransferase OS=Anaeromyxobacter sp. (strain K) GN=trpD PE=3 SV=1 18 329 8.0E-27
sp|B1Y7I3|TRPD_LEPCP Anthranilate phosphoribosyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=trpD PE=3 SV=1 107 408 8.0E-27
sp|A3PCQ4|TRPD_PROM0 Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9301) GN=trpD PE=3 SV=1 110 400 9.0E-27
sp|A8G4M3|TRPD_PROM2 Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9215) GN=trpD PE=3 SV=1 110 409 1.0E-26
sp|Q2IGV6|TRPD_ANADE Anthranilate phosphoribosyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=trpD PE=3 SV=1 18 329 1.0E-26
sp|Q47R55|TRPD_THEFY Anthranilate phosphoribosyltransferase OS=Thermobifida fusca (strain YX) GN=trpD PE=3 SV=1 40 301 1.0E-26
sp|Q31B38|TRPD_PROM9 Anthranilate phosphoribosyltransferase OS=Prochlorococcus marinus (strain MIT 9312) GN=trpD PE=3 SV=1 41 400 1.0E-26
sp|Q7NW17|TRPD_CHRVO Anthranilate phosphoribosyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=trpD PE=3 SV=1 36 410 1.0E-26
sp|Q5LRH8|TRPD_RUEPO Anthranilate phosphoribosyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=trpD PE=3 SV=1 36 328 2.0E-26
sp|A4YHE2|TRPD_METS5 Anthranilate phosphoribosyltransferase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=trpD PE=3 SV=1 125 354 2.0E-26
sp|Q73YM4|TRPD_MYCPA Anthranilate phosphoribosyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=trpD PE=3 SV=1 12 396 2.0E-26
sp|P66998|TRPD_STAAW Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=trpD PE=3 SV=1 106 403 2.0E-26
sp|Q6G9J0|TRPD_STAAS Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=trpD PE=3 SV=1 106 403 2.0E-26
sp|P66997|TRPD_STAAN Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=trpD PE=3 SV=1 106 403 2.0E-26
sp|P66996|TRPD_STAAM Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trpD PE=3 SV=1 106 403 2.0E-26
sp|A5ISQ1|TRPD_STAA9 Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain JH9) GN=trpD PE=3 SV=1 106 403 2.0E-26
sp|A6U1J1|TRPD_STAA2 Anthranilate phosphoribosyltransferase OS=Staphylococcus aureus (strain JH1) GN=trpD PE=3 SV=1 106 403 2.0E-26
[Show less]

GO

GO Term Description Terminal node
GO:0016757 transferase activity, transferring glycosyl groups Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7434
MASVPIGSGQDGLPPVDIKPLLTKLWPVNSDVDPGEIAEAISHFFTNQVTEAQTASLLMALHFTGMDLRADVLAR
CAHAMMHAAAPIPLDELGAVLEGRARREGDYRGGLCDIVGTGGDSHNTFNISTTSSIIASALLLVSKHGNRASTS
KSGSADMVNCMKPRAPVISAVRPDTLAKVYSRTNYSFLFAPVFHTGMRYVAPIRRQLPWRTIFNNLGPLANPVDG
VLEARVIGVGRRELGPPFCEALRSAGCRKALIVCGEEELDEISCAGPTLCWMLKEASDGGQVEMEHFKIEPRDFG
VGSHPLSQVSPGMEAVENAGILKRILCGELADDDPLVEFVLINTAALFVVSGICEADRSDMGHGDDGQVVTERGP
AGQRWKEGVRRAKWAIKSGEAWKQWQAFVDVTNEIAA*
Coding >Hirsu2|7434
ATGGCCTCTGTCCCCATCGGCTCCGGGCAGGATGGGCTCCCGCCCGTCGACATCAAGCCATTGTTGACCAAGCTG
TGGCCGGTCAACTCGGACGTCGACCCGGGCGAGATTGCCGAGGCCATCTCGCACTTTTTCACCAACCAGGTGACG
GAGGCCCAGACGGCCTCGCTGCTGATGGCGCTTCACTTCACCGGCATGGACCTGCGCGCCGACGTCCTGGCCCGG
TGTGCGCATGCCATGATGCACGCCGCGGCGCCGATCCCGCTCGACGAGCTCGGCGCCGTCCTCGAGGGCCGGGCC
AGGAGGGAAGGCGACTACCGGGGCGGACTGTGCGACATCGTCGGCACCGGCGGCGACTCGCACAACACCTTCAAC
ATCAGCACCACGTCCTCCATCATCGCCTCCGCCCTGCTCCTCGTCTCCAAGCACGGGAACAGGGCCAGCACGTCC
AAGTCGGGCAGCGCCGACATGGTCAACTGCATGAAGCCGCGGGCGCCCGTCATCAGCGCCGTCAGGCCCGACACG
CTGGCCAAGGTGTACTCGCGCACCAACTACAGCTTCCTCTTCGCCCCCGTCTTCCACACGGGCATGCGATACGTG
GCCCCCATCCGCCGGCAGCTTCCCTGGCGGACCATCTTCAACAACCTGGGGCCCCTGGCCAACCCGGTCGACGGC
GTGCTGGAGGCGCGGGTCATTGGCGTCGGCAGACGGGAGCTGGGGCCGCCCTTTTGCGAGGCGCTCAGGAGCGCC
GGCTGCCGCAAGGCGCTGATTGTGTGCGGAGAGGAGGAGCTGGACGAGATCAGCTGCGCGGGCCCGACGCTCTGC
TGGATGCTCAAGGAGGCGTCCGACGGCGGCCAGGTCGAGATGGAGCACTTCAAGATCGAGCCCCGTGATTTCGGG
GTCGGGTCCCATCCGCTCAGCCAGGTATCGCCCGGGATGGAGGCGGTCGAGAACGCGGGCATCCTGAAGCGCATC
CTGTGCGGCGAACTGGCCGACGACGACCCCCTGGTGGAGTTCGTCCTCATCAACACGGCCGCCCTCTTCGTCGTC
TCCGGCATCTGCGAAGCGGACCGCAGCGACATGGGGCACGGAGACGACGGACAGGTCGTGACGGAGCGGGGGCCG
GCCGGCCAGCGCTGGAAAGAAGGCGTGAGGAGGGCCAAGTGGGCGATCAAGAGCGGCGAGGCCTGGAAACAGTGG
CAGGCCTTTGTGGACGTGACCAACGAGATTGCTGCGTAG
Transcript >Hirsu2|7434
ATGGCCTCTGTCCCCATCGGCTCCGGGCAGGATGGGCTCCCGCCCGTCGACATCAAGCCATTGTTGACCAAGCTG
TGGCCGGTCAACTCGGACGTCGACCCGGGCGAGATTGCCGAGGCCATCTCGCACTTTTTCACCAACCAGGTGACG
GAGGCCCAGACGGCCTCGCTGCTGATGGCGCTTCACTTCACCGGCATGGACCTGCGCGCCGACGTCCTGGCCCGG
TGTGCGCATGCCATGATGCACGCCGCGGCGCCGATCCCGCTCGACGAGCTCGGCGCCGTCCTCGAGGGCCGGGCC
AGGAGGGAAGGCGACTACCGGGGCGGACTGTGCGACATCGTCGGCACCGGCGGCGACTCGCACAACACCTTCAAC
ATCAGCACCACGTCCTCCATCATCGCCTCCGCCCTGCTCCTCGTCTCCAAGCACGGGAACAGGGCCAGCACGTCC
AAGTCGGGCAGCGCCGACATGGTCAACTGCATGAAGCCGCGGGCGCCCGTCATCAGCGCCGTCAGGCCCGACACG
CTGGCCAAGGTGTACTCGCGCACCAACTACAGCTTCCTCTTCGCCCCCGTCTTCCACACGGGCATGCGATACGTG
GCCCCCATCCGCCGGCAGCTTCCCTGGCGGACCATCTTCAACAACCTGGGGCCCCTGGCCAACCCGGTCGACGGC
GTGCTGGAGGCGCGGGTCATTGGCGTCGGCAGACGGGAGCTGGGGCCGCCCTTTTGCGAGGCGCTCAGGAGCGCC
GGCTGCCGCAAGGCGCTGATTGTGTGCGGAGAGGAGGAGCTGGACGAGATCAGCTGCGCGGGCCCGACGCTCTGC
TGGATGCTCAAGGAGGCGTCCGACGGCGGCCAGGTCGAGATGGAGCACTTCAAGATCGAGCCCCGTGATTTCGGG
GTCGGGTCCCATCCGCTCAGCCAGGTATCGCCCGGGATGGAGGCGGTCGAGAACGCGGGCATCCTGAAGCGCATC
CTGTGCGGCGAACTGGCCGACGACGACCCCCTGGTGGAGTTCGTCCTCATCAACACGGCCGCCCTCTTCGTCGTC
TCCGGCATCTGCGAAGCGGACCGCAGCGACATGGGGCACGGAGACGACGGACAGGTCGTGACGGAGCGGGGGCCG
GCCGGCCAGCGCTGGAAAGAAGGCGTGAGGAGGGCCAAGTGGGCGATCAAGAGCGGCGAGGCCTGGAAACAGTGG
CAGGCCTTTGTGGACGTGACCAACGAGATTGCTGCGTAG
Gene >Hirsu2|7434
ATGGCCTCTGTCCCCATCGGCTCCGGGCAGGATGGGCTCCCGCCCGTCGACATCAAGCCATTGTTGACCAAGCTG
TGGCCGGTCAACTCGGACGTCGACCCGGGCGAGATTGCCGAGGCCATCTCGCACTTTTTCACCAACCAGGTGACG
GAGGCCCAGACGGCCTCGCTGCTGATGGCGCTTCACTTCACCGGCATGGACCTGCGCGCCGACGTCCTGGCCCGG
TGTGCGCATGCCATGATGCACGCCGCGGCGCCGATCCCGCTCGACGAGCTCGGCGCCGTCCTCGAGGGCCGGGCC
AGGAGGGAAGGCGACTACCGGGGCGGACTGGTAAGGCGCCCGGCGGCCGTGCCACGAGTCGGCGACTGTGACTGA
TGGGGACTGGCTGGCAGTGCGACATCGTCGGCACCGGCGGCGACTCGCACAACACCTTCAACATCAGCACCACGT
CCTCCATCATCGCCTCCGCCCTGCTCCTCGTCTCCAAGCACGGGAACAGGGCCAGCACGTCCAAGTCGGGCAGCG
CCGACATGGTCAACTGCATGAAGCCGCGGGCGCCCGTCATCAGCGCCGTCAGGCCCGACACGCTGGCCAAGGTGT
ACTCGCGCACCAACTACAGCTTCCTCTTCGCCCCCGTCTTCCACACGGGCATGCGATACGTGGCCCCCATCCGCC
GGCAGCTTCCCTGGCGGACCATCTTCAACAACCTGGGGCCCCTGGCCAACCCGGTCGACGGCGTGCTGGAGGCGC
GGGTCATTGGCGTCGGCAGACGGGAGCTGGGGCCGCCCTTTTGCGAGGCGCTCAGGAGCGCCGGCTGCCGCAAGG
CGCTGATTGTGTGCGGAGAGGAGGAGCTGGACGAGATCAGCTGCGCGGGCCCGACGCTCTGCTGGATGCTCAAGG
AGGCGTCCGACGGCGGCCAGGTCGAGATGGAGCACTTCAAGATCGAGCCCCGTGATTTCGGGGTCGGGTCCCATC
CGCTCAGCCAGGTATCGCCCGGGATGGAGGCGGTCGAGAACGCGGGCATCCTGAAGCGCATCCTGTGCGGCGAAC
TGGCCGACGACGACCCCCTGGTGGAGTTCGTCCTCATCAACACGGCCGCCCTCTTCGTCGTCTCCGGCATCTGCG
AAGCGGACCGCAGCGACATGGGGCACGGAGACGACGGACAGGTCGTGACGGAGCGGGGGCCGGCCGGCCAGCGCT
GGAAAGAAGGCGTGAGGAGGGCCAAGTGGGCGATCAAGAGCGGCGAGGCCTGGAAACAGTGGCAGGCCTTTGTGG
ACGTGACCAACGAGATTGCTGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail