Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7432
Gene name
LocationContig_431:7418..8477
Strand-
Gene length (bp)1059
Transcript length (bp)1059
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00710 Asparaginase Asparaginase, N-terminal 5.7E-56 15 204
PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain 3.2E-18 229 338

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CX79|ASP24_YEAST L-asparaginase 2-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASP3-4 PE=1 SV=1 13 338 6.0E-87
sp|Q9UTS7|ASPG2_SCHPO Probable L-asparaginase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.12 PE=3 SV=1 12 339 6.0E-87
sp|P0CZ17|ASP21_YEAST L-asparaginase 2-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASP3-1 PE=1 SV=1 13 338 6.0E-87
sp|P0CX78|ASP23_YEAST L-asparaginase 2-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASP3-3 PE=1 SV=1 13 338 6.0E-87
sp|P0CX77|ASP22_YEAST L-asparaginase 2-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASP3-2 PE=1 SV=1 13 338 6.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CX79|ASP24_YEAST L-asparaginase 2-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASP3-4 PE=1 SV=1 13 338 6.0E-87
sp|Q9UTS7|ASPG2_SCHPO Probable L-asparaginase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.12 PE=3 SV=1 12 339 6.0E-87
sp|P0CZ17|ASP21_YEAST L-asparaginase 2-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASP3-1 PE=1 SV=1 13 338 6.0E-87
sp|P0CX78|ASP23_YEAST L-asparaginase 2-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASP3-3 PE=1 SV=1 13 338 6.0E-87
sp|P0CX77|ASP22_YEAST L-asparaginase 2-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASP3-2 PE=1 SV=1 13 338 6.0E-87
sp|Q8TFF8|ASPG4_SCHPO Probable L-asparaginase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8B6.05c PE=3 SV=1 12 339 1.0E-85
sp|P87015|ASPG1_SCHPO Probable L-asparaginase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.03 PE=3 SV=1 13 339 2.0E-84
sp|Q8NKC0|ASPG3_SCHPO Probable L-asparaginase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB21E7.09 PE=3 SV=1 13 339 2.0E-84
sp|P06608|ASPG_DICCH L-asparaginase OS=Dickeya chrysanthemi GN=ansB PE=1 SV=1 13 341 6.0E-82
sp|P38986|ASPG1_YEAST L-asparaginase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASP1 PE=1 SV=1 13 338 2.0E-75
sp|O34482|ASPG2_BACSU L-asparaginase 2 OS=Bacillus subtilis (strain 168) GN=ansZ PE=2 SV=1 13 341 1.0E-69
sp|P50286|ASPG_WOLSU L-asparaginase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=ansA PE=1 SV=2 14 341 5.0E-63
sp|Q9ZLB9|ASPG_HELPJ Probable L-asparaginase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ansA PE=1 SV=1 13 341 7.0E-61
sp|P10172|ASPQ_ACIGL Glutaminase-asparaginase OS=Acinetobacter glutaminasificans GN=ansB PE=1 SV=1 15 341 7.0E-61
sp|O25424|ASPG_HELPY Probable L-asparaginase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ansA PE=3 SV=1 13 341 7.0E-60
sp|P43843|ASPG2_HAEIN Probable L-asparaginase periplasmic OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ansB PE=1 SV=1 10 341 3.0E-58
sp|P00805|ASPG2_ECOLI L-asparaginase 2 OS=Escherichia coli (strain K12) GN=ansB PE=1 SV=2 13 341 2.0E-54
sp|P10182|ASPQ_PSES7 Glutaminase-asparaginase OS=Pseudomonas sp. (strain ATCC 29598 / 7A) GN=ansB PE=1 SV=2 38 338 2.0E-46
sp|Q88K39|ASPQ_PSEPK Glutaminase-asparaginase OS=Pseudomonas putida (strain KT2440) GN=ansB PE=3 SV=1 38 338 2.0E-44
sp|O68897|ASPQ_PSEFA Glutaminase-asparaginase OS=Pseudomonas fluorescens biotype A GN=ansB PE=3 SV=1 38 338 5.0E-42
sp|Q9I407|ASPQ_PSEAE Glutaminase-asparaginase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ansB PE=1 SV=1 38 338 9.0E-40
sp|Q9RRX9|ASPG_DEIRA Probable L-asparaginase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ansA PE=3 SV=2 13 340 2.0E-32
sp|P30363|ASPG_BACLI L-asparaginase OS=Bacillus licheniformis GN=ansA PE=3 SV=1 15 338 9.0E-32
sp|Q12X65|GATD_METBU Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=gatD PE=3 SV=1 13 345 6.0E-22
sp|A6UPR4|GATD_METVS Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=gatD PE=3 SV=1 13 207 4.0E-21
sp|P9WPX5|ASPG_MYCTU Probable L-asparaginase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ansA PE=1 SV=1 59 341 1.0E-20
sp|P9WPX4|ASPG_MYCTO Probable L-asparaginase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ansA PE=3 SV=1 59 341 1.0E-20
sp|P63628|ASPG_MYCBO Probable L-asparaginase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ansA PE=3 SV=1 59 341 1.0E-20
sp|Q8U0X0|GATD_PYRFU Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gatD PE=3 SV=1 13 187 2.0E-20
sp|O59132|GATD_PYRHO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=gatD PE=3 SV=1 13 187 2.0E-20
sp|Q9V0T9|GATD_PYRAB Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gatD PE=1 SV=1 13 187 3.0E-20
sp|Q46GJ6|GATD_METBF Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gatD PE=3 SV=1 13 315 6.0E-20
sp|P61400|GATD_METMP Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus maripaludis (strain S2 / LL) GN=gatD PE=3 SV=1 13 262 7.0E-20
sp|Q5JI77|GATD_THEKO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gatD PE=3 SV=1 13 262 1.0E-19
sp|Q8PUM7|GATD_METMA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gatD PE=3 SV=1 13 315 3.0E-19
sp|A6VGK5|GATD_METM7 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=gatD PE=3 SV=1 13 187 3.0E-19
sp|O29380|GATD_ARCFU Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gatD PE=3 SV=1 13 202 6.0E-19
sp|A9AA46|GATD_METM6 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=gatD PE=3 SV=1 13 187 1.0E-18
sp|Q9X7E6|ASPG_MYCLE Probable L-asparaginase OS=Mycobacterium leprae (strain TN) GN=ansA PE=3 SV=1 71 341 2.0E-18
sp|Q8TR66|GATD_METAC Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gatD PE=3 SV=1 13 315 2.0E-17
sp|A1RX40|GATD_THEPD Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Thermofilum pendens (strain Hrk 5) GN=gatD PE=3 SV=1 14 338 4.0E-17
sp|A4FWR5|GATD_METM5 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=gatD PE=3 SV=1 13 187 6.0E-17
sp|Q9HP20|GATD_HALSA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gatD PE=3 SV=1 13 333 8.0E-17
sp|B0R6H4|GATD_HALS3 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=gatD PE=3 SV=1 13 333 8.0E-17
sp|Q18GL3|GATD_HALWD Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=gatD PE=3 SV=1 13 330 1.0E-16
sp|P26900|ASPG1_BACSU L-asparaginase 1 OS=Bacillus subtilis (strain 168) GN=ansA PE=2 SV=1 13 339 3.0E-15
sp|O26802|GATD_METTH Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=gatD PE=1 SV=1 13 187 4.0E-15
sp|Q2NEH1|GATD_METST Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=gatD PE=3 SV=1 15 156 1.0E-14
sp|Q9Y9T8|GATD_AERPE Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gatD PE=3 SV=1 15 340 1.0E-14
sp|Q60331|GATD_METJA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=gatD PE=3 SV=1 13 202 3.0E-14
sp|A5UK11|GATD_METS3 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=gatD PE=3 SV=1 15 166 6.0E-12
sp|Q979L8|GATD_THEVO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=gatD PE=3 SV=1 16 340 6.0E-11
sp|P0A962|ASPG1_ECOLI L-asparaginase 1 OS=Escherichia coli (strain K12) GN=ansA PE=1 SV=1 69 187 7.0E-11
sp|P0A963|ASPG1_ECO57 L-asparaginase 1 OS=Escherichia coli O157:H7 GN=ansA PE=3 SV=1 69 187 7.0E-11
sp|Q8TV84|GATD_METKA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=gatD PE=3 SV=1 13 190 1.0E-10
sp|C3NE01|GATD_SULIY Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=gatD PE=3 SV=1 11 341 2.0E-10
sp|C3NHQ2|GATD_SULIN Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=gatD PE=3 SV=1 11 341 2.0E-10
sp|C3MYR5|GATD_SULIM Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=gatD PE=3 SV=1 11 341 2.0E-10
sp|C4KH13|GATD_SULIK Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=gatD PE=3 SV=1 11 341 2.0E-10
sp|P61401|GATD_NANEQ Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Nanoarchaeum equitans (strain Kin4-M) GN=gatD PE=3 SV=1 71 262 2.0E-10
sp|C3N5E7|GATD_SULIA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain M.16.27) GN=gatD PE=3 SV=1 11 341 2.0E-10
sp|C3MPS1|GATD_SULIL Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=gatD PE=3 SV=1 11 341 3.0E-10
sp|Q8ZY04|GATD_PYRAE Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=gatD PE=3 SV=1 15 262 6.0E-10
sp|Q97ZH5|GATD_SULSO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gatD PE=3 SV=1 6 262 8.0E-10
sp|A4YHH3|GATD_METS5 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=gatD PE=3 SV=1 12 153 7.0E-09
sp|Q971W5|GATD_SULTO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=gatD PE=3 SV=1 15 267 8.0E-09
sp|Q4J955|GATD_SULAC Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gatD PE=3 SV=1 15 153 7.0E-08
sp|O88202|LPP60_RAT 60 kDa lysophospholipase OS=Rattus norvegicus GN=Aspg PE=1 SV=1 71 185 4.0E-07
sp|Q9U518|ASPG_DIRIM L-asparaginase OS=Dirofilaria immitis PE=1 SV=1 69 211 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7432
MAKAARPVVAGVLPRVTVLGTGGTIAGSAAGPGQTAGYNCGVLPVGKLIETVPELGRVAELRSEQMVNIGSPDVT
AKDLVRMAQAIETELKGDTDGIVITHGTDTMEESAFFLELTVDSDKPVVLVGAMRPSNAYSADGPMNLLCAVNLA
ASASARKRGVMMVLNDRICSARFTSKTNANSLDAFKAEEQGYLGVFVNSKPVFYYPPCRPLDRAYFDVTGHNAGD
GLPQVDILYGHVDMNPKLFETAAETSRGVVLAGMGAGCWATKAGRKVAEVVKASNYPVVVSRRIASGFVGGDSYY
GLGDCCIGGGLLDAKRCRIQLQLALARGYDRQAIRDLFERWRGAEEEGAGYP*
Coding >Hirsu2|7432
ATGGCGAAGGCGGCGCGGCCTGTGGTGGCCGGCGTACTCCCCAGGGTCACGGTCCTGGGCACGGGCGGCACCATA
GCGGGATCGGCAGCCGGGCCCGGACAGACGGCCGGGTACAACTGCGGCGTGCTGCCGGTGGGCAAGCTCATCGAG
ACGGTGCCGGAGCTGGGCAGGGTGGCGGAGCTGCGAAGTGAGCAGATGGTCAACATCGGCAGCCCCGACGTCACG
GCCAAGGACCTGGTGCGCATGGCGCAGGCGATTGAGACGGAGCTCAAGGGCGACACGGACGGCATCGTCATCACG
CACGGGACGGACACGATGGAAGAGTCGGCCTTCTTCCTCGAGCTGACGGTCGACTCGGACAAGCCGGTGGTGCTG
GTGGGCGCCATGCGTCCGTCGAATGCGTACAGTGCCGACGGGCCCATGAACCTGCTCTGCGCGGTCAACCTGGCG
GCCAGCGCGAGCGCGAGGAAACGAGGCGTCATGATGGTGCTCAACGACCGCATCTGCTCGGCGCGCTTCACGAGC
AAGACAAATGCCAACTCGCTCGATGCGTTCAAGGCCGAGGAGCAGGGTTACCTGGGTGTGTTTGTCAACTCGAAG
CCCGTCTTCTACTATCCTCCGTGCCGGCCGCTGGACCGGGCTTACTTTGACGTGACGGGGCACAATGCGGGGGAC
GGGCTGCCGCAGGTCGACATCCTCTACGGGCACGTCGACATGAACCCGAAGCTCTTCGAGACGGCAGCCGAAACA
TCGCGCGGCGTTGTGCTGGCCGGCATGGGGGCCGGGTGTTGGGCGACCAAGGCGGGCCGCAAAGTAGCCGAGGTG
GTCAAGGCGAGCAACTATCCCGTCGTCGTGAGCCGTCGCATTGCCTCGGGCTTTGTTGGCGGAGACTCATACTAC
GGCCTGGGCGACTGCTGCATCGGAGGCGGCCTGCTGGATGCCAAGAGGTGTCGCATCCAACTTCAGCTCGCCCTA
GCCCGAGGGTACGACCGGCAGGCCATCAGAGACCTTTTCGAGAGATGGAGAGGCGCAGAGGAAGAGGGCGCTGGC
TATCCGTGA
Transcript >Hirsu2|7432
ATGGCGAAGGCGGCGCGGCCTGTGGTGGCCGGCGTACTCCCCAGGGTCACGGTCCTGGGCACGGGCGGCACCATA
GCGGGATCGGCAGCCGGGCCCGGACAGACGGCCGGGTACAACTGCGGCGTGCTGCCGGTGGGCAAGCTCATCGAG
ACGGTGCCGGAGCTGGGCAGGGTGGCGGAGCTGCGAAGTGAGCAGATGGTCAACATCGGCAGCCCCGACGTCACG
GCCAAGGACCTGGTGCGCATGGCGCAGGCGATTGAGACGGAGCTCAAGGGCGACACGGACGGCATCGTCATCACG
CACGGGACGGACACGATGGAAGAGTCGGCCTTCTTCCTCGAGCTGACGGTCGACTCGGACAAGCCGGTGGTGCTG
GTGGGCGCCATGCGTCCGTCGAATGCGTACAGTGCCGACGGGCCCATGAACCTGCTCTGCGCGGTCAACCTGGCG
GCCAGCGCGAGCGCGAGGAAACGAGGCGTCATGATGGTGCTCAACGACCGCATCTGCTCGGCGCGCTTCACGAGC
AAGACAAATGCCAACTCGCTCGATGCGTTCAAGGCCGAGGAGCAGGGTTACCTGGGTGTGTTTGTCAACTCGAAG
CCCGTCTTCTACTATCCTCCGTGCCGGCCGCTGGACCGGGCTTACTTTGACGTGACGGGGCACAATGCGGGGGAC
GGGCTGCCGCAGGTCGACATCCTCTACGGGCACGTCGACATGAACCCGAAGCTCTTCGAGACGGCAGCCGAAACA
TCGCGCGGCGTTGTGCTGGCCGGCATGGGGGCCGGGTGTTGGGCGACCAAGGCGGGCCGCAAAGTAGCCGAGGTG
GTCAAGGCGAGCAACTATCCCGTCGTCGTGAGCCGTCGCATTGCCTCGGGCTTTGTTGGCGGAGACTCATACTAC
GGCCTGGGCGACTGCTGCATCGGAGGCGGCCTGCTGGATGCCAAGAGGTGTCGCATCCAACTTCAGCTCGCCCTA
GCCCGAGGGTACGACCGGCAGGCCATCAGAGACCTTTTCGAGAGATGGAGAGGCGCAGAGGAAGAGGGCGCTGGC
TATCCGTGA
Gene >Hirsu2|7432
ATGGCGAAGGCGGCGCGGCCTGTGGTGGCCGGCGTACTCCCCAGGGTCACGGTCCTGGGCACGGGCGGCACCATA
GCGGGATCGGCAGCCGGGCCCGGACAGACGGCCGGGTACAACTGCGGCGTGCTGCCGGTGGGCAAGCTCATCGAG
ACGGTGCCGGAGCTGGGCAGGGTGGCGGAGCTGCGAAGTGAGCAGATGGTCAACATCGGCAGCCCCGACGTCACG
GCCAAGGACCTGGTGCGCATGGCGCAGGCGATTGAGACGGAGCTCAAGGGCGACACGGACGGCATCGTCATCACG
CACGGGACGGACACGATGGAAGAGTCGGCCTTCTTCCTCGAGCTGACGGTCGACTCGGACAAGCCGGTGGTGCTG
GTGGGCGCCATGCGTCCGTCGAATGCGTACAGTGCCGACGGGCCCATGAACCTGCTCTGCGCGGTCAACCTGGCG
GCCAGCGCGAGCGCGAGGAAACGAGGCGTCATGATGGTGCTCAACGACCGCATCTGCTCGGCGCGCTTCACGAGC
AAGACAAATGCCAACTCGCTCGATGCGTTCAAGGCCGAGGAGCAGGGTTACCTGGGTGTGTTTGTCAACTCGAAG
CCCGTCTTCTACTATCCTCCGTGCCGGCCGCTGGACCGGGCTTACTTTGACGTGACGGGGCACAATGCGGGGGAC
GGGCTGCCGCAGGTCGACATCCTCTACGGGCACGTCGACATGAACCCGAAGCTCTTCGAGACGGCAGCCGAAACA
TCGCGCGGCGTTGTGCTGGCCGGCATGGGGGCCGGGTGTTGGGCGACCAAGGCGGGCCGCAAAGTAGCCGAGGTG
GTCAAGGCGAGCAACTATCCCGTCGTCGTGAGCCGTCGCATTGCCTCGGGCTTTGTTGGCGGAGACTCATACTAC
GGCCTGGGCGACTGCTGCATCGGAGGCGGCCTGCTGGATGCCAAGAGGTGTCGCATCCAACTTCAGCTCGCCCTA
GCCCGAGGGTACGACCGGCAGGCCATCAGAGACCTTTTCGAGAGATGGAGAGGCGCAGAGGAAGAGGGCGCTGGC
TATCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail