Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7431
Gene name
LocationContig_431:239..4587
Strand-
Gene length (bp)4348
Transcript length (bp)4182
Coding sequence length (bp)4182
Protein length (aa) 1394

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 8.0E-66 1071 1321
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 2.9E-22 69 123
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 7.5E-07 850 979
PF13246 Cation_ATPase Cation transport ATPase (P-type) 7.9E-10 604 697
PF00122 E1-E2_ATPase E1-E2 ATPase 2.2E-10 201 418

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 32 1370 0.0E+00
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 180 1321 0.0E+00
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 23 698 4.0E-100
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 70 707 4.0E-98
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 56 702 4.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 32 1370 0.0E+00
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 180 1321 0.0E+00
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 23 698 4.0E-100
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 70 707 4.0E-98
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 56 702 4.0E-96
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 56 702 8.0E-96
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 70 698 5.0E-92
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 70 707 4.0E-91
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 70 698 1.0E-90
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 60 698 1.0E-90
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 56 698 5.0E-90
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 832 1319 1.0E-89
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 832 1280 4.0E-89
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 70 701 9.0E-89
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 832 1319 1.0E-88
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 70 698 2.0E-87
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 759 1273 1.0E-86
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 60 698 1.0E-86
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 73 707 3.0E-86
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 70 707 9.0E-86
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 833 1303 6.0E-83
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 818 1200 4.0E-82
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 818 1200 6.0E-82
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 834 1306 1.0E-81
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 823 1207 4.0E-81
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 70 695 4.0E-81
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 818 1200 5.0E-81
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 830 1240 2.0E-80
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 70 697 4.0E-80
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 833 1303 8.0E-80
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 833 1176 1.0E-79
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 833 1275 2.0E-79
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 70 708 2.0E-79
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 70 702 3.0E-79
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 70 698 8.0E-79
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 70 697 2.0E-78
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 833 1304 4.0E-78
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 833 1304 2.0E-77
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 813 1256 2.0E-77
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 833 1304 1.0E-76
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 70 698 8.0E-76
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 833 1304 1.0E-74
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 826 1218 2.0E-74
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 834 1197 3.0E-74
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 833 1304 3.0E-74
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 824 1307 5.0E-74
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 826 1218 6.0E-74
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 835 1313 7.0E-74
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 834 1307 8.0E-74
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 70 698 1.0E-73
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 70 698 1.0E-73
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 833 1307 1.0E-72
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 70 719 2.0E-72
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 834 1242 2.0E-72
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 834 1302 3.0E-72
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 813 1243 3.0E-72
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 834 1307 5.0E-72
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 813 1236 8.0E-72
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 833 1313 1.0E-71
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 56 487 1.0E-70
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 824 1307 1.0E-70
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 819 1200 2.0E-69
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 26 553 3.0E-69
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 835 1304 1.0E-68
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 70 487 2.0E-68
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 26 503 3.0E-68
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 839 1335 2.0E-67
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 833 1264 2.0E-67
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 838 1185 6.0E-67
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 839 1346 1.0E-65
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 70 487 1.0E-65
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 824 1321 2.0E-65
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 212 698 3.0E-64
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 69 698 5.0E-64
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 66 494 5.0E-64
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 834 1307 1.0E-63
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 70 487 5.0E-63
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 70 503 6.0E-63
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 73 487 9.0E-63
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 42 483 1.0E-62
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 70 501 2.0E-62
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 65 494 2.0E-62
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 834 1307 3.0E-62
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 70 504 1.0E-61
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 66 487 2.0E-61
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 174 699 9.0E-61
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 66 506 4.0E-58
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 64 484 1.0E-56
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 838 1280 2.0E-56
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 64 484 4.0E-55
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 837 1274 4.0E-54
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 837 1272 5.0E-53
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 837 1272 1.0E-52
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 837 1203 2.0E-52
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 837 1272 2.0E-52
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 837 1203 2.0E-52
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 73 743 4.0E-52
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 73 743 5.0E-52
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 837 1203 7.0E-52
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 70 748 1.0E-51
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 45 694 1.0E-50
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 73 737 3.0E-50
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 73 490 2.0E-49
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 73 737 4.0E-49
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 988 1198 2.0E-48
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 837 1321 2.0E-48
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 837 1274 6.0E-47
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 65 793 1.0E-46
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 65 793 2.0E-46
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 997 1257 2.0E-42
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 70 516 5.0E-36
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 22 152 1.0E-24
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 835 940 2.0E-22
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 838 940 1.0E-21
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 577 698 2.0E-20
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 574 698 2.0E-20
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 590 702 5.0E-20
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 595 698 9.0E-20
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 595 698 3.0E-19
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 575 698 5.0E-19
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 575 698 1.0E-18
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 586 699 1.0E-18
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 574 699 3.0E-16
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 587 698 3.0E-15
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 588 694 1.0E-14
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 580 721 3.0E-13
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 594 721 3.0E-12
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 595 696 6.0E-12
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 822 1067 3.0E-11
sp|Q5ZKB7|AT134_CHICK Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 868 1067 4.0E-10
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 612 699 2.0E-09
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 604 698 2.0E-09
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 72 156 3.0E-09
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 852 1067 3.0E-09
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 835 1071 8.0E-09
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 549 702 2.0E-08
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 835 1071 2.0E-08
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 833 1071 2.0E-08
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 884 1067 4.0E-08
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 612 702 9.0E-08
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 603 751 1.0E-07
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 604 699 1.0E-07
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 73 148 1.0E-07
sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 888 1066 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 356 378 22
2 399 421 22
3 1136 1155 19
4 1185 1204 19
5 1219 1241 22
6 1248 1265 17
7 1295 1317 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7431
MSTTQSTTTEKHSVYDSVHLAPSPTPFNHATIADFVLCRKRSQASKHGRCIPLAIERQTPLIDARRGCAYISNNV
RTSRYTIWDFVPKQLFFQFSRIGNFYFLCVAIPQTIPGLSTTGNFTTMLPLCFFVLVTMAKEGYDDYRRHRLDKI
ENANLATVLGRESKYADGAESHGPLSRWNPFRTKTTGRPRSAPADDIQGVGWVPVRWSHVKVGDIVLLSRDEPVP
ADLVLLHSDDEDGVAYIDTMALDGETNLKSKQVCHALEGCNSIKGIASCPAQFAVEDPNPNLFDFKGRVAVGDKA
APLTPNHVIYRGSVMRNTTCAMGLVINTGEECKVRMNANQHPTAKRPALEKIVNRVVIILAIYVMVLSVGIATGY
LKWQSDFERKAWYLDRAAVPFHQILIAFVIMFNNIVPLSLYITLEIIKVGQLLLVNSDVNMYHEETDTPARCNTN
TILENLGQVGYIFSDKTGTLTDNIMKFRKLSVAGTVWLHEMDLQPSEPDQNPVPTPRDGLPSLRPLPDKAGPSTL
VIPEDYSDAAETPTSPARSSLGHRPSSHWRSTGRPDHVQPEVNTSDLLDYMRSRPHSAFSRKARECMISVAICHT
CLPEHKDGSIEYQASSPDELALVKASQELGYQVTNRTSQSMTLQVPRPNGQVDKMVFQILDVIEFSSTRKRMSII
VRYPDGRISLICKGADSAILPRLKLSSLAMQKAGEVRKSADLEREMHRRSEQQEPRNSFGGRPSLTVHRNHGVMR
DASLSRRPVASRSKSFEINKLARSSVDRVRVSLSSPRGASLDVSRAQFANPPALHSRSAHDRMDFLDDPSIFDES
EVFTRCFKHIDDFATEGLRTLIYAQKFISEQEYIEWKGLYDEATTSLDNRQEMIEAAGEKIEQSFDLVGATAIED
KLQRGVPETIDKLRRANIRIWMLTGDKRETAINIAHSARICRPASDLFVLDATKGSLWSQLAALAEDLQEGSVHS
VMVVDGQTLAAVEKSAELSQRFFDLAVLVDSVICCRAAPAQKALLVRAVRSRLCAAKGKHRHGLTLAIGDGANDI
AMIQESHVGIGISGQEGLQAARIADYSIAQFRFLQRMLLVHGRWNYIRTAKFILCTFWKELFFYLPAAQFQRLNG
YSGTSLFQETSLTVFNTLFTSLCTICMGIWEQDLRAETLLAVPELYVYGQRDLGLNMSKYLRWMFLACVEGVIVF
HGAWAGYGLIEPGIRDSGLYPLGTLVFTLAVFWINWKLLIFETHYKTAIVIGSFFLTTVGWWAWLSFLDEVFPLM
PSGPNAVHDSFTKHWGQDAAWWATVFLVLTVLGAIGACGKVVKRQMLLAGFWQWPPWRRRRRLSDNVEEWDLELW
QELEQDPVVREQLRALARDEGSPADEAAAAEDGAEPGTATAKA*
Coding >Hirsu2|7431
ATGTCCACGACTCAATCCACCACCACCGAGAAACACTCCGTCTACGATTCCGTCCACTTGGCCCCCAGTCCGACT
CCCTTCAACCACGCCACCATCGCCGACTTCGTTCTGTGCCGAAAGCGCTCCCAGGCCTCCAAGCATGGGCGATGC
ATTCCCCTCGCCATTGAGCGCCAGACGCCCTTAATCGACGCCCGACGTGGTTGCGCATACATCTCCAACAATGTC
CGGACTTCTCGCTATACCATCTGGGACTTTGTCCCAAAACAGCTTTTTTTTCAGTTCTCCCGCATCGGAAACTTC
TATTTCCTCTGCGTCGCCATTCCCCAGACCATACCGGGCCTGTCCACCACTGGTAACTTTACCACAATGTTGCCC
CTCTGCTTCTTCGTCCTTGTTACCATGGCGAAGGAGGGCTACGATGACTACAGGAGACATCGCTTGGACAAGATC
GAGAATGCCAATCTCGCCACTGTTCTCGGCCGCGAGAGCAAGTACGCCGACGGAGCCGAGTCACACGGTCCCCTG
AGCCGCTGGAATCCCTTTCGCACCAAGACAACTGGCCGGCCCAGATCAGCCCCGGCTGATGACATCCAGGGCGTC
GGCTGGGTGCCGGTCAGATGGAGCCATGTTAAGGTCGGCGATATCGTCCTGCTATCCCGCGATGAGCCGGTTCCT
GCCGACCTGGTTCTGCTCCACAGCGATGACGAGGATGGCGTCGCATACATCGACACCATGGCACTGGACGGCGAG
ACGAACCTCAAGTCCAAGCAGGTCTGCCACGCTCTCGAGGGTTGCAATTCGATCAAGGGCATAGCATCTTGCCCC
GCCCAATTCGCCGTCGAAGATCCAAACCCCAATCTATTTGACTTCAAGGGCCGTGTCGCCGTCGGCGACAAGGCG
GCGCCGCTCACTCCCAACCACGTCATCTATCGCGGGAGCGTGATGCGCAACACCACCTGCGCCATGGGTCTGGTC
ATCAACACGGGCGAAGAGTGCAAGGTCAGAATGAATGCGAATCAGCACCCCACCGCGAAACGCCCAGCTCTCGAG
AAGATTGTCAACAGAGTCGTCATCATCCTGGCCATCTACGTGATGGTCCTGTCAGTCGGCATCGCCACGGGCTAC
TTAAAGTGGCAGAGCGACTTCGAACGAAAGGCTTGGTATCTCGATCGCGCCGCTGTTCCCTTCCACCAGATCCTC
ATTGCATTTGTCATCATGTTCAACAACATCGTACCCTTGTCCCTGTACATCACCTTAGAGATCATCAAGGTCGGA
CAGCTCTTACTTGTCAACTCGGACGTGAACATGTATCACGAGGAGACGGACACTCCGGCACGATGCAACACAAAT
ACCATTTTGGAGAACCTGGGGCAGGTTGGCTACATCTTCTCCGACAAGACCGGAACTTTGACGGACAACATCATG
AAGTTCCGCAAGCTCAGTGTCGCCGGCACCGTTTGGCTGCACGAGATGGACCTCCAGCCGTCCGAGCCGGATCAG
AACCCCGTCCCGACGCCCCGCGACGGGCTCCCCTCGCTGAGGCCGCTTCCCGATAAGGCCGGGCCCAGCACCTTG
GTCATCCCGGAGGATTATAGCGACGCGGCCGAAACGCCCACGTCACCCGCCAGGTCGTCCTTGGGCCACAGGCCA
TCGTCCCACTGGCGGTCGACTGGTCGTCCCGACCATGTCCAACCCGAAGTCAACACGTCGGATCTCCTGGATTAC
ATGCGATCCCGTCCGCACTCGGCTTTCTCTAGGAAGGCGAGAGAGTGCATGATTTCTGTCGCCATCTGCCATACC
TGTCTGCCCGAACACAAGGACGGCAGTATCGAGTACCAGGCATCGTCACCCGATGAGCTGGCCCTAGTGAAGGCG
TCACAGGAACTCGGCTACCAGGTGACGAACCGCACGTCGCAATCCATGACCCTGCAGGTCCCGCGGCCGAATGGC
CAGGTCGATAAGATGGTCTTCCAGATCTTGGATGTGATTGAGTTCAGCAGTACGCGCAAGAGAATGTCCATCATC
GTCCGCTATCCCGACGGGCGCATCTCCCTCATTTGCAAGGGCGCCGATTCGGCTATCCTGCCACGACTGAAACTT
TCCTCGCTGGCCATGCAAAAGGCAGGCGAGGTCCGCAAGAGTGCCGATCTCGAGCGCGAGATGCATCGCCGTAGT
GAGCAGCAGGAGCCCCGGAATAGCTTTGGCGGGAGGCCGAGCCTGACCGTCCATCGCAACCACGGAGTTATGAGG
GACGCGAGCTTGAGTCGGCGGCCGGTCGCCAGCAGAAGCAAGTCGTTCGAGATTAACAAGCTCGCCCGATCGTCC
GTCGACCGAGTTCGAGTCTCGCTCTCCTCCCCGCGCGGCGCCTCACTCGATGTGTCGCGCGCTCAGTTTGCGAAT
CCGCCAGCTCTCCACTCGCGGTCCGCGCATGATCGCATGGATTTCCTGGACGACCCCTCCATCTTCGACGAGTCG
GAAGTCTTCACAAGGTGTTTCAAGCACATCGACGACTTTGCAACAGAGGGCCTCCGGACGCTGATCTACGCTCAA
AAGTTCATCTCGGAGCAGGAGTATATTGAGTGGAAAGGGCTCTACGACGAAGCGACGACGAGCCTCGACAACCGG
CAGGAGATGATTGAAGCCGCCGGAGAAAAGATTGAGCAGTCGTTCGACCTCGTCGGTGCCACCGCTATCGAGGAC
AAACTTCAGCGTGGCGTGCCCGAGACTATCGACAAGCTGCGACGTGCCAACATCAGGATATGGATGCTCACTGGC
GACAAGCGCGAAACGGCCATCAACATTGCTCATTCGGCGCGCATATGCCGGCCCGCTTCGGATCTGTTCGTCCTG
GACGCGACCAAGGGCTCTCTATGGTCGCAGCTCGCTGCCTTGGCCGAAGACCTGCAAGAGGGTTCCGTCCACAGC
GTCATGGTCGTCGACGGGCAGACTCTGGCAGCCGTGGAGAAGTCGGCCGAGCTATCACAGAGGTTTTTTGACCTC
GCCGTTCTCGTCGACTCCGTCATATGCTGCCGGGCCGCGCCGGCCCAGAAGGCGTTATTGGTGCGGGCTGTGCGC
TCTCGCCTGTGTGCTGCCAAGGGAAAGCATCGCCACGGGTTGACGCTGGCCATTGGCGATGGCGCAAACGACATC
GCCATGATCCAAGAAAGTCACGTTGGCATAGGAATCTCGGGACAGGAGGGCCTGCAGGCGGCGCGCATCGCCGAC
TACTCCATAGCGCAGTTCCGGTTTCTGCAGAGGATGCTCCTCGTCCACGGGCGCTGGAACTACATCCGGACCGCA
AAGTTCATCCTCTGCACCTTCTGGAAAGAGCTGTTTTTCTATCTCCCGGCCGCACAGTTCCAAAGACTTAATGGT
TACAGCGGCACCTCGCTGTTCCAGGAGACGAGCCTGACCGTCTTCAACACGCTCTTCACCAGTCTCTGCACCATC
TGTATGGGCATCTGGGAGCAGGACCTGAGAGCCGAAACGCTGCTCGCCGTGCCGGAGCTCTACGTGTACGGGCAG
CGCGACCTGGGGCTGAACATGAGCAAATATCTGCGCTGGATGTTCCTGGCATGCGTGGAAGGCGTCATTGTCTTT
CACGGCGCCTGGGCAGGCTACGGATTGATCGAGCCGGGCATCCGCGACTCGGGTCTGTACCCCCTGGGGACGCTC
GTCTTCACGTTGGCGGTCTTCTGGATCAACTGGAAGCTACTCATTTTCGAGACGCACTACAAGACGGCCATCGTC
ATCGGCTCCTTCTTCCTCACGACCGTGGGCTGGTGGGCCTGGCTCTCCTTCCTCGACGAAGTCTTCCCGCTGATG
CCTTCGGGGCCCAACGCCGTCCACGACTCGTTCACCAAGCACTGGGGCCAGGACGCAGCCTGGTGGGCGACGGTC
TTCCTCGTCCTCACCGTCCTCGGCGCGATCGGGGCCTGTGGCAAGGTGGTCAAGCGGCAGATGCTCCTGGCCGGC
TTCTGGCAGTGGCCGCCGTGGCGGAGACGGCGGAGGCTGAGCGACAATGTGGAGGAGTGGGACCTGGAGCTGTGG
CAGGAGCTGGAGCAGGACCCGGTCGTGCGCGAGCAGCTGAGGGCCCTGGCCCGGGACGAGGGCTCGCCGGCCGAC
GAGGCGGCGGCCGCGGAGGACGGGGCCGAGCCCGGGACGGCCACGGCCAAGGCCTGA
Transcript >Hirsu2|7431
ATGTCCACGACTCAATCCACCACCACCGAGAAACACTCCGTCTACGATTCCGTCCACTTGGCCCCCAGTCCGACT
CCCTTCAACCACGCCACCATCGCCGACTTCGTTCTGTGCCGAAAGCGCTCCCAGGCCTCCAAGCATGGGCGATGC
ATTCCCCTCGCCATTGAGCGCCAGACGCCCTTAATCGACGCCCGACGTGGTTGCGCATACATCTCCAACAATGTC
CGGACTTCTCGCTATACCATCTGGGACTTTGTCCCAAAACAGCTTTTTTTTCAGTTCTCCCGCATCGGAAACTTC
TATTTCCTCTGCGTCGCCATTCCCCAGACCATACCGGGCCTGTCCACCACTGGTAACTTTACCACAATGTTGCCC
CTCTGCTTCTTCGTCCTTGTTACCATGGCGAAGGAGGGCTACGATGACTACAGGAGACATCGCTTGGACAAGATC
GAGAATGCCAATCTCGCCACTGTTCTCGGCCGCGAGAGCAAGTACGCCGACGGAGCCGAGTCACACGGTCCCCTG
AGCCGCTGGAATCCCTTTCGCACCAAGACAACTGGCCGGCCCAGATCAGCCCCGGCTGATGACATCCAGGGCGTC
GGCTGGGTGCCGGTCAGATGGAGCCATGTTAAGGTCGGCGATATCGTCCTGCTATCCCGCGATGAGCCGGTTCCT
GCCGACCTGGTTCTGCTCCACAGCGATGACGAGGATGGCGTCGCATACATCGACACCATGGCACTGGACGGCGAG
ACGAACCTCAAGTCCAAGCAGGTCTGCCACGCTCTCGAGGGTTGCAATTCGATCAAGGGCATAGCATCTTGCCCC
GCCCAATTCGCCGTCGAAGATCCAAACCCCAATCTATTTGACTTCAAGGGCCGTGTCGCCGTCGGCGACAAGGCG
GCGCCGCTCACTCCCAACCACGTCATCTATCGCGGGAGCGTGATGCGCAACACCACCTGCGCCATGGGTCTGGTC
ATCAACACGGGCGAAGAGTGCAAGGTCAGAATGAATGCGAATCAGCACCCCACCGCGAAACGCCCAGCTCTCGAG
AAGATTGTCAACAGAGTCGTCATCATCCTGGCCATCTACGTGATGGTCCTGTCAGTCGGCATCGCCACGGGCTAC
TTAAAGTGGCAGAGCGACTTCGAACGAAAGGCTTGGTATCTCGATCGCGCCGCTGTTCCCTTCCACCAGATCCTC
ATTGCATTTGTCATCATGTTCAACAACATCGTACCCTTGTCCCTGTACATCACCTTAGAGATCATCAAGGTCGGA
CAGCTCTTACTTGTCAACTCGGACGTGAACATGTATCACGAGGAGACGGACACTCCGGCACGATGCAACACAAAT
ACCATTTTGGAGAACCTGGGGCAGGTTGGCTACATCTTCTCCGACAAGACCGGAACTTTGACGGACAACATCATG
AAGTTCCGCAAGCTCAGTGTCGCCGGCACCGTTTGGCTGCACGAGATGGACCTCCAGCCGTCCGAGCCGGATCAG
AACCCCGTCCCGACGCCCCGCGACGGGCTCCCCTCGCTGAGGCCGCTTCCCGATAAGGCCGGGCCCAGCACCTTG
GTCATCCCGGAGGATTATAGCGACGCGGCCGAAACGCCCACGTCACCCGCCAGGTCGTCCTTGGGCCACAGGCCA
TCGTCCCACTGGCGGTCGACTGGTCGTCCCGACCATGTCCAACCCGAAGTCAACACGTCGGATCTCCTGGATTAC
ATGCGATCCCGTCCGCACTCGGCTTTCTCTAGGAAGGCGAGAGAGTGCATGATTTCTGTCGCCATCTGCCATACC
TGTCTGCCCGAACACAAGGACGGCAGTATCGAGTACCAGGCATCGTCACCCGATGAGCTGGCCCTAGTGAAGGCG
TCACAGGAACTCGGCTACCAGGTGACGAACCGCACGTCGCAATCCATGACCCTGCAGGTCCCGCGGCCGAATGGC
CAGGTCGATAAGATGGTCTTCCAGATCTTGGATGTGATTGAGTTCAGCAGTACGCGCAAGAGAATGTCCATCATC
GTCCGCTATCCCGACGGGCGCATCTCCCTCATTTGCAAGGGCGCCGATTCGGCTATCCTGCCACGACTGAAACTT
TCCTCGCTGGCCATGCAAAAGGCAGGCGAGGTCCGCAAGAGTGCCGATCTCGAGCGCGAGATGCATCGCCGTAGT
GAGCAGCAGGAGCCCCGGAATAGCTTTGGCGGGAGGCCGAGCCTGACCGTCCATCGCAACCACGGAGTTATGAGG
GACGCGAGCTTGAGTCGGCGGCCGGTCGCCAGCAGAAGCAAGTCGTTCGAGATTAACAAGCTCGCCCGATCGTCC
GTCGACCGAGTTCGAGTCTCGCTCTCCTCCCCGCGCGGCGCCTCACTCGATGTGTCGCGCGCTCAGTTTGCGAAT
CCGCCAGCTCTCCACTCGCGGTCCGCGCATGATCGCATGGATTTCCTGGACGACCCCTCCATCTTCGACGAGTCG
GAAGTCTTCACAAGGTGTTTCAAGCACATCGACGACTTTGCAACAGAGGGCCTCCGGACGCTGATCTACGCTCAA
AAGTTCATCTCGGAGCAGGAGTATATTGAGTGGAAAGGGCTCTACGACGAAGCGACGACGAGCCTCGACAACCGG
CAGGAGATGATTGAAGCCGCCGGAGAAAAGATTGAGCAGTCGTTCGACCTCGTCGGTGCCACCGCTATCGAGGAC
AAACTTCAGCGTGGCGTGCCCGAGACTATCGACAAGCTGCGACGTGCCAACATCAGGATATGGATGCTCACTGGC
GACAAGCGCGAAACGGCCATCAACATTGCTCATTCGGCGCGCATATGCCGGCCCGCTTCGGATCTGTTCGTCCTG
GACGCGACCAAGGGCTCTCTATGGTCGCAGCTCGCTGCCTTGGCCGAAGACCTGCAAGAGGGTTCCGTCCACAGC
GTCATGGTCGTCGACGGGCAGACTCTGGCAGCCGTGGAGAAGTCGGCCGAGCTATCACAGAGGTTTTTTGACCTC
GCCGTTCTCGTCGACTCCGTCATATGCTGCCGGGCCGCGCCGGCCCAGAAGGCGTTATTGGTGCGGGCTGTGCGC
TCTCGCCTGTGTGCTGCCAAGGGAAAGCATCGCCACGGGTTGACGCTGGCCATTGGCGATGGCGCAAACGACATC
GCCATGATCCAAGAAAGTCACGTTGGCATAGGAATCTCGGGACAGGAGGGCCTGCAGGCGGCGCGCATCGCCGAC
TACTCCATAGCGCAGTTCCGGTTTCTGCAGAGGATGCTCCTCGTCCACGGGCGCTGGAACTACATCCGGACCGCA
AAGTTCATCCTCTGCACCTTCTGGAAAGAGCTGTTTTTCTATCTCCCGGCCGCACAGTTCCAAAGACTTAATGGT
TACAGCGGCACCTCGCTGTTCCAGGAGACGAGCCTGACCGTCTTCAACACGCTCTTCACCAGTCTCTGCACCATC
TGTATGGGCATCTGGGAGCAGGACCTGAGAGCCGAAACGCTGCTCGCCGTGCCGGAGCTCTACGTGTACGGGCAG
CGCGACCTGGGGCTGAACATGAGCAAATATCTGCGCTGGATGTTCCTGGCATGCGTGGAAGGCGTCATTGTCTTT
CACGGCGCCTGGGCAGGCTACGGATTGATCGAGCCGGGCATCCGCGACTCGGGTCTGTACCCCCTGGGGACGCTC
GTCTTCACGTTGGCGGTCTTCTGGATCAACTGGAAGCTACTCATTTTCGAGACGCACTACAAGACGGCCATCGTC
ATCGGCTCCTTCTTCCTCACGACCGTGGGCTGGTGGGCCTGGCTCTCCTTCCTCGACGAAGTCTTCCCGCTGATG
CCTTCGGGGCCCAACGCCGTCCACGACTCGTTCACCAAGCACTGGGGCCAGGACGCAGCCTGGTGGGCGACGGTC
TTCCTCGTCCTCACCGTCCTCGGCGCGATCGGGGCCTGTGGCAAGGTGGTCAAGCGGCAGATGCTCCTGGCCGGC
TTCTGGCAGTGGCCGCCGTGGCGGAGACGGCGGAGGCTGAGCGACAATGTGGAGGAGTGGGACCTGGAGCTGTGG
CAGGAGCTGGAGCAGGACCCGGTCGTGCGCGAGCAGCTGAGGGCCCTGGCCCGGGACGAGGGCTCGCCGGCCGAC
GAGGCGGCGGCCGCGGAGGACGGGGCCGAGCCCGGGACGGCCACGGCCAAGGCCTGA
Gene >Hirsu2|7431
ATGTCCACGACTCAATCCACCACCACCGAGAAACACTCCGTCTACGATTCCGTCCACTTGGCCCCCAGTCCGACT
CCCTTCAACCACGGTGCTTCCTCAAGGCCGTCTCTGCGGGCCCGTCTTCGACGCTCGCTCGGCGCTGTCTCTCCA
GCCACCATCGCCGACTTCGTTCTGTGCCGAAAGCGCTCCCAGGCCTCCAAGCATGGGCGATGCATTCCCCTCGCC
ATTGAGCGCCAGACGCCCTTAATCGACGCCCGACGTGGTTGCGCATACATCTCCAACAATGTCCGGACTTCTCGC
TATACCATCTGGGACTTTGTCCCAAAACAGCTTTTTTTTCAGTTCTCCCGCATCGGAAACTTCTATTTCCTCTGC
GTCGCCATTCCCCAGACCGTATGTGTCCCTTGACTGCTTCTCGGGGCCGCTGCTGACTGCCGACCAAGATACCGG
GCCTGTCCACCACTGGTAACTTTACCACAATGTTGCCCCTCTGCTTCTTCGTCCTTGTTACCATGGCGAAGGAGG
GCTACGATGACTACAGGAGACATCGCTTGGACAAGATCGAGAATGCCAATCTCGCCACTGTTCTCGGCCGCGAGA
GCAAGTACGCCGACGGAGCCGAGTCACACGGTCCCCTGAGCCGCTGGAATCCCTTTCGCACCAAGACAACTGGCC
GGCCCAGATCAGCCCCGGCTGATGACATCCAGGGCGTCGGCTGGGTGCCGGTCAGATGGAGCCATGTTAAGGTCG
GCGATATCGTCCTGCTATCCCGCGATGAGCCGGTTCCTGCCGACCTGGTTCTGCTCCACAGCGATGACGAGGATG
GCGTCGCATACATCGACACCATGGCACTGGACGGCGAGACGAACCTCAAGTCCAAGCAGGTCTGCCACGCTCTCG
AGGGTTGCAATTCGATCAAGGGCATAGCATCTTGCCCCGCCCAATTCGCCGTCGAAGATCCAAACCCCAATCTAT
TTGACTTCAAGGGCCGTGTCGCCGTCGGCGACAAGGCGGCGCCGCTCACTCCCAACCACGTCATCTATCGCGGGA
GCGTGATGCGCAACACCACCTGCGCCATGGGTCTGGTCATCAACACGGGCGAAGAGTGCAAGGTCAGAATGAATG
CGAATCAGCACCCCACCGCGAAACGCCCAGCTCTCGAGAAGATTGTCAACAGAGTCGTCATCATCCTGGCCATCT
ACGTGATGGTCCTGTCAGTCGGCATCGCCACGGGCTACTTAAAGTGGCAGAGCGACTTCGAACGAAAGGCTTGGT
ATCTCGATCGCGCCGCTGTTCCCTTCCACCAGATCCTCATTGCATTTGTCATCATGTTCAACAACATCGTACCCT
TGTCCCTGTACATCACCTTAGAGATCATCAAGGTCGGACAGCTCTTACTTGTCAACTCGGACGTGAACATGTATC
ACGAGGAGACGGACACTCCGGCACGATGCAACACAAATACCATTTTGGAGAACCTGGGGCAGGTTGGCTACATCT
TCTCCGACAAGACCGGAACTTTGACGGACAACATCATGAAGTTCCGCAAGCTCAGTGTCGCCGGCACCGTTTGGC
TGCACGAGATGGACCTCCAGCCGTCCGAGCCGGATCAGAACCCCGTCCCGACGCCCCGCGACGGGCTCCCCTCGC
TGAGGCCGCTTCCCGATAAGGCCGGGCCCAGCACCTTGGTCATCCCGGAGGATTATAGCGACGCGGCCGAAACGC
CCACGTCACCCGCCAGGTCGTCCTTGGGCCACAGGCCATCGTCCCACTGGCGGTCGACTGGTCGTCCCGACCATG
TCCAACCCGAAGTCAACACGTCGGATCTCCTGGATTACATGCGATCCCGTCCGCACTCGGCTTTCTCTAGGAAGG
CGAGAGAGTGCATGATTTCTGTCGCCATCTGCCATACCTGTCTGCCCGAACACAAGGACGGCAGTATCGAGTACC
AGGCATCGTCACCCGATGAGCTGGCCCTAGTGAAGGCGTCACAGGAACTCGGCTACCAGGTGACGAACCGCACGT
CGCAATCCATGACCCTGCAGGTCCCGCGGCCGAATGGCCAGGTCGATAAGATGGTCTTCCAGATCTTGGATGTGA
TTGAGTTCAGCAGTACGCGCAAGAGAATGTCCATCATCGTCCGCTATCCCGACGGGCGCATCTCCCTCATTTGCA
AGGGCGCCGATTCGGCTATCCTGCCACGACTGAAACTTTCCTCGCTGGCCATGCAAAAGGCAGGCGAGGTCCGCA
AGAGTGCCGATCTCGAGCGCGAGATGCATCGCCGTAGTGAGCAGCAGGAGCCCCGGAATAGCTTTGGCGGGAGGC
CGAGCCTGACCGTCCATCGCAACCACGGAGTTATGAGGGACGCGAGCTTGAGTCGGCGGCCGGTCGCCAGCAGAA
GCAAGTCGTTCGAGATTAACAAGCTCGCCCGATCGTCCGTCGACCGAGTTCGAGTCTCGCTCTCCTCCCCGCGCG
GCGCCTCACTCGATGTGTCGCGCGCTCAGTTTGCGAATCCGCCAGCTCTCCACTCGCGGTCCGCGCATGATCGCA
TGGATTTCCTGGACGACCCCTCCATCTTCGACGAGTCGGAAGTCTTCACAAGGTGTTTCAAGCACATCGACGACT
TTGCAACAGAGGGCCTCCGGACGCTGATCTACGCTCAAAAGTTCATCTCGGAGCAGGAGTATATTGAGTGGAAAG
GGCTCTACGACGAAGCGACGACGAGCCTCGACAACCGGCAGGAGATGATTGAAGCCGCCGGAGAAAAGATTGAGC
AGTCGTTCGACCTCGTCGGTGCCACCGCTATCGAGGACAAACTTCAGCGTGGCGTGCCCGAGACTATCGACAAGC
TGCGACGTGCCAACATCAGGATATGGATGCTCACTGGCGACAAGCGCGAAACGGCCATCAACATTGCTCATTCGG
CGCGCATATGCCGGCCCGCTTCGGATCTGTTCGTCCTGGACGCGACCAAGGGCTCTCTATGGTCGCAGCTCGCTG
CCTTGGCCGAAGACCTGCAAGAGGGTTCCGTCCACAGCGTCATGGTCGTCGACGGGCAGACTCTGGCAGCCGTGG
AGAAGTCGGCCGAGCTATCACAGAGGTTTTTTGACCTCGCCGTTCTCGTCGACTCCGTCATATGCTGCCGGGCCG
CGCCGGCCCAGAAGGCGTTATTGGTGCGGGCTGTGCGCTCTCGCCTGTGTGCTGCCAAGGGAAAGCATCGCCACG
GGTTGACGCTGGCCATTGGCGATGGCGCAAACGACATCGCCATGATCCAAGAAAGTCACGTTGGCATAGGAATCT
CGGGACAGGAGGGCCTGCAGGCGGCGCGCATCGCCGACTACTCCATAGCGCAGTTCCGGTTTCTGCAGAGGATGC
TCCTCGTCCACGGGCGCTGGAACTACATCCGGACCGCAAAGTTCATCCTCTGCACCTTCTGGAAAGAGCTGTTTT
TCTATCTCCCGGCCGCACAGTTCCAAAGACTTAATGGTTACAGCGGCACCTCGCTGTTCCAGGAGACGAGCCTGA
CCGTCTTCAACACGCTCTTCACCAGTCTCTGCACCATCTGTATGGGCATCTGGGAGCAGGACCTGAGAGCCGAAA
CGCTGCTCGCCGTGCCGGAGCTCTACGTGTACGGGCAGCGCGACCTGGGGCTGAACATGAGCAAATATCTGCGCT
GGATGTTCCTGGCATGCGTGGAAGGCGTCATTGTCTTTCACGGCGCCTGGGCAGGCTACGGATTGATCGAGCCGG
GCATCCGCGACTCGGGTCTGTACCCCCTGGGGACGCTCGTCTTCACGTTGGCGGTCTTCTGGATCAACTGGAAGC
TACTGTGAGTTGGACGGACGGACGGGAGAGGAGACGACGAGACTGACGGCGCGGCAGCATTTTCGAGACGCACTA
CAAGACGGCCATCGTCATCGGCTCCTTCTTCCTCACGACCGTGGGCTGGTGGGCCTGGCTCTCCTTCCTCGACGA
AGTCTTCCCGCTGATGCCTTCGGGGCCCAACGCCGTCCACGACTCGTTCACCAAGCACTGGGGCCAGGACGCAGC
CTGGTGGGCGACGGTCTTCCTCGTCCTCACCGTCCTCGGCGCGATCGGGGCCTGTGGCAAGGTGGTCAAGCGGCA
GATGCTCCTGGCCGGCTTCTGGCAGTGGCCGCCGTGGCGGAGACGGCGGAGGCTGAGCGACAATGTGGAGGAGTG
GGACCTGGAGCTGTGGCAGGAGCTGGAGCAGGACCCGGTCGTGCGCGAGCAGCTGAGGGCCCTGGCCCGGGACGA
GGGCTCGCCGGCCGACGAGGCGGCGGCCGCGGAGGACGGGGCCGAGCCCGGGACGGCCACGGCCAAGGCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail