Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7425
Gene name
LocationContig_430:5211..7053
Strand+
Gene length (bp)1842
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.4E-42 72 453
PF00083 Sugar_tr Sugar (and other) transporter 8.0E-13 97 315
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 5.1E-07 48 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 4 500 7.0E-99
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 52 500 3.0E-94
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 14 498 2.0E-93
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 52 498 2.0E-88
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 44 498 1.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 4 500 7.0E-99
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 52 500 3.0E-94
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 14 498 2.0E-93
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 52 498 2.0E-88
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 44 498 1.0E-83
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 18 496 4.0E-82
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 26 496 7.0E-82
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 36 500 2.0E-76
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 4 500 9.0E-76
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 2 500 6.0E-73
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 2 499 3.0E-72
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 8 500 3.0E-69
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 20 500 1.0E-65
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 29 499 2.0E-64
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 20 497 2.0E-62
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 46 500 1.0E-61
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 46 500 8.0E-60
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 46 500 9.0E-60
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 34 500 1.0E-58
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 24 500 1.0E-58
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 44 499 1.0E-58
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 13 500 6.0E-47
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 46 503 7.0E-47
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 46 503 1.0E-46
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 46 503 3.0E-43
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 9 504 3.0E-34
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 8 505 2.0E-30
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 5 503 1.0E-25
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 82 237 3.0E-15
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 83 237 2.0E-14
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 369 503 3.0E-12
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 82 237 6.0E-12
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 51 224 2.0E-09
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 64 219 7.0E-09
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 83 237 9.0E-09
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 69 219 1.0E-08
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 83 255 1.0E-08
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 74 397 2.0E-08
sp|Q797E3|PBUE_BACSU Purine efflux pump PbuE OS=Bacillus subtilis (strain 168) GN=pbuE PE=1 SV=1 81 217 4.0E-08
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 82 226 4.0E-08
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 83 241 6.0E-08
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 83 241 8.0E-08
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 104 250 1.0E-07
sp|Q0GQS6|PBUE_BACAM Purine efflux pump PbuE OS=Bacillus amyloliquefaciens GN=pbuE PE=1 SV=1 81 217 2.0E-07
sp|Q4UMJ9|BCRH_RICFE Uncharacterized transporter RF_0358 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0358 PE=3 SV=1 67 238 9.0E-07
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 95 220 9.0E-07
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 56 253 1.0E-06
sp|Q1RI77|BCRH_RICBR Uncharacterized transporter RBE_0856 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0856 PE=3 SV=1 83 238 1.0E-06
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 83 238 4.0E-06
sp|P9WJY3|MFS55_MYCTU MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1410c PE=1 SV=1 56 219 4.0E-06
sp|P9WJY2|MFS55_MYCTO MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1454 PE=3 SV=1 56 219 4.0E-06
sp|C6DTH3|MFS55_MYCTK MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=TBMG_02570 PE=3 SV=1 56 219 4.0E-06
sp|A5WM93|MFS55_MYCTF MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain F11) GN=TBFG_11439 PE=3 SV=1 56 219 4.0E-06
sp|A5U2B2|MFS55_MYCTA MFS-type drug efflux transporter P55 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=MRA_1419 PE=3 SV=1 56 219 4.0E-06
sp|C1AN55|MFS55_MYCBT MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=JTY_1446 PE=3 SV=1 56 219 4.0E-06
sp|A1KIJ9|MFS55_MYCBP MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_1471c PE=1 SV=1 56 219 4.0E-06
sp|Q7U042|MFS55_MYCBO MFS-type drug efflux transporter P55 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1445c PE=3 SV=1 56 219 4.0E-06
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 82 240 4.0E-06
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 82 240 4.0E-06
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 43 224 5.0E-06
sp|P37498|YYBF_BACSU Uncharacterized MFS-type transporter YybF OS=Bacillus subtilis (strain 168) GN=yybF PE=3 SV=1 83 214 5.0E-06
sp|Q9CCP7|MFS55_MYCLE MFS-type drug efflux transporter P55 OS=Mycobacterium leprae (strain TN) GN=ML0556 PE=3 SV=1 56 219 5.0E-06
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 83 240 6.0E-06
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 80 235 7.0E-06
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 83 232 7.0E-06
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 83 232 7.0E-06
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 83 232 7.0E-06
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 83 232 7.0E-06
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 83 232 7.0E-06
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 83 232 8.0E-06
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 83 232 8.0E-06
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 83 232 8.0E-06
sp|O34367|YTBD_BACSU Uncharacterized MFS-type transporter YtbD OS=Bacillus subtilis (strain 168) GN=ytbD PE=3 SV=1 81 343 8.0E-06
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 82 218 9.0E-06
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 60 219 1.0E-05
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 60 219 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 60 77 17
2 97 119 22
3 126 148 22
4 185 207 22
5 212 234 22
6 291 313 22
7 326 348 22
8 372 394 22
9 401 423 22
10 465 487 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7425
MDALNRVLSRPTNKPYRTRELEKEEERLGEPPYLNERGLVDFRPGDIENPHNWTTGRRAAVTFSAVLLVMNATYA
SSSPSGCLPSMARHFGVSIEAASLTITLFLLGYCAGPLMFAPLSELYGRRNVFLISFSGYIIFNFLCAWPPNFGA
LLVGRFLTGTLVSAPLSNAPGVLADLWDPVERGTAMAFFSAMVWVGPALGPVVAGFLELRMGWRWSFYVLLWLGG
LTWLFLITIPETHGPTLLRHKARRIRRAAIPGYEHVKAPAEAQDRSLKTVYKIALTRPWVILFDPISFLCAVYMS
IVYTLLYMLFTIYPIVFQERRGWNSGVGALPLLGTAVGAIIGGIGVMFDTRRRSNNIKSGKIRMEDITPEDRLPL
AMIGGVGFAVTMFWLAWSAEYNSVHWIVPTLAGVFLSTALLLIFVSILNYLVDTYLMYAASAIAANTIARSACGS
AAPLFTHQMFEALGIGGGGSLIGGVAALLAIIPFMFYRYGARIRVRSKFAPTKAPGPPPPQQQQQHGDEEAGTTA
ACPTDSFDTALEESSTRTR*
Coding >Hirsu2|7425
ATGGACGCCCTCAACCGGGTCCTGTCGCGGCCGACCAACAAGCCGTACCGGACGCGCGAGCTGGAGAAGGAGGAG
GAGCGGCTGGGCGAGCCGCCGTACCTCAACGAGCGCGGCCTGGTCGACTTCCGGCCGGGCGACATCGAGAACCCG
CACAACTGGACGACGGGCCGGCGGGCGGCGGTGACGTTCAGCGCCGTGCTGCTGGTCATGAACGCGACGTACGCG
TCGTCGTCGCCGAGCGGCTGCCTGCCCAGCATGGCGCGCCACTTCGGCGTCTCCATCGAGGCCGCCAGCCTGACC
ATCACCCTGTTCCTGCTCGGCTACTGCGCCGGCCCGCTCATGTTCGCGCCGCTGAGCGAGCTGTACGGCCGCCGC
AACGTCTTCCTCATCAGCTTCAGCGGCTACATCATCTTCAACTTCCTCTGCGCCTGGCCGCCCAACTTCGGCGCC
CTGCTCGTCGGCCGCTTCCTGACCGGCACCCTCGTCTCGGCCCCGCTCAGCAACGCGCCCGGCGTCCTGGCCGAC
CTCTGGGACCCGGTCGAGCGCGGCACCGCCATGGCCTTCTTCTCCGCCATGGTCTGGGTCGGCCCGGCCCTCGGC
CCCGTCGTCGCCGGCTTCCTCGAGCTCCGCATGGGCTGGCGCTGGAGCTTCTACGTCCTGCTCTGGCTCGGCGGC
CTCACCTGGCTCTTCCTCATCACCATCCCCGAGACGCACGGGCCGACGCTGCTTCGGCACAAGGCCCGCCGCATC
CGCCGCGCCGCCATCCCCGGCTACGAGCACGTCAAGGCCCCGGCCGAGGCCCAGGACCGCTCGCTCAAGACCGTC
TACAAGATCGCCCTGACCCGGCCCTGGGTCATCCTCTTCGACCCCATCTCCTTCCTGTGCGCCGTCTACATGTCC
ATCGTCTATACCCTGCTCTATATGCTCTTCACCATCTACCCTATCGTCTTCCAGGAGCGCCGCGGCTGGAACTCG
GGCGTCGGCGCCCTGCCGCTGCTCGGCACCGCCGTCGGCGCCATCATCGGCGGCATCGGCGTCATGTTCGACACC
CGCCGCCGCTCCAACAATATCAAGTCGGGCAAGATCCGCATGGAAGACATCACGCCCGAGGACCGCCTGCCGCTG
GCCATGATCGGCGGCGTCGGCTTTGCCGTCACCATGTTCTGGCTCGCCTGGTCGGCCGAGTATAACTCCGTCCAC
TGGATCGTCCCGACCCTGGCCGGCGTCTTCCTCTCGACGGCTCTGCTGCTCATCTTCGTCAGCATCCTCAACTAC
CTGGTCGACACCTACCTCATGTATGCCGCCTCCGCCATCGCCGCCAACACCATCGCCCGCTCCGCCTGCGGCTCG
GCTGCGCCCCTCTTCACCCACCAGATGTTCGAAGCCCTCGGCATCGGCGGCGGCGGCAGCCTCATCGGCGGCGTC
GCCGCCCTGCTGGCCATCATCCCCTTCATGTTCTACCGCTACGGCGCGCGCATCCGCGTCCGCAGCAAGTTCGCG
CCCACCAAGGCGCCAGGGCCGCCGCCGCCCCAGCAGCAGCAGCAGCACGGCGACGAGGAGGCCGGCACGACGGCC
GCCTGCCCGACTGACAGCTTTGACACCGCTCTGGAGGAGAGTTCCACACGCACTCGCTGA
Transcript >Hirsu2|7425
ATGGACGCCCTCAACCGGGTCCTGTCGCGGCCGACCAACAAGCCGTACCGGACGCGCGAGCTGGAGAAGGAGGAG
GAGCGGCTGGGCGAGCCGCCGTACCTCAACGAGCGCGGCCTGGTCGACTTCCGGCCGGGCGACATCGAGAACCCG
CACAACTGGACGACGGGCCGGCGGGCGGCGGTGACGTTCAGCGCCGTGCTGCTGGTCATGAACGCGACGTACGCG
TCGTCGTCGCCGAGCGGCTGCCTGCCCAGCATGGCGCGCCACTTCGGCGTCTCCATCGAGGCCGCCAGCCTGACC
ATCACCCTGTTCCTGCTCGGCTACTGCGCCGGCCCGCTCATGTTCGCGCCGCTGAGCGAGCTGTACGGCCGCCGC
AACGTCTTCCTCATCAGCTTCAGCGGCTACATCATCTTCAACTTCCTCTGCGCCTGGCCGCCCAACTTCGGCGCC
CTGCTCGTCGGCCGCTTCCTGACCGGCACCCTCGTCTCGGCCCCGCTCAGCAACGCGCCCGGCGTCCTGGCCGAC
CTCTGGGACCCGGTCGAGCGCGGCACCGCCATGGCCTTCTTCTCCGCCATGGTCTGGGTCGGCCCGGCCCTCGGC
CCCGTCGTCGCCGGCTTCCTCGAGCTCCGCATGGGCTGGCGCTGGAGCTTCTACGTCCTGCTCTGGCTCGGCGGC
CTCACCTGGCTCTTCCTCATCACCATCCCCGAGACGCACGGGCCGACGCTGCTTCGGCACAAGGCCCGCCGCATC
CGCCGCGCCGCCATCCCCGGCTACGAGCACGTCAAGGCCCCGGCCGAGGCCCAGGACCGCTCGCTCAAGACCGTC
TACAAGATCGCCCTGACCCGGCCCTGGGTCATCCTCTTCGACCCCATCTCCTTCCTGTGCGCCGTCTACATGTCC
ATCGTCTATACCCTGCTCTATATGCTCTTCACCATCTACCCTATCGTCTTCCAGGAGCGCCGCGGCTGGAACTCG
GGCGTCGGCGCCCTGCCGCTGCTCGGCACCGCCGTCGGCGCCATCATCGGCGGCATCGGCGTCATGTTCGACACC
CGCCGCCGCTCCAACAATATCAAGTCGGGCAAGATCCGCATGGAAGACATCACGCCCGAGGACCGCCTGCCGCTG
GCCATGATCGGCGGCGTCGGCTTTGCCGTCACCATGTTCTGGCTCGCCTGGTCGGCCGAGTATAACTCCGTCCAC
TGGATCGTCCCGACCCTGGCCGGCGTCTTCCTCTCGACGGCTCTGCTGCTCATCTTCGTCAGCATCCTCAACTAC
CTGGTCGACACCTACCTCATGTATGCCGCCTCCGCCATCGCCGCCAACACCATCGCCCGCTCCGCCTGCGGCTCG
GCTGCGCCCCTCTTCACCCACCAGATGTTCGAAGCCCTCGGCATCGGCGGCGGCGGCAGCCTCATCGGCGGCGTC
GCCGCCCTGCTGGCCATCATCCCCTTCATGTTCTACCGCTACGGCGCGCGCATCCGCGTCCGCAGCAAGTTCGCG
CCCACCAAGGCGCCAGGGCCGCCGCCGCCCCAGCAGCAGCAGCAGCACGGCGACGAGGAGGCCGGCACGACGGCC
GCCTGCCCGACTGACAGCTTTGACACCGCTCTGGAGGAGAGTTCCACACGCACTCGCTGA
Gene >Hirsu2|7425
ATGGACGCCCTCAACCGGGTCCTGTCGCGGCCGACCAACAAGCCGTACCGGACGCGCGAGCTGGAGAAGGAGGAG
GAGCGGCTGGGCGAGCCGCCGTACCTCAACGAGCGCGGCCTGGTCGACTTCCGGCCGGGCGACATCGAGAACCCG
CACAACTGGACGACGGGCCGGCGGGCGGCGGTGACGTTCAGCGCCGTGCTGCTGGTCATGAACGCGACGTACGCG
TCGTCGTCGCCGAGCGGCTGCCTGCCCAGCATGGCGCGCCACTTCGGCGTCTCCATCGAGGCCGCCAGCCTGACC
ATCACCCTGTTCCTGCTCGGCTACTGCGCCGGCCCGCTCATGTTCGCGCCGCTGAGCGAGCTGTACGGCCGCCGC
AACGTCTTCCTCATCAGCTTCAGCGGCTACATCATCTTCAACTTCCTCTGCGCCTGGCCGCCCAACTTCGGCGCC
CTGCTCGTCGGCCGCTTCCTGACCGGCACCCTCGTCTCGGCCCCGCTCAGCAACGCGCCCGGCGTCCTGGCCGAC
CTCTGGGACCCGGTCGAGCGCGGCACCGCCATGGCCTTCTTCTCCGCCATGGTCTGGGTCGGCCCGGCCCTCGGC
CCCGTCGTCGCCGGCTTCCTCGAGCTCCGCATGGGCTGGCGCTGGAGCTTCTACGTCCTGCTCTGGCTCGGCGGC
CTCACCTGGCTCTTCCTCATCACCATCCCCGAGACGCACGGGCCGACGCTGCTTCGGCACAAGGCCCGCCGCATC
CGCCGCGCCGCCATCCCCGGCTACGAGCACGTCAAGGCCCCGGCCGAGGCCCAGGACCGCTCGCTCAAGACCGTC
TACAAGATCGCCCTGACCCGGCCCTGGGTCATCCTCTTCGACCCCATCTCCTTCCTGTGCGCCGTCTACATGTCC
ATCGTCTATACCCTGCTCTATATGCTCTTCACCATCTACCCTATCGTCTTCCAGGAGCGCCGCGGCTGGAACTCG
GGCGTCGGCGCCCTGCCGCTGCTCGGCACCGCCGTCGGCGCCATCATCGGCGGCATCGGCGTCATGTTCGACACC
CGCCGCCGCTCCAACAATATCAAGTCGGGCAAGATCCGCATGGAAGACATCACGCCCGAGGACCGCCTGCCGCTG
GCCATGATCGGCGGCGTCGGCTTTGCCGTCACCATGTTCTGGCTCGCCTGGTCGGCCGAGTATAAGTACGTTGTT
CCAACGTTGCCCCTTTACCCCTTTTTATACCCCCTTTTCTCCCAAACCATCTACCTCCTTTTTTTTCTCTCTCAA
CCACAGACCACCCCCTTTTCCGGCTTCGTCTCTCAGCTGTTTTGTCCAGCTTGGAGATGAAAAATCGACACCAAT
CTTCTCAACTCACAGCCTGCTGACTTCCACCCCCCCCCCCTTTCCAGCTCCGTCCACTGGATCGTCCCGACCCTG
GCCGGCGTCTTCCTCTCGACGGCTCTGCTGCTCATCTTCGTCAGCATCCTCAACTACCTGGTCGACACCTACCTC
ATGTATGCCGCCTCCGCCATCGCCGCCAACACCATCGCCCGCTCCGCCTGCGGCTCGGCTGCGCCCCTCTTCACC
CACCAGATGTTCGAAGCCCTCGGCATCGGCGGCGGCGGCAGCCTCATCGGCGGCGTCGCCGCCCTGCTGGCCATC
ATCCCCTTCATGTTCTACCGCTACGGCGCGCGCATCCGCGTCCGCAGCAAGTTCGCGCCCACCAAGGCGCCAGGG
CCGCCGCCGCCCCAGCAGCAGCAGCAGCACGGCGACGAGGAGGCCGGCACGACGGCCGCCTGCCCGACTGACAGC
TTTGACACCGCTCTGGAGGAGAGTTCCACACGCACTCGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail