Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|742
Gene name
LocationContig_1150:6969..7659
Strand-
Gene length (bp)690
Transcript length (bp)690
Coding sequence length (bp)690
Protein length (aa) 230

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8SVY9|Y3G1_ENCCU Uncharacterized protein ECU03_1610 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU03_1610 PE=1 SV=1 154 219 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|742
MKFSPSAVLLAAMAGSAMAAPLADSAPQQNQRHVSTANQMDAQGLIDLLSQIDTELYRKHGHHEHDRHHEHDRHR
HGQLKGGVNINDGGILANGERNIGKLLKDGVPKQGQLDYHERRDVTAEAARGKSPDFVCSVLSIVGLCKDGGMKK
NPLDKAGKTAGGLKDKVGKTAGGLKDKAGKTAGGLKDKAGKAADDVKDKADDVKDKAGDAKDKVKDKAEEKTGGD
KDKA*
Coding >Hirsu2|742
ATGAAGTTCAGCCCGTCCGCCGTTCTTCTGGCCGCCATGGCCGGCAGCGCCATGGCCGCGCCGCTGGCCGACTCG
GCGCCGCAGCAGAACCAGCGCCACGTCTCGACGGCCAACCAGATGGACGCCCAGGGTCTTATCGATCTCCTGTCG
CAGATTGATACCGAGCTGTACCGCAAGCACGGGCACCATGAGCACGACAGGCACCATGAGCACGACAGGCACAGG
CACGGCCAGCTCAAGGGCGGGGTCAATATCAACGACGGCGGCATCCTCGCCAACGGCGAGAGGAACATCGGCAAG
CTCCTCAAGGACGGCGTCCCCAAGCAAGGCCAGCTCGACTACCACGAGCGGAGAGACGTGACCGCGGAGGCGGCC
CGGGGCAAGTCGCCCGACTTCGTCTGCAGCGTCCTTTCCATCGTTGGCCTGTGCAAGGACGGCGGCATGAAGAAG
AACCCTCTGGACAAGGCTGGCAAGACGGCCGGCGGTCTCAAGGACAAGGTTGGCAAGACGGCCGGCGGTCTCAAG
GACAAGGCTGGCAAGACGGCCGGCGGTCTCAAGGACAAGGCTGGCAAGGCGGCCGACGATGTCAAGGACAAGGCC
GATGATGTCAAGGATAAGGCCGGCGATGCCAAGGACAAGGTCAAGGACAAGGCCGAGGAGAAGACCGGCGGTGAC
AAGGACAAGGCTTAG
Transcript >Hirsu2|742
ATGAAGTTCAGCCCGTCCGCCGTTCTTCTGGCCGCCATGGCCGGCAGCGCCATGGCCGCGCCGCTGGCCGACTCG
GCGCCGCAGCAGAACCAGCGCCACGTCTCGACGGCCAACCAGATGGACGCCCAGGGTCTTATCGATCTCCTGTCG
CAGATTGATACCGAGCTGTACCGCAAGCACGGGCACCATGAGCACGACAGGCACCATGAGCACGACAGGCACAGG
CACGGCCAGCTCAAGGGCGGGGTCAATATCAACGACGGCGGCATCCTCGCCAACGGCGAGAGGAACATCGGCAAG
CTCCTCAAGGACGGCGTCCCCAAGCAAGGCCAGCTCGACTACCACGAGCGGAGAGACGTGACCGCGGAGGCGGCC
CGGGGCAAGTCGCCCGACTTCGTCTGCAGCGTCCTTTCCATCGTTGGCCTGTGCAAGGACGGCGGCATGAAGAAG
AACCCTCTGGACAAGGCTGGCAAGACGGCCGGCGGTCTCAAGGACAAGGTTGGCAAGACGGCCGGCGGTCTCAAG
GACAAGGCTGGCAAGACGGCCGGCGGTCTCAAGGACAAGGCTGGCAAGGCGGCCGACGATGTCAAGGACAAGGCC
GATGATGTCAAGGATAAGGCCGGCGATGCCAAGGACAAGGTCAAGGACAAGGCCGAGGAGAAGACCGGCGGTGAC
AAGGACAAGGCTTAG
Gene >Hirsu2|742
ATGAAGTTCAGCCCGTCCGCCGTTCTTCTGGCCGCCATGGCCGGCAGCGCCATGGCCGCGCCGCTGGCCGACTCG
GCGCCGCAGCAGAACCAGCGCCACGTCTCGACGGCCAACCAGATGGACGCCCAGGGTCTTATCGATCTCCTGTCG
CAGATTGATACCGAGCTGTACCGCAAGCACGGGCACCATGAGCACGACAGGCACCATGAGCACGACAGGCACAGG
CACGGCCAGCTCAAGGGCGGGGTCAATATCAACGACGGCGGCATCCTCGCCAACGGCGAGAGGAACATCGGCAAG
CTCCTCAAGGACGGCGTCCCCAAGCAAGGCCAGCTCGACTACCACGAGCGGAGAGACGTGACCGCGGAGGCGGCC
CGGGGCAAGTCGCCCGACTTCGTCTGCAGCGTCCTTTCCATCGTTGGCCTGTGCAAGGACGGCGGCATGAAGAAG
AACCCTCTGGACAAGGCTGGCAAGACGGCCGGCGGTCTCAAGGACAAGGTTGGCAAGACGGCCGGCGGTCTCAAG
GACAAGGCTGGCAAGACGGCCGGCGGTCTCAAGGACAAGGCTGGCAAGGCGGCCGACGATGTCAAGGACAAGGCC
GATGATGTCAAGGATAAGGCCGGCGATGCCAAGGACAAGGTCAAGGACAAGGCCGAGGAGAAGACCGGCGGTGAC
AAGGACAAGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail