Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7408
Gene name
LocationContig_43:23593..25223
Strand-
Gene length (bp)1630
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8CQD9|PLS_STAES Accumulation-associated protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0175 PE=3 SV=1 128 315 4.0E-06
sp|A2AX52|CO6A4_MOUSE Collagen alpha-4(VI) chain OS=Mus musculus GN=Col6a4 PE=1 SV=2 251 452 7.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 459 481 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7408
MDLVQHEHGEDGHGSGSTCDGKDEKCAGNDDAEKGHIIPPCATDGSDAGSKSCSGARVVCPNGGHCSPEGALGGN
DNQAGYPGEASAHASKPCAGCHGAGVVYPAEPAEPVPGYPHVPKKPEIPGKPVYPIPGKPIYPIPGKPAYPVPGT
PIYPVVKPVYPIPGKPDYPEKPAYPGKPAYPVPGKPVYPVVRPVYPIPAKPDYPGKPEYPGKAAYPVPGEHNTPG
KPEYPGKPDFTAPGEHEVPSKIAYPVPGKPDYPGKPENPVPGKPEHPGKPDYPVPGKPEYPGKAEYPVPGEHETP
GKPDYSGSGEHEGAGGAGYPGEHEGPGYPGEHETLGKPGYPGEHEIPGKPEYPAPGKPETPGKPGYPAPGEGETP
GKPDCSVPGKPECETGEEKPEYSGSGEHGAPGEKPEEAPGKKPEEAPGKKPEEAPGKKPEIPGKPGYPGKYGNGL
EPPSVYISGGALTSTWNGACIFVGVAAWFAARRLSM*
Coding >Hirsu2|7408
ATGGATCTGGTTCAACACGAGCACGGCGAGGATGGCCATGGATCTGGTTCAACTTGCGACGGCAAGGACGAGAAA
TGCGCTGGCAACGACGACGCCGAAAAGGGACACATCATCCCCCCTTGCGCGACTGACGGGTCGGACGCCGGATCT
AAGAGCTGCAGCGGCGCCCGCGTCGTCTGCCCGAACGGGGGTCATTGCTCTCCCGAGGGTGCTCTCGGCGGAAAC
GACAACCAAGCTGGCTATCCGGGAGAAGCTTCCGCTCATGCGTCCAAGCCTTGCGCCGGATGCCACGGCGCTGGT
GTCGTCTATCCCGCGGAGCCTGCCGAGCCCGTCCCCGGCTACCCCCACGTCCCCAAGAAGCCCGAGATCCCCGGC
AAGCCCGTCTACCCGATCCCCGGAAAGCCCATCTACCCGATCCCCGGCAAGCCCGCCTATCCCGTCCCCGGAACG
CCCATCTATCCCGTTGTCAAGCCTGTCTACCCGATCCCGGGCAAGCCTGACTATCCCGAAAAGCCTGCGTACCCC
GGAAAGCCTGCGTACCCCGTCCCTGGCAAGCCCGTCTACCCCGTCGTCAGGCCCGTCTACCCGATCCCCGCCAAG
CCTGACTATCCCGGCAAGCCTGAGTACCCCGGAAAGGCTGCCTACCCCGTTCCCGGTGAGCACAATACTCCCGGC
AAGCCTGAGTACCCGGGAAAGCCCGACTTCACCGCCCCCGGAGAGCATGAAGTCCCGAGCAAGATTGCCTATCCA
GTCCCCGGCAAGCCTGACTATCCTGGCAAGCCCGAAAACCCGGTTCCTGGAAAGCCCGAGCACCCTGGCAAGCCC
GACTACCCCGTCCCTGGAAAGCCTGAATACCCTGGGAAGGCTGAATACCCCGTCCCCGGCGAGCATGAGACGCCT
GGCAAGCCCGACTACTCCGGCTCCGGCGAGCACGAGGGTGCCGGGGGTGCCGGCTACCCCGGCGAGCACGAGGGG
CCCGGTTACCCCGGTGAGCACGAAACGCTCGGCAAGCCCGGCTATCCCGGCGAGCACGAGATTCCTGGCAAGCCC
GAATACCCGGCGCCCGGCAAGCCCGAGACGCCCGGCAAGCCTGGCTATCCCGCCCCGGGCGAGGGTGAGACTCCC
GGAAAGCCTGACTGCTCGGTCCCCGGCAAGCCCGAATGCGAGACGGGCGAAGAAAAGCCCGAGTACTCTGGGTCT
GGCGAGCATGGTGCTCCCGGCGAGAAGCCCGAGGAGGCTCCCGGAAAGAAGCCCGAGGAGGCTCCCGGCAAGAAG
CCCGAGGAGGCTCCCGGCAAGAAGCCCGAGATCCCTGGCAAGCCCGGCTATCCTGGCAAGTACGGCAACGGCCTG
GAGCCTCCGTCCGTCTACATCTCCGGTGGTGCTCTTACTTCGACTTGGAACGGCGCGTGCATCTTCGTCGGCGTG
GCCGCCTGGTTCGCGGCCCGGCGGCTGAGCATGTAA
Transcript >Hirsu2|7408
ATGGATCTGGTTCAACACGAGCACGGCGAGGATGGCCATGGATCTGGTTCAACTTGCGACGGCAAGGACGAGAAA
TGCGCTGGCAACGACGACGCCGAAAAGGGACACATCATCCCCCCTTGCGCGACTGACGGGTCGGACGCCGGATCT
AAGAGCTGCAGCGGCGCCCGCGTCGTCTGCCCGAACGGGGGTCATTGCTCTCCCGAGGGTGCTCTCGGCGGAAAC
GACAACCAAGCTGGCTATCCGGGAGAAGCTTCCGCTCATGCGTCCAAGCCTTGCGCCGGATGCCACGGCGCTGGT
GTCGTCTATCCCGCGGAGCCTGCCGAGCCCGTCCCCGGCTACCCCCACGTCCCCAAGAAGCCCGAGATCCCCGGC
AAGCCCGTCTACCCGATCCCCGGAAAGCCCATCTACCCGATCCCCGGCAAGCCCGCCTATCCCGTCCCCGGAACG
CCCATCTATCCCGTTGTCAAGCCTGTCTACCCGATCCCGGGCAAGCCTGACTATCCCGAAAAGCCTGCGTACCCC
GGAAAGCCTGCGTACCCCGTCCCTGGCAAGCCCGTCTACCCCGTCGTCAGGCCCGTCTACCCGATCCCCGCCAAG
CCTGACTATCCCGGCAAGCCTGAGTACCCCGGAAAGGCTGCCTACCCCGTTCCCGGTGAGCACAATACTCCCGGC
AAGCCTGAGTACCCGGGAAAGCCCGACTTCACCGCCCCCGGAGAGCATGAAGTCCCGAGCAAGATTGCCTATCCA
GTCCCCGGCAAGCCTGACTATCCTGGCAAGCCCGAAAACCCGGTTCCTGGAAAGCCCGAGCACCCTGGCAAGCCC
GACTACCCCGTCCCTGGAAAGCCTGAATACCCTGGGAAGGCTGAATACCCCGTCCCCGGCGAGCATGAGACGCCT
GGCAAGCCCGACTACTCCGGCTCCGGCGAGCACGAGGGTGCCGGGGGTGCCGGCTACCCCGGCGAGCACGAGGGG
CCCGGTTACCCCGGTGAGCACGAAACGCTCGGCAAGCCCGGCTATCCCGGCGAGCACGAGATTCCTGGCAAGCCC
GAATACCCGGCGCCCGGCAAGCCCGAGACGCCCGGCAAGCCTGGCTATCCCGCCCCGGGCGAGGGTGAGACTCCC
GGAAAGCCTGACTGCTCGGTCCCCGGCAAGCCCGAATGCGAGACGGGCGAAGAAAAGCCCGAGTACTCTGGGTCT
GGCGAGCATGGTGCTCCCGGCGAGAAGCCCGAGGAGGCTCCCGGAAAGAAGCCCGAGGAGGCTCCCGGCAAGAAG
CCCGAGGAGGCTCCCGGCAAGAAGCCCGAGATCCCTGGCAAGCCCGGCTATCCTGGCAAGTACGGCAACGGCCTG
GAGCCTCCGTCCGTCTACATCTCCGGTGGTGCTCTTACTTCGACTTGGAACGGCGCGTGCATCTTCGTCGGCGTG
GCCGCCTGGTTCGCGGCCCGGCGGCTGAGCATGTAA
Gene >Hirsu2|7408
ATGGATCTGGTTCAACGTGCGATGGCAAGGACGGAAAGTGCGCCGGCAACGAAGACGAGCACGGCGAGGATGGCC
ATGGATCTGGTTCAACTTGCGACGGCAAGGACGAGAAATGCGCTGGCAACGACGACGCCGAAAAGGGACACGTAA
GTCTTTCGCCACGGTTAAAAGATGGCGGAGATGCTCACGTCGTCTCGACAGATCATCCCCCCTTGCGCGACTGAC
GGGTCGGACGCCGGATCTAAGAGCTGCAGCGGCGCCCGCGTCGTCTGCCCGAACGGGGGTCATTGCTCTCCCGAG
GGTGCTCTCGGCGGAAACGACAACCAAGCTGGCTATCCGGGAGAAGCTTCCGCTCATGCGTCCAAGCCTTGCGCC
GGTAAGCCCCCGGACCCTTGAGTCTACGGAGGGATCTACTGAGGGAGGGATGAGACTAATGTGCCGGTTCCCTTT
AGGATGCCACGGCGCTGGTGTCGTCTATCCCGCGGAGCCTGCCGAGCCCGTCCCCGGCTACCCCCACGTCCCCAA
GAAGCCCGAGATCCCCGGCAAGCCCGTCTACCCGATCCCCGGAAAGCCCATCTACCCGATCCCCGGCAAGCCCGC
CTATCCCGTCCCCGGAACGCCCATCTATCCCGTTGTCAAGCCTGTCTACCCGATCCCGGGCAAGCCTGACTATCC
CGAAAAGCCTGCGTACCCCGGAAAGCCTGCGTACCCCGTCCCTGGCAAGCCCGTCTACCCCGTCGTCAGGCCCGT
CTACCCGATCCCCGCCAAGCCTGACTATCCCGGCAAGCCTGAGTACCCCGGAAAGGCTGCCTACCCCGTTCCCGG
TGAGCACAATACTCCCGGCAAGCCTGAGTACCCGGGAAAGCCCGACTTCACCGCCCCCGGAGAGCATGAAGTCCC
GAGCAAGATTGCCTATCCAGTCCCCGGCAAGCCTGACTATCCTGGCAAGCCCGAAAACCCGGTTCCTGGAAAGCC
CGAGCACCCTGGCAAGCCCGACTACCCCGTCCCTGGAAAGCCTGAATACCCTGGGAAGGCTGAATACCCCGTCCC
CGGCGAGCATGAGACGCCTGGCAAGCCCGACTACTCCGGCTCCGGCGAGCACGAGGGTGCCGGGGGTGCCGGCTA
CCCCGGCGAGCACGAGGGGCCCGGTTACCCCGGTGAGCACGAAACGCTCGGCAAGCCCGGCTATCCCGGCGAGCA
CGAGATTCCTGGCAAGCCCGAATACCCGGCGCCCGGCAAGCCCGAGACGCCCGGCAAGCCTGGCTATCCCGCCCC
GGGCGAGGGTGAGACTCCCGGAAAGCCTGACTGCTCGGTCCCCGGCAAGCCCGAATGCGAGACGGGCGAAGAAAA
GCCCGAGTACTCTGGGTCTGGCGAGCATGGTGCTCCCGGCGAGAAGCCCGAGGAGGCTCCCGGAAAGAAGCCCGA
GGAGGCTCCCGGCAAGAAGCCCGAGGAGGCTCCCGGCAAGAAGCCCGAGATCCCTGGCAAGCCCGGCTATCCTGG
CAAGTACGGCAACGGCCTGGAGCCTCCGTCCGTCTACATCTCCGGTGGTGCTCTTACTTCGACTTGGAACGGCGC
GTGCATCTTCGTCGGCGTGGCCGCCTGGTTCGCGGCCCGGCGGCTGAGCATGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail