Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7407
Gene name
LocationContig_43:22355..23119
Strand-
Gene length (bp)764
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00929 RNase_T Exonuclease 9.2E-26 22 187

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54964|ORN_YEAST Oligoribonuclease, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX2 PE=1 SV=1 20 201 4.0E-49
sp|A2VE52|ORN_BOVIN Oligoribonuclease, mitochondrial OS=Bos taurus GN=REXO2 PE=2 SV=1 8 197 6.0E-47
sp|Q7NVH5|ORN_CHRVO Oligoribonuclease OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=orn PE=3 SV=1 21 199 1.0E-46
sp|Q9Y3B8|ORN_HUMAN Oligoribonuclease, mitochondrial OS=Homo sapiens GN=REXO2 PE=1 SV=3 8 217 2.0E-46
sp|Q9D8S4|ORN_MOUSE Oligoribonuclease, mitochondrial OS=Mus musculus GN=Rexo2 PE=1 SV=2 9 197 5.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54964|ORN_YEAST Oligoribonuclease, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX2 PE=1 SV=1 20 201 4.0E-49
sp|A2VE52|ORN_BOVIN Oligoribonuclease, mitochondrial OS=Bos taurus GN=REXO2 PE=2 SV=1 8 197 6.0E-47
sp|Q7NVH5|ORN_CHRVO Oligoribonuclease OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=orn PE=3 SV=1 21 199 1.0E-46
sp|Q9Y3B8|ORN_HUMAN Oligoribonuclease, mitochondrial OS=Homo sapiens GN=REXO2 PE=1 SV=3 8 217 2.0E-46
sp|Q9D8S4|ORN_MOUSE Oligoribonuclease, mitochondrial OS=Mus musculus GN=Rexo2 PE=1 SV=2 9 197 5.0E-46
sp|Q5U1X1|ORN_RAT Oligoribonuclease, mitochondrial OS=Rattus norvegicus GN=Rexo2 PE=2 SV=1 9 197 5.0E-46
sp|O94626|ORN_SCHPO Probable oligoribonuclease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rex2 PE=3 SV=2 15 193 2.0E-43
sp|Q9JW09|ORN_NEIMA Oligoribonuclease OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=orn PE=3 SV=1 21 202 3.0E-43
sp|A1KS35|ORN_NEIMF Oligoribonuclease OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=orn PE=3 SV=1 21 202 8.0E-43
sp|Q5FAH8|ORN_NEIG1 Oligoribonuclease OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=orn PE=3 SV=1 21 202 3.0E-42
sp|Q9VCI0|ORN_DROME Probable oligoribonuclease OS=Drosophila melanogaster GN=CG10214 PE=1 SV=1 12 197 3.0E-42
sp|Q9JXW1|ORN_NEIMB Oligoribonuclease OS=Neisseria meningitidis serogroup B (strain MC58) GN=orn PE=3 SV=1 21 202 7.0E-42
sp|Q3IG97|ORN_PSEHT Oligoribonuclease OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=orn PE=3 SV=1 15 198 1.0E-41
sp|Q31HZ4|ORN_THICR Oligoribonuclease OS=Thiomicrospira crunogena (strain XCL-2) GN=orn PE=3 SV=1 21 197 2.0E-41
sp|Q8Y0V1|ORN_RALSO Oligoribonuclease OS=Ralstonia solanacearum (strain GMI1000) GN=orn PE=3 SV=1 17 193 2.0E-41
sp|Q7VVH7|ORN_BORPE Oligoribonuclease OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=orn PE=3 SV=1 15 199 3.0E-41
sp|Q7W9T4|ORN_BORPA Oligoribonuclease OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=orn PE=3 SV=1 15 199 3.0E-41
sp|Q7WGX3|ORN_BORBR Oligoribonuclease OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=orn PE=3 SV=1 15 199 3.0E-41
sp|Q9KV17|ORN_VIBCH Oligoribonuclease OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=orn PE=3 SV=1 15 198 5.0E-41
sp|A5F3M7|ORN_VIBC3 Oligoribonuclease OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=orn PE=3 SV=1 15 198 5.0E-41
sp|Q7MGZ7|ORN_VIBVY Oligoribonuclease OS=Vibrio vulnificus (strain YJ016) GN=orn PE=3 SV=2 15 198 1.0E-40
sp|Q8DCV6|ORN_VIBVU Oligoribonuclease OS=Vibrio vulnificus (strain CMCP6) GN=orn PE=3 SV=2 15 198 1.0E-40
sp|Q2SBB4|ORN_HAHCH Oligoribonuclease OS=Hahella chejuensis (strain KCTC 2396) GN=orn PE=3 SV=1 21 197 2.0E-40
sp|A1WTK7|ORN_HALHL Oligoribonuclease OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=orn PE=3 SV=1 21 193 6.0E-40
sp|Q87L01|ORN_VIBPA Oligoribonuclease OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=orn PE=3 SV=1 15 198 2.0E-39
sp|Q6AEG5|ORN_LEIXX Oligoribonuclease OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=orn PE=3 SV=1 21 213 2.0E-39
sp|A1U4D2|ORN_MARHV Oligoribonuclease OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=orn PE=3 SV=1 15 198 2.0E-39
sp|Q2L2P5|ORN_BORA1 Oligoribonuclease OS=Bordetella avium (strain 197N) GN=orn PE=3 SV=1 15 194 2.0E-39
sp|A7MZ48|ORN_VIBCB Oligoribonuclease OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=orn PE=3 SV=1 15 198 3.0E-39
sp|A1K5N0|ORN_AZOSB Oligoribonuclease OS=Azoarcus sp. (strain BH72) GN=orn PE=3 SV=1 21 200 1.0E-38
sp|Q60BD8|ORN_METCA Oligoribonuclease OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=orn PE=3 SV=1 21 198 2.0E-38
sp|Q4ZYY8|ORN_PSEU2 Oligoribonuclease OS=Pseudomonas syringae pv. syringae (strain B728a) GN=orn PE=3 SV=1 21 194 4.0E-38
sp|Q48P10|ORN_PSE14 Oligoribonuclease OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=orn PE=3 SV=1 21 194 4.0E-38
sp|Q0ADS5|ORN_NITEC Oligoribonuclease OS=Nitrosomonas eutropha (strain C91) GN=orn PE=3 SV=1 21 198 5.0E-38
sp|A0KNT4|ORN_AERHH Oligoribonuclease OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=orn PE=3 SV=1 21 198 5.0E-38
sp|Q39IC7|ORN_BURL3 Oligoribonuclease OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=orn PE=3 SV=1 21 194 6.0E-38
sp|Q6LM23|ORN_PHOPR Oligoribonuclease OS=Photobacterium profundum GN=orn PE=3 SV=1 15 198 2.0E-37
sp|Q5P0T5|ORN_AROAE Oligoribonuclease OS=Aromatoleum aromaticum (strain EbN1) GN=orn PE=3 SV=1 21 197 3.0E-37
sp|A6VD64|ORN_PSEA7 Oligoribonuclease OS=Pseudomonas aeruginosa (strain PA7) GN=orn PE=3 SV=1 21 198 4.0E-37
sp|P57665|ORN_PSEAE Oligoribonuclease OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=orn PE=3 SV=1 21 194 5.0E-37
sp|Q02F67|ORN_PSEAB Oligoribonuclease OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=orn PE=3 SV=1 21 194 5.0E-37
sp|Q87VI6|ORN_PSESM Oligoribonuclease OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=orn PE=3 SV=1 21 194 6.0E-37
sp|A1RFR0|ORN_SHESW Oligoribonuclease OS=Shewanella sp. (strain W3-18-1) GN=orn PE=3 SV=1 15 198 6.0E-37
sp|A4YAL6|ORN_SHEPC Oligoribonuclease OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=orn PE=3 SV=1 15 198 6.0E-37
sp|Q1B5T7|ORN_MYCSS Oligoribonuclease OS=Mycobacterium sp. (strain MCS) GN=orn PE=3 SV=1 21 197 8.0E-37
sp|A1UJ99|ORN_MYCSK Oligoribonuclease OS=Mycobacterium sp. (strain KMS) GN=orn PE=3 SV=1 21 197 8.0E-37
sp|A3Q2P5|ORN_MYCSJ Oligoribonuclease OS=Mycobacterium sp. (strain JLS) GN=orn PE=3 SV=1 21 197 8.0E-37
sp|Q9ZVE0|ORN_ARATH Oligoribonuclease OS=Arabidopsis thaliana GN=At2g26970 PE=2 SV=2 20 197 8.0E-37
sp|Q5E2C2|ORN_VIBF1 Oligoribonuclease OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=orn PE=3 SV=1 17 198 9.0E-37
sp|Q82Y15|ORN_NITEU Oligoribonuclease OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=orn PE=3 SV=1 21 198 1.0E-36
sp|Q8EJ78|ORN_SHEON Oligoribonuclease OS=Shewanella oneidensis (strain MR-1) GN=orn PE=3 SV=1 16 198 4.0E-36
sp|Q13VF8|ORN_BURXL Oligoribonuclease OS=Burkholderia xenovorans (strain LB400) GN=orn PE=3 SV=1 17 197 4.0E-36
sp|A6WSV9|ORN_SHEB8 Oligoribonuclease OS=Shewanella baltica (strain OS185) GN=orn PE=3 SV=1 21 198 5.0E-36
sp|A3D017|ORN_SHEB5 Oligoribonuclease OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=orn PE=3 SV=1 21 198 5.0E-36
sp|Q5Z0A9|ORN_NOCFA Oligoribonuclease OS=Nocardia farcinica (strain IFM 10152) GN=orn PE=3 SV=1 17 197 8.0E-36
sp|Q0HR35|ORN_SHESR Oligoribonuclease OS=Shewanella sp. (strain MR-7) GN=orn PE=3 SV=1 21 198 9.0E-36
sp|Q0HMP6|ORN_SHESM Oligoribonuclease OS=Shewanella sp. (strain MR-4) GN=orn PE=3 SV=1 21 198 9.0E-36
sp|Q6F805|ORN_ACIAD Oligoribonuclease OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=orn PE=3 SV=1 14 197 9.0E-36
sp|Q556Y2|ORN_DICDI Probable oligoribonuclease OS=Dictyostelium discoideum GN=rexo2-1 PE=3 SV=1 21 198 1.0E-35
sp|Q12J88|ORN_SHEDO Oligoribonuclease OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=orn PE=3 SV=1 21 198 1.0E-35
sp|Q15Q55|ORN_PSEA6 Oligoribonuclease OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=orn PE=3 SV=1 21 198 1.0E-35
sp|Q47VZ4|ORN_COLP3 Oligoribonuclease OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=orn PE=3 SV=1 17 198 1.0E-35
sp|Q5QVW2|ORN_IDILO Oligoribonuclease OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=orn PE=3 SV=1 21 198 1.0E-35
sp|A4SJD0|ORN_AERS4 Oligoribonuclease OS=Aeromonas salmonicida (strain A449) GN=orn PE=3 SV=1 21 198 1.0E-35
sp|A0KSR0|ORN_SHESA Oligoribonuclease OS=Shewanella sp. (strain ANA-3) GN=orn PE=3 SV=1 21 198 1.0E-35
sp|A4W5Q6|ORN_ENT38 Oligoribonuclease OS=Enterobacter sp. (strain 638) GN=orn PE=3 SV=1 15 198 3.0E-35
sp|Q3SHU1|ORN_THIDA Oligoribonuclease OS=Thiobacillus denitrificans (strain ATCC 25259) GN=orn PE=3 SV=1 21 194 3.0E-35
sp|P57666|ORN_STRCO Oligoribonuclease OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=orn PE=1 SV=1 21 197 3.0E-35
sp|P9WIU1|ORN_MYCTU Oligoribonuclease OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=orn PE=1 SV=1 21 197 4.0E-35
sp|P9WIU0|ORN_MYCTO Oligoribonuclease OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=orn PE=3 SV=1 21 197 4.0E-35
sp|A5U5K8|ORN_MYCTA Oligoribonuclease OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=orn PE=3 SV=1 21 197 4.0E-35
sp|A1KLK6|ORN_MYCBP Oligoribonuclease OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=orn PE=3 SV=1 21 197 4.0E-35
sp|P65598|ORN_MYCBO Oligoribonuclease OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=orn PE=3 SV=1 21 197 4.0E-35
sp|A3QAD3|ORN_SHELP Oligoribonuclease OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=orn PE=3 SV=1 15 199 4.0E-35
sp|A1TND9|ORN_ACIAC Oligoribonuclease OS=Acidovorax citrulli (strain AAC00-1) GN=orn PE=3 SV=1 17 197 5.0E-35
sp|Q7VNN8|ORN_HAEDU Oligoribonuclease OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=orn PE=3 SV=1 14 200 6.0E-35
sp|Q82CS8|ORN_STRAW Oligoribonuclease OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=orn PE=3 SV=1 21 197 7.0E-35
sp|A1SA28|ORN_SHEAM Oligoribonuclease OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=orn PE=3 SV=1 16 199 8.0E-35
sp|Q6D037|ORN_PECAS Oligoribonuclease OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=orn PE=3 SV=1 21 197 8.0E-35
sp|Q7MYS8|ORN_PHOLL Oligoribonuclease OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=orn PE=3 SV=1 15 194 8.0E-35
sp|Q65SE1|ORN_MANSM Oligoribonuclease OS=Mannheimia succiniciproducens (strain MBEL55E) GN=orn PE=3 SV=1 21 194 8.0E-35
sp|A6VN13|ORN_ACTSZ Oligoribonuclease OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=orn PE=3 SV=1 21 194 1.0E-34
sp|A1WB43|ORN_ACISJ Oligoribonuclease OS=Acidovorax sp. (strain JS42) GN=orn PE=3 SV=1 17 199 1.0E-34
sp|A3N1D8|ORN_ACTP2 Oligoribonuclease OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=orn PE=3 SV=1 14 193 1.0E-34
sp|Q0VME0|ORN_ALCBS Oligoribonuclease OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=orn PE=3 SV=1 21 194 2.0E-34
sp|A6TH79|ORN_KLEP7 Oligoribonuclease OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=orn PE=3 SV=1 15 194 2.0E-34
sp|Q8G3N5|ORN_BIFLO Oligoribonuclease OS=Bifidobacterium longum (strain NCC 2705) GN=orn PE=3 SV=1 11 200 2.0E-34
sp|Q83GA7|ORN_TROWT Oligoribonuclease OS=Tropheryma whipplei (strain Twist) GN=orn PE=3 SV=1 21 198 3.0E-34
sp|P65599|ORN_SALTY Oligoribonuclease OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=orn PE=3 SV=2 15 194 4.0E-34
sp|P65600|ORN_SALTI Oligoribonuclease OS=Salmonella typhi GN=orn PE=3 SV=2 15 194 4.0E-34
sp|Q5PLG7|ORN_SALPA Oligoribonuclease OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=orn PE=3 SV=3 15 194 4.0E-34
sp|Q57GM7|ORN_SALCH Oligoribonuclease OS=Salmonella choleraesuis (strain SC-B67) GN=orn PE=3 SV=3 15 194 4.0E-34
sp|Q0SGU7|ORN_RHOJR Oligoribonuclease OS=Rhodococcus jostii (strain RHA1) GN=orn PE=3 SV=1 21 197 5.0E-34
sp|Q83HW9|ORN_TROW8 Oligoribonuclease OS=Tropheryma whipplei (strain TW08/27) GN=orn PE=3 SV=1 21 198 6.0E-34
sp|A8AMN6|ORN_CITK8 Oligoribonuclease OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=orn PE=3 SV=1 15 198 8.0E-34
sp|A4VR15|ORN_PSEU5 Oligoribonuclease OS=Pseudomonas stutzeri (strain A1501) GN=orn PE=3 SV=1 21 199 9.0E-34
sp|P0A784|ORN_ECOLI Oligoribonuclease OS=Escherichia coli (strain K12) GN=orn PE=1 SV=2 15 194 1.0E-33
sp|P0A785|ORN_ECOL6 Oligoribonuclease OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=orn PE=3 SV=2 15 194 1.0E-33
sp|A8A7Q9|ORN_ECOHS Oligoribonuclease OS=Escherichia coli O9:H4 (strain HS) GN=orn PE=3 SV=1 15 194 1.0E-33
sp|A7ZV33|ORN_ECO24 Oligoribonuclease OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=orn PE=3 SV=1 15 194 1.0E-33
sp|Q83IJ9|ORN_SHIFL Oligoribonuclease OS=Shigella flexneri GN=orn PE=3 SV=3 15 194 2.0E-33
sp|A3NBZ6|ORN_BURP6 Oligoribonuclease OS=Burkholderia pseudomallei (strain 668) GN=orn PE=3 SV=1 10 205 2.0E-33
sp|A1V6I4|ORN_BURMS Oligoribonuclease OS=Burkholderia mallei (strain SAVP1) GN=orn PE=3 SV=1 10 205 2.0E-33
sp|Q62M61|ORN_BURMA Oligoribonuclease OS=Burkholderia mallei (strain ATCC 23344) GN=orn PE=3 SV=1 10 205 2.0E-33
sp|A2S4M9|ORN_BURM9 Oligoribonuclease OS=Burkholderia mallei (strain NCTC 10229) GN=orn PE=3 SV=1 10 205 2.0E-33
sp|A3MHS8|ORN_BURM7 Oligoribonuclease OS=Burkholderia mallei (strain NCTC 10247) GN=orn PE=3 SV=1 10 205 2.0E-33
sp|Q63S41|ORN_BURPS Oligoribonuclease OS=Burkholderia pseudomallei (strain K96243) GN=orn PE=3 SV=1 10 205 2.0E-33
sp|A3NXT2|ORN_BURP0 Oligoribonuclease OS=Burkholderia pseudomallei (strain 1106a) GN=orn PE=3 SV=1 10 205 2.0E-33
sp|O07708|ORN_MYCLE Oligoribonuclease OS=Mycobacterium leprae (strain TN) GN=orn PE=3 SV=1 21 197 2.0E-33
sp|P61651|ORN_MYCPA Oligoribonuclease OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=orn PE=3 SV=1 21 214 3.0E-33
sp|A0QDA8|ORN_MYCA1 Oligoribonuclease OS=Mycobacterium avium (strain 104) GN=orn PE=3 SV=1 21 214 3.0E-33
sp|Q17819|ORN_CAEEL Probable oligoribonuclease OS=Caenorhabditis elegans GN=C08B6.8 PE=3 SV=1 21 197 3.0E-33
sp|Q0BH60|ORN_BURCM Oligoribonuclease OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=orn PE=3 SV=1 21 193 5.0E-33
sp|A0PU74|ORN_MYCUA Oligoribonuclease OS=Mycobacterium ulcerans (strain Agy99) GN=orn PE=3 SV=1 21 197 6.0E-33
sp|A5UFF2|ORN_HAEIG Oligoribonuclease OS=Haemophilus influenzae (strain PittGG) GN=orn PE=3 SV=1 21 194 6.0E-33
sp|Q07XW1|ORN_SHEFN Oligoribonuclease OS=Shewanella frigidimarina (strain NCIMB 400) GN=orn PE=3 SV=1 21 198 7.0E-33
sp|A5UBG1|ORN_HAEIE Oligoribonuclease OS=Haemophilus influenzae (strain PittEE) GN=orn PE=3 SV=1 21 194 7.0E-33
sp|Q4QJM8|ORN_HAEI8 Oligoribonuclease OS=Haemophilus influenzae (strain 86-028NP) GN=orn PE=3 SV=1 21 194 7.0E-33
sp|P45340|ORN_HAEIN Oligoribonuclease OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=orn PE=1 SV=1 21 194 8.0E-33
sp|Q4KJ81|ORN_PSEF5 Oligoribonuclease OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=orn PE=3 SV=1 21 193 8.0E-33
sp|A8G8U2|ORN_SERP5 Oligoribonuclease OS=Serratia proteamaculans (strain 568) GN=orn PE=3 SV=1 15 194 9.0E-33
sp|A0K5Q4|ORN_BURCH Oligoribonuclease OS=Burkholderia cenocepacia (strain HI2424) GN=orn PE=3 SV=1 21 194 1.0E-32
sp|Q1BXZ5|ORN_BURCA Oligoribonuclease OS=Burkholderia cenocepacia (strain AU 1054) GN=orn PE=3 SV=1 21 194 1.0E-32
sp|P57667|ORN_STRGR Oligoribonuclease OS=Streptomyces griseus GN=orn PE=1 SV=1 21 197 1.0E-32
sp|A1JIQ8|ORN_YERE8 Oligoribonuclease OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=orn PE=3 SV=1 21 194 1.0E-32
sp|A4JCK6|ORN_BURVG Oligoribonuclease OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=orn PE=3 SV=1 21 200 2.0E-32
sp|Q8XDP0|ORN_ECO57 Oligoribonuclease OS=Escherichia coli O157:H7 GN=orn PE=3 SV=2 15 194 2.0E-32
sp|Q1LSQ0|ORN_BAUCH Oligoribonuclease OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=orn PE=3 SV=1 21 193 2.0E-32
sp|Q88DC5|ORN_PSEPK Oligoribonuclease OS=Pseudomonas putida (strain KT2440) GN=orn PE=3 SV=1 21 194 2.0E-32
sp|A5W9T8|ORN_PSEP1 Oligoribonuclease OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=orn PE=3 SV=1 21 194 2.0E-32
sp|A4J020|ORN_FRATW Oligoribonuclease OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=orn PE=3 SV=1 21 198 3.0E-32
sp|Q2A5M3|ORN_FRATH Oligoribonuclease OS=Francisella tularensis subsp. holarctica (strain LVS) GN=orn PE=3 SV=1 21 198 3.0E-32
sp|A7N9M1|ORN_FRATF Oligoribonuclease OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=orn PE=3 SV=1 21 198 3.0E-32
sp|Q1I440|ORN_PSEE4 Oligoribonuclease OS=Pseudomonas entomophila (strain L48) GN=orn PE=3 SV=1 21 194 4.0E-32
sp|Q0BNX6|ORN_FRATO Oligoribonuclease OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=orn PE=3 SV=1 21 198 4.0E-32
sp|Q8ZIW9|ORN_YERPE Oligoribonuclease OS=Yersinia pestis GN=orn PE=3 SV=1 21 199 5.0E-32
sp|Q5NI61|ORN_FRATT Oligoribonuclease OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=orn PE=3 SV=1 21 198 9.0E-32
sp|Q14JL3|ORN_FRAT1 Oligoribonuclease OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=orn PE=3 SV=1 21 198 9.0E-32
sp|Q66FC2|ORN_YERPS Oligoribonuclease OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=orn PE=3 SV=1 21 199 1.0E-31
sp|A7FMY7|ORN_YERP3 Oligoribonuclease OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=orn PE=3 SV=1 21 199 1.0E-31
sp|Q6A786|ORN_PROAC Oligoribonuclease OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=orn PE=3 SV=1 21 197 1.0E-31
sp|P57885|ORN_PASMU Oligoribonuclease OS=Pasteurella multocida (strain Pm70) GN=orn PE=3 SV=1 21 198 2.0E-31
sp|A0Q414|ORN_FRATN Oligoribonuclease OS=Francisella tularensis subsp. novicida (strain U112) GN=orn PE=3 SV=1 21 198 2.0E-31
sp|Q5WT59|ORN_LEGPL Oligoribonuclease OS=Legionella pneumophila (strain Lens) GN=orn PE=3 SV=1 17 206 3.0E-31
sp|Q5ZRY0|ORN_LEGPH Oligoribonuclease OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=orn PE=3 SV=1 17 206 3.0E-31
sp|A5IAI0|ORN_LEGPC Oligoribonuclease OS=Legionella pneumophila (strain Corby) GN=orn PE=3 SV=1 17 206 3.0E-31
sp|Q5X1E6|ORN_LEGPA Oligoribonuclease OS=Legionella pneumophila (strain Paris) GN=orn PE=3 SV=1 17 206 3.0E-31
sp|Q83C93|ORN_COXBU Oligoribonuclease OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=orn PE=1 SV=1 17 201 8.0E-31
sp|A4QGM5|ORN_CORGB Oligoribonuclease OS=Corynebacterium glutamicum (strain R) GN=orn PE=3 SV=1 4 197 1.0E-30
sp|P61650|ORN_CORDI Oligoribonuclease OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=orn PE=3 SV=1 21 195 1.0E-30
sp|Q8NMU1|ORN_CORGL Oligoribonuclease OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=orn PE=3 SV=1 4 197 1.0E-30
sp|Q3KIZ7|ORN_PSEPF Oligoribonuclease OS=Pseudomonas fluorescens (strain Pf0-1) GN=orn PE=3 SV=1 21 193 2.0E-30
sp|Q2NW86|ORN_SODGM Oligoribonuclease OS=Sodalis glossinidius (strain morsitans) GN=orn PE=3 SV=1 16 194 2.0E-30
sp|Q8PKW8|ORN_XANAC Oligoribonuclease OS=Xanthomonas axonopodis pv. citri (strain 306) GN=orn PE=3 SV=1 16 193 3.0E-30
sp|Q8K909|ORN_BUCAP Oligoribonuclease OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=orn PE=3 SV=1 15 201 4.0E-30
sp|Q3BTI2|ORN_XANC5 Oligoribonuclease OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=orn PE=3 SV=1 12 193 4.0E-30
sp|Q8P8S1|ORN_XANCP Oligoribonuclease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=orn PE=1 SV=1 12 193 4.0E-30
sp|Q4UVB0|ORN_XANC8 Oligoribonuclease OS=Xanthomonas campestris pv. campestris (strain 8004) GN=orn PE=3 SV=1 12 193 4.0E-30
sp|Q8FMX9|ORN_COREF Oligoribonuclease OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=orn PE=3 SV=1 13 197 4.0E-30
sp|Q5H0Q8|ORN_XANOR Oligoribonuclease OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=orn PE=3 SV=1 16 193 8.0E-30
sp|Q2P3P5|ORN_XANOM Oligoribonuclease OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=orn PE=3 SV=1 16 193 8.0E-30
sp|A4XPY0|ORN_PSEMY Oligoribonuclease OS=Pseudomonas mendocina (strain ymp) GN=orn PE=3 SV=1 21 193 1.0E-28
sp|Q0A8I6|ORN_ALKEH Oligoribonuclease OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=orn PE=3 SV=1 21 193 1.0E-28
sp|Q8D2C5|ORN_WIGBR Oligoribonuclease OS=Wigglesworthia glossinidia brevipalpis GN=orn PE=3 SV=1 21 196 3.0E-28
sp|A5EY84|ORN_DICNV Oligoribonuclease OS=Dichelobacter nodosus (strain VCS1703A) GN=orn PE=3 SV=1 21 197 1.0E-27
sp|Q9PDX2|ORN_XYLFA Oligoribonuclease OS=Xylella fastidiosa (strain 9a5c) GN=orn PE=3 SV=1 17 196 4.0E-27
sp|Q7VQP7|ORN_BLOFL Oligoribonuclease OS=Blochmannia floridanus GN=orn PE=3 SV=1 21 198 4.0E-27
sp|Q87E07|ORN_XYLFT Oligoribonuclease OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=orn PE=3 SV=1 17 196 7.0E-27
sp|A1AVF0|ORN_RUTMC Oligoribonuclease OS=Ruthia magnifica subsp. Calyptogena magnifica GN=orn PE=3 SV=1 21 199 6.0E-25
sp|P57637|ORN_BUCAI Oligoribonuclease OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=orn PE=3 SV=1 21 188 4.0E-23
sp|Q89A34|ORN_BUCBP Oligoribonuclease OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=orn PE=3 SV=1 21 162 3.0E-22
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7407
MASAEVPRQAAAGTSAGDAPLVWIDCEMTGLDPDTDEILEVYCVVTTGDLELVDEAGFHAVVHWPQSRLDGMDDW
CRATHGGSGLTAAVVASTTTAAQAAEGLYRYVAGLVPERRTGLLAGNSVHADRAFLRRGPWAPVVDHLHYRLLDV
SAIKEAARRWSPAGVLAAAPRKRGRHLARDDILESIAEARFYRDAIFSTAQRQGQKTEEDEGGEDEERRAGTA*
Coding >Hirsu2|7407
ATGGCGTCTGCCGAGGTGCCCAGGCAGGCGGCGGCTGGGACGAGCGCCGGCGACGCTCCTCTCGTCTGGATCGAC
TGCGAGATGACGGGGCTCGACCCGGACACGGACGAAATCCTGGAAGTCTACTGCGTCGTGACGACGGGCGATCTC
GAGCTGGTGGACGAGGCGGGCTTCCACGCGGTGGTGCACTGGCCGCAGTCGCGGCTGGACGGCATGGACGACTGG
TGCCGGGCGACGCACGGCGGGTCGGGGCTGACGGCGGCGGTGGTGGCGTCGACGACGACGGCGGCGCAGGCGGCC
GAGGGCCTGTACCGGTACGTGGCCGGGCTGGTGCCGGAGCGGCGGACGGGGCTGCTGGCGGGCAACAGCGTGCAC
GCGGACCGGGCCTTTCTGCGGCGCGGGCCGTGGGCGCCGGTCGTCGACCACCTGCACTACCGGCTGCTGGACGTC
AGCGCCATCAAGGAGGCGGCCCGGCGCTGGTCGCCGGCGGGGGTGCTGGCGGCGGCGCCGCGCAAGAGGGGCCGC
CACCTGGCCCGCGACGACATCCTCGAGAGCATCGCCGAGGCGCGCTTCTACCGCGACGCCATCTTTTCGACGGCC
CAGAGGCAGGGGCAGAAGACGGAAGAGGATGAGGGCGGCGAAGACGAGGAGAGACGAGCCGGCACGGCTTGA
Transcript >Hirsu2|7407
ATGGCGTCTGCCGAGGTGCCCAGGCAGGCGGCGGCTGGGACGAGCGCCGGCGACGCTCCTCTCGTCTGGATCGAC
TGCGAGATGACGGGGCTCGACCCGGACACGGACGAAATCCTGGAAGTCTACTGCGTCGTGACGACGGGCGATCTC
GAGCTGGTGGACGAGGCGGGCTTCCACGCGGTGGTGCACTGGCCGCAGTCGCGGCTGGACGGCATGGACGACTGG
TGCCGGGCGACGCACGGCGGGTCGGGGCTGACGGCGGCGGTGGTGGCGTCGACGACGACGGCGGCGCAGGCGGCC
GAGGGCCTGTACCGGTACGTGGCCGGGCTGGTGCCGGAGCGGCGGACGGGGCTGCTGGCGGGCAACAGCGTGCAC
GCGGACCGGGCCTTTCTGCGGCGCGGGCCGTGGGCGCCGGTCGTCGACCACCTGCACTACCGGCTGCTGGACGTC
AGCGCCATCAAGGAGGCGGCCCGGCGCTGGTCGCCGGCGGGGGTGCTGGCGGCGGCGCCGCGCAAGAGGGGCCGC
CACCTGGCCCGCGACGACATCCTCGAGAGCATCGCCGAGGCGCGCTTCTACCGCGACGCCATCTTTTCGACGGCC
CAGAGGCAGGGGCAGAAGACGGAAGAGGATGAGGGCGGCGAAGACGAGGAGAGACGAGCCGGCACGGCTTGA
Gene >Hirsu2|7407
ATGGCGTCTGCCGAGGTGCCCAGGCAGGCGGCGGCTGGGACGAGCGCCGGCGACGCTCCTCTCGTCTGGATCGAC
TGCGAGGTGAGAACGACAGCCGCTCAGCTCGCCCTCTCGGAAAGCGGTGATGAGGCACAGCCGGCAGATAAAGGG
GGGCTGACGGCGCCAACACCAAGATGACGGGGCTCGACCCGGACACGGACGAAATCCTGGAAGTCTACTGCGTCG
TGACGACGGGCGATCTCGAGCTGGTGGACGAGGCGGGCTTCCACGCGGTGGTGCACTGGCCGCAGTCGCGGCTGG
ACGGCATGGACGACTGGTGCCGGGCGACGCACGGCGGGTCGGGGCTGACGGCGGCGGTGGTGGCGTCGACGACGA
CGGCGGCGCAGGCGGCCGAGGGCCTGTACCGGTACGTGGCCGGGCTGGTGCCGGAGCGGCGGACGGGGCTGCTGG
CGGGCAACAGCGTGCACGCGGACCGGGCCTTTCTGCGGCGCGGGCCGTGGGCGCCGGTCGTCGACCACCTGCACT
ACCGGCTGCTGGACGTCAGCGCCATCAAGGAGGCGGCCCGGCGCTGGTCGCCGGCGGGGGTGCTGGCGGCGGCGC
CGCGCAAGAGGGGCCGCCACCTGGCCCGCGACGACATCCTCGAGAGCATCGCCGAGGCGCGCTTCTACCGCGACG
CCATCTTTTCGACGGCCCAGAGGCAGGGGCAGAAGACGGAAGAGGATGAGGGCGGCGAAGACGAGGAGAGACGAG
CCGGCACGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail