Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7406
Gene name
LocationContig_43:19543..21475
Strand-
Gene length (bp)1932
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I 1.1E-32 14 154
PF02880 PGM_PMM_III Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III 4.9E-24 295 414
PF02879 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II 2.9E-14 185 287
PF00408 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-terminal domain 2.0E-05 462 525

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WY53|PGM_ASPFU Phosphoglucomutase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgmA PE=3 SV=1 1 553 0.0E+00
sp|P57749|PGM_ASPOR Phosphoglucomutase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgmA PE=2 SV=1 1 553 0.0E+00
sp|Q9P931|PGM_EMENI Phosphoglucomutase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgmB PE=3 SV=2 1 553 0.0E+00
sp|P37012|PGM2_YEAST Phosphoglucomutase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PGM2 PE=1 SV=1 3 553 0.0E+00
sp|O74374|PGM_SCHPO Phosphoglucomutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC32F12.10 PE=1 SV=1 3 553 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WY53|PGM_ASPFU Phosphoglucomutase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgmA PE=3 SV=1 1 553 0.0E+00
sp|P57749|PGM_ASPOR Phosphoglucomutase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgmA PE=2 SV=1 1 553 0.0E+00
sp|Q9P931|PGM_EMENI Phosphoglucomutase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgmB PE=3 SV=2 1 553 0.0E+00
sp|P37012|PGM2_YEAST Phosphoglucomutase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PGM2 PE=1 SV=1 3 553 0.0E+00
sp|O74374|PGM_SCHPO Phosphoglucomutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC32F12.10 PE=1 SV=1 3 553 0.0E+00
sp|P33401|PGM1_YEAST Phosphoglucomutase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PGM1 PE=1 SV=1 11 553 0.0E+00
sp|Q08DP0|PGM1_BOVIN Phosphoglucomutase-1 OS=Bos taurus GN=PGM1 PE=2 SV=1 1 553 0.0E+00
sp|P36871|PGM1_HUMAN Phosphoglucomutase-1 OS=Homo sapiens GN=PGM1 PE=1 SV=3 1 553 0.0E+00
sp|Q4R5E4|PGM1_MACFA Phosphoglucomutase-1 OS=Macaca fascicularis GN=PGM1 PE=2 SV=3 1 553 0.0E+00
sp|Q9D0F9|PGM1_MOUSE Phosphoglucomutase-1 OS=Mus musculus GN=Pgm1 PE=1 SV=4 1 553 0.0E+00
sp|P38652|PGM1_RAT Phosphoglucomutase-1 OS=Rattus norvegicus GN=Pgm1 PE=1 SV=2 1 553 0.0E+00
sp|P00949|PGM1_RABIT Phosphoglucomutase-1 OS=Oryctolagus cuniculus GN=PGM1 PE=1 SV=2 1 553 0.0E+00
sp|P39671|PGM_RHIRD Phosphoglucomutase OS=Rhizobium radiobacter GN=pgm PE=1 SV=1 3 553 0.0E+00
sp|Q9SMM0|PGMP_BRANA Phosphoglucomutase, chloroplastic OS=Brassica napus GN=PGMP PE=2 SV=1 1 553 0.0E+00
sp|Q9SCY0|PGMP_ARATH Phosphoglucomutase, chloroplastic OS=Arabidopsis thaliana GN=PGMP PE=1 SV=2 1 553 0.0E+00
sp|Q23919|PGM1_DICDI Phosphoglucomutase-1 OS=Dictyostelium discoideum GN=pgmA PE=2 SV=1 3 553 0.0E+00
sp|Q9ZSQ4|PGMC_POPTN Phosphoglucomutase, cytoplasmic OS=Populus tremula GN=PGM1 PE=2 SV=1 1 553 0.0E+00
sp|Q9VUY9|PGM_DROME Phosphoglucomutase OS=Drosophila melanogaster GN=Pgm PE=1 SV=1 1 553 0.0E+00
sp|Q7KHA1|PGM_DROSI Phosphoglucomutase OS=Drosophila simulans GN=Pgm PE=3 SV=1 1 553 0.0E+00
sp|Q9M4G5|PGMP_SOLTU Phosphoglucomutase, chloroplastic OS=Solanum tuberosum GN=PGMP PE=2 SV=1 1 553 0.0E+00
sp|Q9M4G4|PGMC_SOLTU Phosphoglucomutase, cytoplasmic OS=Solanum tuberosum GN=PGM1 PE=2 SV=1 3 553 0.0E+00
sp|P93805|PGMC2_MAIZE Phosphoglucomutase, cytoplasmic 2 OS=Zea mays PE=2 SV=2 10 553 0.0E+00
sp|Q9SNX2|PGMC_BROIN Phosphoglucomutase, cytoplasmic OS=Bromus inermis GN=PGM1 PE=2 SV=1 10 553 0.0E+00
sp|Q9SM60|PGMC_PEA Phosphoglucomutase, cytoplasmic OS=Pisum sativum GN=PGM1 PE=2 SV=1 3 553 0.0E+00
sp|P93804|PGMC1_MAIZE Phosphoglucomutase, cytoplasmic 1 OS=Zea mays PE=2 SV=2 10 553 0.0E+00
sp|Q9SM59|PGMP_PEA Phosphoglucomutase, chloroplastic OS=Pisum sativum GN=PGMP PE=2 SV=1 1 553 0.0E+00
sp|P93262|PGMC_MESCR Phosphoglucomutase, cytoplasmic OS=Mesembryanthemum crystallinum GN=PGM1 PE=2 SV=1 3 553 0.0E+00
sp|Q9SGC1|PGMC2_ARATH Probable phosphoglucomutase, cytoplasmic 2 OS=Arabidopsis thaliana GN=At1g70730 PE=2 SV=1 3 553 0.0E+00
sp|O49299|PGMC1_ARATH Probable phosphoglucomutase, cytoplasmic 1 OS=Arabidopsis thaliana GN=At1g23190 PE=2 SV=2 3 553 9.0E-179
sp|Q8BZF8|PGM5_MOUSE Phosphoglucomutase-like protein 5 OS=Mus musculus GN=Pgm5 PE=1 SV=2 3 553 2.0E-165
sp|Q15124|PGM5_HUMAN Phosphoglucomutase-like protein 5 OS=Homo sapiens GN=PGM5 PE=1 SV=2 3 553 2.0E-164
sp|O02606|PGM2_PARTE Phosphoglucomutase-2 OS=Paramecium tetraurelia GN=pp63-2 PE=2 SV=1 9 553 2.0E-157
sp|P47244|PGM1_PARTE Phosphoglucomutase-1 OS=Paramecium tetraurelia GN=pp63-1 PE=1 SV=4 9 553 1.0E-152
sp|O18719|PGM_ENTDI Phosphoglucomutase OS=Entamoeba dispar GN=pgm PE=2 SV=1 3 553 7.0E-138
sp|O15820|PGM_ENTHI Phosphoglucomutase OS=Entamoeba histolytica GN=pgm PE=2 SV=1 3 553 2.0E-137
sp|P38569|PGM_KOMXY Phosphoglucomutase OS=Komagataeibacter xylinus GN=celB PE=3 SV=1 17 383 1.0E-14
sp|P36938|PGM_ECOLI Phosphoglucomutase OS=Escherichia coli (strain K12) GN=pgm PE=1 SV=1 15 395 2.0E-14
sp|Q5HLD2|PGCA_STAEQ Phosphoglucomutase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pgcA PE=3 SV=1 54 411 1.0E-11
sp|Q6AMQ5|GLMM_DESPS Phosphoglucosamine mutase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=glmM PE=3 SV=1 54 412 2.0E-11
sp|A9BMK7|GLMM_DELAS Phosphoglucosamine mutase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=glmM PE=3 SV=1 79 379 4.0E-11
sp|Q21WW5|GLMM_RHOFT Phosphoglucosamine mutase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=glmM PE=3 SV=1 17 379 5.0E-11
sp|C5CKU7|GLMM_VARPS Phosphoglucosamine mutase OS=Variovorax paradoxus (strain S110) GN=glmM PE=3 SV=1 17 379 6.0E-11
sp|Q57290|Y740_HAEIN Probable phosphomannomutase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0740 PE=1 SV=1 54 526 7.0E-11
sp|A1VQI3|GLMM_POLNA Phosphoglucosamine mutase OS=Polaromonas naphthalenivorans (strain CJ2) GN=glmM PE=3 SV=1 79 379 8.0E-11
sp|A2SF93|GLMM_METPP Phosphoglucosamine mutase OS=Methylibium petroleiphilum (strain PM1) GN=glmM PE=3 SV=1 76 375 2.0E-10
sp|Q8CN38|PGCA_STAES Phosphoglucomutase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pgcA PE=3 SV=1 54 411 2.0E-10
sp|Q7NRI6|GLMM_CHRVO Phosphoglucosamine mutase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=glmM PE=3 SV=1 77 367 2.0E-10
sp|A1KV99|GLMM_NEIMF Phosphoglucosamine mutase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=glmM PE=3 SV=1 17 443 3.0E-10
sp|B8GNY2|GLMM_THISH Phosphoglucosamine mutase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=glmM PE=3 SV=1 89 395 3.0E-10
sp|A5UKY3|GLMM_METS3 Probable phosphoglucosamine mutase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=glmM PE=3 SV=2 17 299 4.0E-10
sp|Q49WH7|PGCA_STAS1 Phosphoglucomutase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pgcA PE=3 SV=1 48 396 6.0E-10
sp|A0KNE8|GLMM_AERHH Phosphoglucosamine mutase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=glmM PE=3 SV=1 76 394 6.0E-10
sp|A1WEE4|GLMM_VEREI Phosphoglucosamine mutase OS=Verminephrobacter eiseniae (strain EF01-2) GN=glmM PE=3 SV=1 14 379 1.0E-09
sp|Q0AHC3|GLMM_NITEC Phosphoglucosamine mutase OS=Nitrosomonas eutropha (strain C91) GN=glmM PE=3 SV=1 17 307 1.0E-09
sp|A6TEJ5|GLMM_KLEP7 Phosphoglucosamine mutase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=glmM PE=3 SV=1 88 394 2.0E-09
sp|B5XSW5|GLMM_KLEP3 Phosphoglucosamine mutase OS=Klebsiella pneumoniae (strain 342) GN=glmM PE=3 SV=1 88 394 2.0E-09
sp|Q3SJR2|GLMM_THIDA Phosphoglucosamine mutase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=glmM PE=3 SV=1 17 319 2.0E-09
sp|Q6LUJ6|GLMM_PHOPR Phosphoglucosamine mutase OS=Photobacterium profundum GN=glmM PE=3 SV=2 89 394 2.0E-09
sp|A4SJR0|GLMM_AERS4 Phosphoglucosamine mutase OS=Aeromonas salmonicida (strain A449) GN=glmM PE=3 SV=1 17 394 3.0E-09
sp|A4VPP5|GLMM_PSEU5 Phosphoglucosamine mutase OS=Pseudomonas stutzeri (strain A1501) GN=glmM PE=3 SV=2 76 402 3.0E-09
sp|A9M1R2|GLMM_NEIM0 Phosphoglucosamine mutase OS=Neisseria meningitidis serogroup C (strain 053442) GN=glmM PE=3 SV=1 17 443 3.0E-09
sp|A1TQF3|GLMM_ACIAC Phosphoglucosamine mutase OS=Acidovorax citrulli (strain AAC00-1) GN=glmM PE=3 SV=1 17 367 4.0E-09
sp|A1W8G7|GLMM_ACISJ Phosphoglucosamine mutase OS=Acidovorax sp. (strain JS42) GN=glmM PE=3 SV=1 79 379 5.0E-09
sp|B9MI07|GLMM_ACIET Phosphoglucosamine mutase OS=Acidovorax ebreus (strain TPSY) GN=glmM PE=3 SV=1 79 379 7.0E-09
sp|A5N4Y9|GLMM_CLOK5 Phosphoglucosamine mutase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=glmM PE=3 SV=1 89 408 1.0E-08
sp|B9DYJ3|GLMM_CLOK1 Phosphoglucosamine mutase OS=Clostridium kluyveri (strain NBRC 12016) GN=glmM PE=3 SV=1 89 408 1.0E-08
sp|B4F2B5|GLMM_PROMH Phosphoglucosamine mutase OS=Proteus mirabilis (strain HI4320) GN=glmM PE=3 SV=1 89 324 1.0E-08
sp|B0KD39|GLMM_THEP3 Phosphoglucosamine mutase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=glmM PE=3 SV=1 89 367 1.0E-08
sp|B8I0I6|GLMM_CLOCE Phosphoglucosamine mutase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=glmM PE=3 SV=1 89 442 1.0E-08
sp|Q68BJ6|PGMMM_THEKO Phosphoglucomutase/phosphomannomutase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1108 PE=1 SV=1 89 395 1.0E-08
sp|Q24NW7|GLMM_DESHY Phosphoglucosamine mutase OS=Desulfitobacterium hafniense (strain Y51) GN=glmM PE=3 SV=1 54 395 1.0E-08
sp|B1YH95|GLMM_EXIS2 Phosphoglucosamine mutase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=glmM PE=3 SV=1 17 405 1.0E-08
sp|Q5P1F7|GLMM_AROAE Phosphoglucosamine mutase OS=Aromatoleum aromaticum (strain EbN1) GN=glmM PE=3 SV=1 17 394 2.0E-08
sp|Q5HD61|PGCA_STAAC Phosphoglucomutase OS=Staphylococcus aureus (strain COL) GN=pgcA PE=3 SV=2 54 448 2.0E-08
sp|Q2FVC1|PGCA_STAA8 Phosphoglucomutase OS=Staphylococcus aureus (strain NCTC 8325) GN=pgcA PE=1 SV=2 54 448 2.0E-08
sp|Q2FE11|PGCA_STAA3 Phosphoglucomutase OS=Staphylococcus aureus (strain USA300) GN=pgcA PE=3 SV=2 54 448 2.0E-08
sp|Q6GDU9|PGCA_STAAR Phosphoglucomutase OS=Staphylococcus aureus (strain MRSA252) GN=pgcA PE=3 SV=1 54 448 3.0E-08
sp|Q1H384|GLMM_METFK Phosphoglucosamine mutase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=glmM PE=3 SV=1 88 405 3.0E-08
sp|A4XH45|GLMM_CALS8 Phosphoglucosamine mutase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=glmM PE=3 SV=1 89 302 4.0E-08
sp|B0K5X4|GLMM_THEPX Phosphoglucosamine mutase OS=Thermoanaerobacter sp. (strain X514) GN=glmM PE=3 SV=1 89 367 4.0E-08
sp|Q4KIG0|GLMM_PSEF5 Phosphoglucosamine mutase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=glmM PE=3 SV=1 76 410 4.0E-08
sp|B2I1H8|GLMM_ACIBC Phosphoglucosamine mutase OS=Acinetobacter baumannii (strain ACICU) GN=glmM PE=3 SV=1 17 310 4.0E-08
sp|A3M9W5|GLMM_ACIBT Phosphoglucosamine mutase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=glmM PE=3 SV=2 17 310 4.0E-08
sp|B0VNX9|GLMM_ACIBS Phosphoglucosamine mutase OS=Acinetobacter baumannii (strain SDF) GN=glmM PE=3 SV=1 17 310 4.0E-08
sp|B0V9C8|GLMM_ACIBY Phosphoglucosamine mutase OS=Acinetobacter baumannii (strain AYE) GN=glmM PE=3 SV=1 17 310 4.0E-08
sp|B7ICC7|GLMM_ACIB5 Phosphoglucosamine mutase OS=Acinetobacter baumannii (strain AB0057) GN=glmM PE=3 SV=1 17 310 4.0E-08
sp|B7GV90|GLMM_ACIB3 Phosphoglucosamine mutase OS=Acinetobacter baumannii (strain AB307-0294) GN=glmM PE=3 SV=1 17 310 4.0E-08
sp|B1HMT3|GLMM_LYSSC Phosphoglucosamine mutase OS=Lysinibacillus sphaericus (strain C3-41) GN=glmM PE=3 SV=1 89 406 4.0E-08
sp|Q3AAK3|GLMM_CARHZ Phosphoglucosamine mutase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=glmM PE=3 SV=1 17 412 6.0E-08
sp|Q46ZA1|GLMM_CUPPJ Phosphoglucosamine mutase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=glmM PE=3 SV=1 79 394 7.0E-08
sp|A1JIW5|GLMM_YERE8 Phosphoglucosamine mutase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=glmM PE=3 SV=1 88 447 7.0E-08
sp|A4WEY7|GLMM_ENT38 Phosphoglucosamine mutase OS=Enterobacter sp. (strain 638) GN=glmM PE=3 SV=1 89 394 9.0E-08
sp|Q31HG3|GLMM_THICR Phosphoglucosamine mutase OS=Thiomicrospira crunogena (strain XCL-2) GN=glmM PE=3 SV=1 77 369 1.0E-07
sp|Q1QC16|GLMM_PSYCK Phosphoglucosamine mutase OS=Psychrobacter cryohalolentis (strain K5) GN=glmM PE=3 SV=1 54 397 1.0E-07
sp|B6END8|GLMM_ALISL Phosphoglucosamine mutase OS=Aliivibrio salmonicida (strain LFI1238) GN=glmM PE=3 SV=1 89 319 1.0E-07
sp|A5W992|GLMM_PSEP1 Phosphoglucosamine mutase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=glmM PE=3 SV=1 76 410 1.0E-07
sp|Q7A3K7|PGCA_STAAN Phosphoglucomutase OS=Staphylococcus aureus (strain N315) GN=pgcA PE=1 SV=2 54 448 1.0E-07
sp|Q99RE2|PGCA_STAAM Phosphoglucomutase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pgcA PE=3 SV=2 54 448 1.0E-07
sp|Q88DV3|GLMM_PSEPK Phosphoglucosamine mutase OS=Pseudomonas putida (strain KT2440) GN=glmM PE=3 SV=1 76 410 1.0E-07
sp|B8CKG8|GLMM_SHEPW Phosphoglucosamine mutase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=glmM PE=3 SV=1 76 394 1.0E-07
sp|Q47HH9|GLMM_DECAR Phosphoglucosamine mutase OS=Dechloromonas aromatica (strain RCB) GN=glmM PE=3 SV=1 17 394 1.0E-07
sp|Q0T0A8|GLMM_SHIF8 Phosphoglucosamine mutase OS=Shigella flexneri serotype 5b (strain 8401) GN=glmM PE=3 SV=1 88 394 1.0E-07
sp|Q8NUV4|PGCA_STAAW Phosphoglucomutase OS=Staphylococcus aureus (strain MW2) GN=pgcA PE=3 SV=2 54 448 1.0E-07
sp|Q6G6I3|PGCA_STAAS Phosphoglucomutase OS=Staphylococcus aureus (strain MSSA476) GN=pgcA PE=3 SV=1 54 448 1.0E-07
sp|Q15VJ3|GLMM_PSEA6 Phosphoglucosamine mutase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=glmM PE=3 SV=1 17 394 1.0E-07
sp|Q8XZ76|GLMM_RALSO Phosphoglucosamine mutase OS=Ralstonia solanacearum (strain GMI1000) GN=glmM PE=3 SV=1 54 394 2.0E-07
sp|A6T078|GLMM_JANMA Phosphoglucosamine mutase OS=Janthinobacterium sp. (strain Marseille) GN=glmM PE=3 SV=1 17 394 2.0E-07
sp|B5BGK0|GLMM_SALPK Phosphoglucosamine mutase OS=Salmonella paratyphi A (strain AKU_12601) GN=glmM PE=3 SV=1 89 394 2.0E-07
sp|Q5PLC4|GLMM_SALPA Phosphoglucosamine mutase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glmM PE=3 SV=1 89 394 2.0E-07
sp|B1J265|GLMM_PSEPW Phosphoglucosamine mutase OS=Pseudomonas putida (strain W619) GN=glmM PE=3 SV=1 76 410 2.0E-07
sp|B0TCS1|GLMM_HELMI Phosphoglucosamine mutase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=glmM PE=3 SV=1 89 408 2.0E-07
sp|Q3KKM5|GLMM_CHLTA Phosphoglucosamine mutase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=glmM PE=3 SV=1 17 303 2.0E-07
sp|B0BAS3|GLMM_CHLTB Phosphoglucosamine mutase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=glmM PE=3 SV=1 17 303 2.0E-07
sp|B0B944|GLMM_CHLT2 Phosphoglucosamine mutase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=glmM PE=3 SV=1 17 303 2.0E-07
sp|O84822|GLMM_CHLTR Phosphoglucosamine mutase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=glmM PE=3 SV=1 17 303 2.0E-07
sp|A4G4B3|GLMM_HERAR Phosphoglucosamine mutase OS=Herminiimonas arsenicoxydans GN=glmM PE=3 SV=1 76 394 3.0E-07
sp|Q0K8Y7|GLMM_CUPNH Phosphoglucosamine mutase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=glmM PE=3 SV=1 79 394 3.0E-07
sp|B7N0V9|GLMM_ECO81 Phosphoglucosamine mutase OS=Escherichia coli O81 (strain ED1a) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|B7LHN9|GLMM_ECO55 Phosphoglucosamine mutase OS=Escherichia coli (strain 55989 / EAEC) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|B7LR43|GLMM_ESCF3 Phosphoglucosamine mutase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|B9MMU5|GLMM_CALBD Phosphoglucosamine mutase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=glmM PE=3 SV=1 89 302 3.0E-07
sp|B7NKP3|GLMM_ECO7I Phosphoglucosamine mutase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|B2U201|GLMM_SHIB3 Phosphoglucosamine mutase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|B6I1P9|GLMM_ECOSE Phosphoglucosamine mutase OS=Escherichia coli (strain SE11) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|P31120|GLMM_ECOLI Phosphoglucosamine mutase OS=Escherichia coli (strain K12) GN=glmM PE=1 SV=3 88 394 3.0E-07
sp|B1IQU7|GLMM_ECOLC Phosphoglucosamine mutase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|A8A4Z0|GLMM_ECOHS Phosphoglucosamine mutase OS=Escherichia coli O9:H4 (strain HS) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|B1XGY6|GLMM_ECODH Phosphoglucosamine mutase OS=Escherichia coli (strain K12 / DH10B) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|C4ZSR5|GLMM_ECOBW Phosphoglucosamine mutase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|B7M082|GLMM_ECO8A Phosphoglucosamine mutase OS=Escherichia coli O8 (strain IAI1) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|A7ZS72|GLMM_ECO24 Phosphoglucosamine mutase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|B0KHY3|GLMM_PSEPG Phosphoglucosamine mutase OS=Pseudomonas putida (strain GB-1) GN=glmM PE=3 SV=1 89 410 3.0E-07
sp|Q31W53|GLMM_SHIBS Phosphoglucosamine mutase OS=Shigella boydii serotype 4 (strain Sb227) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|B5YS65|GLMM_ECO5E Phosphoglucosamine mutase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|Q8X9L2|GLMM_ECO57 Phosphoglucosamine mutase OS=Escherichia coli O157:H7 GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|A5WEW6|GLMM_PSYWF Phosphoglucosamine mutase OS=Psychrobacter sp. (strain PRwf-1) GN=glmM PE=3 SV=1 46 394 3.0E-07
sp|Q3YX65|GLMM_SHISS Phosphoglucosamine mutase OS=Shigella sonnei (strain Ss046) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|Q1R6G2|GLMM_ECOUT Phosphoglucosamine mutase OS=Escherichia coli (strain UTI89 / UPEC) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|B1LFS6|GLMM_ECOSM Phosphoglucosamine mutase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|B7NDG0|GLMM_ECOLU Phosphoglucosamine mutase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|Q8FD84|GLMM_ECOL6 Phosphoglucosamine mutase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|Q0TCT4|GLMM_ECOL5 Phosphoglucosamine mutase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|A1AG79|GLMM_ECOK1 Phosphoglucosamine mutase OS=Escherichia coli O1:K1 / APEC GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|B7MB95|GLMM_ECO45 Phosphoglucosamine mutase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|B7UJ69|GLMM_ECO27 Phosphoglucosamine mutase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=glmM PE=3 SV=1 88 394 3.0E-07
sp|C3K264|GLMM_PSEFS Phosphoglucosamine mutase OS=Pseudomonas fluorescens (strain SBW25) GN=glmM PE=3 SV=1 76 410 4.0E-07
sp|Q2YBS8|GLMM_NITMU Phosphoglucosamine mutase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=glmM PE=3 SV=1 76 375 4.0E-07
sp|Q83Q15|GLMM_SHIFL Phosphoglucosamine mutase OS=Shigella flexneri GN=glmM PE=3 SV=1 88 324 4.0E-07
sp|B0TQA7|GLMM_SHEHH Phosphoglucosamine mutase OS=Shewanella halifaxensis (strain HAW-EB4) GN=glmM PE=3 SV=1 76 394 4.0E-07
sp|A9MP31|GLMM_SALAR Phosphoglucosamine mutase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=glmM PE=3 SV=1 88 394 5.0E-07
sp|B1JMH4|GLMM_YERPY Phosphoglucosamine mutase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=glmM PE=3 SV=1 88 286 5.0E-07
sp|Q66F64|GLMM_YERPS Phosphoglucosamine mutase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glmM PE=3 SV=1 88 286 5.0E-07
sp|A4TRI7|GLMM_YERPP Phosphoglucosamine mutase OS=Yersinia pestis (strain Pestoides F) GN=glmM PE=3 SV=1 88 286 5.0E-07
sp|Q1CEK9|GLMM_YERPN Phosphoglucosamine mutase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=glmM PE=3 SV=1 88 286 5.0E-07
sp|A9R599|GLMM_YERPG Phosphoglucosamine mutase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=glmM PE=3 SV=1 88 286 5.0E-07
sp|Q8ZBB8|GLMM_YERPE Phosphoglucosamine mutase OS=Yersinia pestis GN=glmM PE=3 SV=1 88 286 5.0E-07
sp|B2K2Q1|GLMM_YERPB Phosphoglucosamine mutase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=glmM PE=3 SV=1 88 286 5.0E-07
sp|Q1CC03|GLMM_YERPA Phosphoglucosamine mutase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=glmM PE=3 SV=1 88 286 5.0E-07
sp|A7FMS6|GLMM_YERP3 Phosphoglucosamine mutase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=glmM PE=3 SV=1 88 286 5.0E-07
sp|B2UGP7|GLMM_RALPJ Phosphoglucosamine mutase OS=Ralstonia pickettii (strain 12J) GN=glmM PE=3 SV=1 54 394 5.0E-07
sp|A1AR93|GLMM_PELPD Phosphoglucosamine mutase OS=Pelobacter propionicus (strain DSM 2379) GN=glmM PE=3 SV=1 54 367 5.0E-07
sp|Q1IF48|GLMM_PSEE4 Phosphoglucosamine mutase OS=Pseudomonas entomophila (strain L48) GN=glmM PE=3 SV=1 76 407 6.0E-07
sp|A8H745|GLMM_SHEPA Phosphoglucosamine mutase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=glmM PE=3 SV=1 76 394 6.0E-07
sp|Q890U1|GLMM_CLOTE Phosphoglucosamine mutase OS=Clostridium tetani (strain Massachusetts / E88) GN=glmM PE=3 SV=1 89 315 6.0E-07
sp|C0PZ59|GLMM_SALPC Phosphoglucosamine mutase OS=Salmonella paratyphi C (strain RKS4594) GN=glmM PE=3 SV=1 89 394 7.0E-07
sp|Q57JH3|GLMM_SALCH Phosphoglucosamine mutase OS=Salmonella choleraesuis (strain SC-B67) GN=glmM PE=3 SV=1 89 394 7.0E-07
sp|Q1LLB1|GLMM_CUPMC Phosphoglucosamine mutase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=glmM PE=3 SV=1 77 394 7.0E-07
sp|Q7CPP9|GLMM_SALTY Phosphoglucosamine mutase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glmM PE=3 SV=1 89 394 7.0E-07
sp|Q8XF81|GLMM_SALTI Phosphoglucosamine mutase OS=Salmonella typhi GN=glmM PE=3 SV=1 89 394 7.0E-07
sp|B4TWE3|GLMM_SALSV Phosphoglucosamine mutase OS=Salmonella schwarzengrund (strain CVM19633) GN=glmM PE=3 SV=1 89 394 7.0E-07
sp|A9N740|GLMM_SALPB Phosphoglucosamine mutase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glmM PE=3 SV=1 89 394 7.0E-07
sp|B4T705|GLMM_SALNS Phosphoglucosamine mutase OS=Salmonella newport (strain SL254) GN=glmM PE=3 SV=1 89 394 7.0E-07
sp|B4TJ12|GLMM_SALHS Phosphoglucosamine mutase OS=Salmonella heidelberg (strain SL476) GN=glmM PE=3 SV=1 89 394 7.0E-07
sp|B5REP2|GLMM_SALG2 Phosphoglucosamine mutase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=glmM PE=3 SV=1 89 394 7.0E-07
sp|B5QZW4|GLMM_SALEP Phosphoglucosamine mutase OS=Salmonella enteritidis PT4 (strain P125109) GN=glmM PE=3 SV=1 89 394 7.0E-07
sp|B5FI19|GLMM_SALDC Phosphoglucosamine mutase OS=Salmonella dublin (strain CT_02021853) GN=glmM PE=3 SV=1 89 394 7.0E-07
sp|B5F6U4|GLMM_SALA4 Phosphoglucosamine mutase OS=Salmonella agona (strain SL483) GN=glmM PE=3 SV=1 89 394 7.0E-07
sp|B5FA75|GLMM_VIBFM Phosphoglucosamine mutase OS=Vibrio fischeri (strain MJ11) GN=glmM PE=3 SV=1 88 319 7.0E-07
sp|C6DKI6|GLMM_PECCP Phosphoglucosamine mutase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=glmM PE=3 SV=1 88 367 8.0E-07
sp|Q5E7M0|GLMM_VIBF1 Phosphoglucosamine mutase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=glmM PE=3 SV=3 88 319 8.0E-07
sp|Q0VSS6|GLMM_ALCBS Phosphoglucosamine mutase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=glmM PE=3 SV=1 51 408 9.0E-07
sp|B2JFP2|GLMM_BURP8 Phosphoglucosamine mutase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=glmM PE=3 SV=1 17 394 9.0E-07
sp|Q2SML8|GLMM_HAHCH Phosphoglucosamine mutase OS=Hahella chejuensis (strain KCTC 2396) GN=glmM PE=3 SV=1 76 319 1.0E-06
sp|P26276|ALGC_PSEAE Phosphomannomutase/phosphoglucomutase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=algC PE=1 SV=4 54 303 1.0E-06
sp|Q02E40|ALGC_PSEAB Phosphomannomutase/phosphoglucomutase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=algC PE=1 SV=2 54 303 1.0E-06
sp|A8AQ65|GLMM_CITK8 Phosphoglucosamine mutase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=glmM PE=3 SV=1 89 394 1.0E-06
sp|Q2NW27|GLMM_SODGM Phosphoglucosamine mutase OS=Sodalis glossinidius (strain morsitans) GN=glmM PE=3 SV=1 88 286 1.0E-06
sp|A1VY80|GLMM_CAMJJ Phosphoglucosamine mutase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=glmM PE=3 SV=2 87 405 1.0E-06
sp|Q9PIE2|GLMM_CAMJE Phosphoglucosamine mutase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=glmM PE=3 SV=1 87 405 2.0E-06
sp|Q5HWA7|GLMM_CAMJR Phosphoglucosamine mutase OS=Campylobacter jejuni (strain RM1221) GN=glmM PE=3 SV=1 87 405 2.0E-06
sp|Q7VZ59|GLMM_BORPE Phosphoglucosamine mutase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glmM PE=3 SV=1 54 310 2.0E-06
sp|A9HYU0|GLMM_BORPD Phosphoglucosamine mutase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=glmM PE=3 SV=1 54 367 2.0E-06
sp|Q7VP94|GLMM_HAEDU Phosphoglucosamine mutase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=glmM PE=3 SV=1 89 398 2.0E-06
sp|Q7W8R3|GLMM_BORPA Phosphoglucosamine mutase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glmM PE=3 SV=1 54 310 2.0E-06
sp|Q7WMD0|GLMM_BORBR Phosphoglucosamine mutase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glmM PE=3 SV=1 54 310 2.0E-06
sp|B7JYN0|GLMM_CYAP8 Phosphoglucosamine mutase OS=Cyanothece sp. (strain PCC 8801) GN=glmM PE=3 SV=1 17 297 3.0E-06
sp|P95575|GLMM_PSEU2 Phosphoglucosamine mutase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=glmM PE=3 SV=1 76 394 3.0E-06
sp|Q493U0|GLMM_BLOPB Phosphoglucosamine mutase OS=Blochmannia pennsylvanicus (strain BPEN) GN=glmM PE=3 SV=1 17 367 3.0E-06
sp|Q87WQ0|GLMM_PSESM Phosphoglucosamine mutase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=glmM PE=3 SV=1 76 394 3.0E-06
sp|Q2NES6|GLMM_METST Probable phosphoglucosamine mutase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=glmM PE=3 SV=1 17 302 3.0E-06
sp|P65705|GLMM_STAAW Phosphoglucosamine mutase OS=Staphylococcus aureus (strain MW2) GN=glmM PE=3 SV=1 42 302 3.0E-06
sp|Q6G7F2|GLMM_STAAS Phosphoglucosamine mutase OS=Staphylococcus aureus (strain MSSA476) GN=glmM PE=3 SV=1 42 302 3.0E-06
sp|Q6GER6|GLMM_STAAR Phosphoglucosamine mutase OS=Staphylococcus aureus (strain MRSA252) GN=glmM PE=3 SV=1 42 302 3.0E-06
sp|P99087|GLMM_STAAN Phosphoglucosamine mutase OS=Staphylococcus aureus (strain N315) GN=glmM PE=1 SV=1 42 302 3.0E-06
sp|P65704|GLMM_STAAM Phosphoglucosamine mutase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glmM PE=3 SV=1 42 302 3.0E-06
sp|A5IUV1|GLMM_STAA9 Phosphoglucosamine mutase OS=Staphylococcus aureus (strain JH9) GN=glmM PE=3 SV=1 42 302 3.0E-06
sp|A6U3P1|GLMM_STAA2 Phosphoglucosamine mutase OS=Staphylococcus aureus (strain JH1) GN=glmM PE=3 SV=1 42 302 3.0E-06
sp|A7X524|GLMM_STAA1 Phosphoglucosamine mutase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=glmM PE=3 SV=1 42 302 3.0E-06
sp|Q2YYE6|GLMM_STAAB Phosphoglucosamine mutase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=glmM PE=3 SV=1 42 302 3.0E-06
sp|C4KZK4|GLMM_EXISA Phosphoglucosamine mutase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=glmM PE=3 SV=1 45 405 3.0E-06
sp|Q49ZA7|GLMM_STAS1 Phosphoglucosamine mutase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=glmM PE=3 SV=1 42 306 4.0E-06
sp|Q7MYY3|GLMM_PHOLL Phosphoglucosamine mutase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=glmM PE=3 SV=1 89 324 4.0E-06
sp|A9G862|GLMM_SORC5 Phosphoglucosamine mutase OS=Sorangium cellulosum (strain So ce56) GN=glmM PE=3 SV=1 54 429 4.0E-06
sp|A3QGV0|GLMM_SHELP Phosphoglucosamine mutase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=glmM PE=3 SV=1 76 394 4.0E-06
sp|C1DFL3|GLMM_AZOVD Phosphoglucosamine mutase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=glmM PE=3 SV=1 76 412 4.0E-06
sp|Q32BF7|GLMM_SHIDS Phosphoglucosamine mutase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glmM PE=3 SV=1 88 394 4.0E-06
sp|Q48E72|GLMM_PSE14 Phosphoglucosamine mutase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=glmM PE=3 SV=1 76 394 4.0E-06
sp|Q6F717|GLMM_ACIAD Phosphoglucosamine mutase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=glmM PE=3 SV=1 17 310 4.0E-06
sp|A8FKE8|GLMM_CAMJ8 Phosphoglucosamine mutase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=glmM PE=3 SV=1 87 405 5.0E-06
sp|Q8CNH0|GLMM_STAES Phosphoglucosamine mutase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glmM PE=3 SV=1 42 407 5.0E-06
sp|Q5HM67|GLMM_STAEQ Phosphoglucosamine mutase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glmM PE=3 SV=1 42 407 5.0E-06
sp|A7MUV2|GLMM_VIBCB Phosphoglucosamine mutase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=glmM PE=3 SV=1 88 319 5.0E-06
sp|A8FYS5|GLMM_SHESH Phosphoglucosamine mutase OS=Shewanella sediminis (strain HAW-EB3) GN=glmM PE=3 SV=1 76 409 5.0E-06
sp|Q46AY7|GLMM_METBF Probable phosphoglucosamine mutase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=glmM PE=3 SV=1 48 301 6.0E-06
sp|Q607B4|GLMM_METCA Phosphoglucosamine mutase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=glmM PE=3 SV=1 51 412 6.0E-06
sp|A8YYC6|GLMM_STAAT Phosphoglucosamine mutase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=glmM PE=3 SV=1 42 302 7.0E-06
sp|A6QJ02|GLMM_STAAE Phosphoglucosamine mutase OS=Staphylococcus aureus (strain Newman) GN=glmM PE=3 SV=1 42 302 7.0E-06
sp|Q5HE43|GLMM_STAAC Phosphoglucosamine mutase OS=Staphylococcus aureus (strain COL) GN=glmM PE=1 SV=1 42 302 7.0E-06
sp|P0C0V7|GLMM_STAA8 Phosphoglucosamine mutase OS=Staphylococcus aureus (strain NCTC 8325) GN=glmM PE=1 SV=1 42 302 7.0E-06
sp|Q2FEX1|GLMM_STAA3 Phosphoglucosamine mutase OS=Staphylococcus aureus (strain USA300) GN=glmM PE=3 SV=1 42 302 7.0E-06
sp|A6VU24|GLMM_MARMS Phosphoglucosamine mutase OS=Marinomonas sp. (strain MWYL1) GN=glmM PE=3 SV=1 89 305 7.0E-06
sp|Q6D9B6|GLMM_PECAS Phosphoglucosamine mutase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glmM PE=3 SV=1 88 367 7.0E-06
sp|Q18CL0|GLMM_PEPD6 Phosphoglucosamine mutase OS=Peptoclostridium difficile (strain 630) GN=glmM PE=3 SV=2 89 303 9.0E-06
sp|Q4L837|GLMM_STAHJ Phosphoglucosamine mutase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=glmM PE=3 SV=1 42 302 1.0E-05
sp|B8DN76|GLMM_DESVM Phosphoglucosamine mutase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=glmM PE=3 SV=1 17 391 1.0E-05
sp|A8G903|GLMM_SERP5 Phosphoglucosamine mutase OS=Serratia proteamaculans (strain 568) GN=glmM PE=3 SV=1 88 324 1.0E-05
sp|Q21H51|GLMM_SACD2 Phosphoglucosamine mutase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=glmM PE=3 SV=1 85 410 1.0E-05
sp|Q1D498|GLMM_MYXXD Phosphoglucosamine mutase OS=Myxococcus xanthus (strain DK 1622) GN=glmM PE=3 SV=1 17 303 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016868 intramolecular transferase activity, phosphotransferases Yes
GO:0071704 organic substance metabolic process Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0008152 metabolic process No
GO:0016853 isomerase activity No
GO:0008150 biological_process No
GO:0016866 intramolecular transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7406
MDVKTVEFKPFQDQKPGTSGLRKKVTVFQQPHYSESFVASILLSIPEGVKGSFLVIGGDGRFWNPEVIQLIAKIG
AAYGVKKLLIGQNGILSTPAASHVIRLRKATGGILLTASHNPGGPSNDFGIKYNLANGGPAPESVTNKIYDASKS
LTSYKLASIPDVDIASLGSRTYGSLEVEVIDSTADYVAMLKDIFDFDTIRAFFSAHPDFKMLFDGLHGVTGPYGK
AIFETELGLAGSTQNCEPSPDFNGGHPDPNLTYARSLVDAVDKAAIPFGAASDGDGDRNMIYGANAFVSPGDSLA
IIAHHAQLIPYFRKNGVHGLARSMPTSGAVDLVAKAQALACYEVPTGWKFFCALFDARKLSICGEESFGTGSDHI
REKDGLWAIVAWLNIIAALGVRKPDVAPSIRQIQRDFWAQYGRTFFTRYDYENVDSDGANKVVAELQRLVADPAF
VGSKIGERTVTKAGNFSYEDLDGSVASNQGLYACFSSGSRIVVRLSGTGSSGATIRLYVEQHSADPATYDMDAQQ
FLRAEVAFATDLLKFKQHVGRDEPDVRT*
Coding >Hirsu2|7406
ATGGACGTCAAGACGGTCGAGTTCAAGCCCTTCCAGGACCAGAAGCCCGGCACGTCCGGCCTGCGCAAAAAGGTC
ACCGTCTTCCAGCAGCCGCACTACAGCGAGTCGTTCGTCGCCAGCATCCTGCTCTCCATCCCGGAAGGCGTCAAG
GGCTCCTTTCTCGTCATCGGCGGCGATGGCCGCTTCTGGAACCCCGAGGTCATCCAGCTCATTGCCAAGATCGGC
GCCGCCTATGGCGTCAAGAAGCTCCTGATCGGCCAGAACGGCATTCTGTCCACGCCGGCCGCCAGCCATGTCATC
CGCCTGCGAAAGGCCACCGGCGGCATCCTGCTGACCGCCAGCCACAACCCGGGCGGCCCCAGCAACGACTTCGGC
ATCAAGTACAACCTTGCCAACGGCGGCCCGGCCCCCGAGTCCGTCACCAACAAGATCTACGACGCCTCCAAGAGC
CTGACGTCGTACAAGCTCGCCTCCATCCCCGACGTCGACATCGCCAGCCTCGGCTCCCGCACCTACGGCTCGCTC
GAGGTCGAGGTCATCGACAGCACCGCCGACTACGTCGCCATGCTCAAGGACATCTTCGACTTCGACACCATCCGC
GCCTTCTTCTCCGCCCACCCCGACTTCAAGATGCTCTTCGACGGCCTGCACGGCGTCACCGGCCCCTACGGCAAG
GCCATCTTCGAGACGGAGCTCGGCCTGGCCGGCTCGACCCAGAACTGCGAGCCCAGCCCCGACTTCAACGGCGGC
CACCCGGACCCCAACCTGACGTATGCCCGCTCGCTCGTCGACGCCGTCGACAAGGCCGCCATCCCCTTCGGCGCC
GCCTCGGACGGCGACGGCGACCGCAACATGATCTACGGCGCCAACGCCTTCGTCTCGCCCGGCGACTCGCTCGCC
ATCATCGCCCACCACGCCCAGCTGATACCCTACTTCCGCAAGAACGGCGTCCACGGCCTGGCCCGCTCCATGCCC
ACCTCGGGCGCCGTCGACCTCGTCGCCAAGGCCCAGGCCCTCGCCTGCTACGAGGTCCCGACCGGCTGGAAGTTC
TTCTGCGCCCTCTTCGACGCCCGCAAGCTGTCCATCTGCGGCGAGGAGAGCTTCGGCACCGGCAGCGACCACATC
CGCGAGAAGGACGGCCTGTGGGCCATCGTCGCCTGGCTCAACATCATCGCCGCCCTCGGCGTCCGCAAGCCCGAC
GTGGCCCCCTCCATCCGCCAGATCCAGCGCGACTTCTGGGCCCAGTACGGCCGCACCTTCTTCACCCGCTACGAC
TACGAGAACGTCGACTCGGACGGCGCCAACAAGGTCGTCGCCGAGCTGCAGCGCCTCGTCGCCGACCCGGCCTTT
GTCGGCAGCAAGATTGGCGAACGCACCGTGACCAAGGCCGGCAACTTCTCGTACGAGGACCTGGACGGCTCCGTC
GCCTCCAACCAGGGCCTGTACGCCTGCTTCTCGTCGGGCAGCCGCATCGTCGTCCGCCTCTCCGGCACCGGCTCC
TCGGGCGCCACCATCCGCCTCTACGTCGAGCAGCACAGCGCCGACCCGGCCACGTACGACATGGACGCCCAGCAG
TTCCTGCGCGCCGAGGTCGCCTTCGCCACCGACCTGCTCAAGTTCAAGCAGCACGTCGGCCGCGACGAGCCCGAC
GTCCGGACCTGA
Transcript >Hirsu2|7406
ATGGACGTCAAGACGGTCGAGTTCAAGCCCTTCCAGGACCAGAAGCCCGGCACGTCCGGCCTGCGCAAAAAGGTC
ACCGTCTTCCAGCAGCCGCACTACAGCGAGTCGTTCGTCGCCAGCATCCTGCTCTCCATCCCGGAAGGCGTCAAG
GGCTCCTTTCTCGTCATCGGCGGCGATGGCCGCTTCTGGAACCCCGAGGTCATCCAGCTCATTGCCAAGATCGGC
GCCGCCTATGGCGTCAAGAAGCTCCTGATCGGCCAGAACGGCATTCTGTCCACGCCGGCCGCCAGCCATGTCATC
CGCCTGCGAAAGGCCACCGGCGGCATCCTGCTGACCGCCAGCCACAACCCGGGCGGCCCCAGCAACGACTTCGGC
ATCAAGTACAACCTTGCCAACGGCGGCCCGGCCCCCGAGTCCGTCACCAACAAGATCTACGACGCCTCCAAGAGC
CTGACGTCGTACAAGCTCGCCTCCATCCCCGACGTCGACATCGCCAGCCTCGGCTCCCGCACCTACGGCTCGCTC
GAGGTCGAGGTCATCGACAGCACCGCCGACTACGTCGCCATGCTCAAGGACATCTTCGACTTCGACACCATCCGC
GCCTTCTTCTCCGCCCACCCCGACTTCAAGATGCTCTTCGACGGCCTGCACGGCGTCACCGGCCCCTACGGCAAG
GCCATCTTCGAGACGGAGCTCGGCCTGGCCGGCTCGACCCAGAACTGCGAGCCCAGCCCCGACTTCAACGGCGGC
CACCCGGACCCCAACCTGACGTATGCCCGCTCGCTCGTCGACGCCGTCGACAAGGCCGCCATCCCCTTCGGCGCC
GCCTCGGACGGCGACGGCGACCGCAACATGATCTACGGCGCCAACGCCTTCGTCTCGCCCGGCGACTCGCTCGCC
ATCATCGCCCACCACGCCCAGCTGATACCCTACTTCCGCAAGAACGGCGTCCACGGCCTGGCCCGCTCCATGCCC
ACCTCGGGCGCCGTCGACCTCGTCGCCAAGGCCCAGGCCCTCGCCTGCTACGAGGTCCCGACCGGCTGGAAGTTC
TTCTGCGCCCTCTTCGACGCCCGCAAGCTGTCCATCTGCGGCGAGGAGAGCTTCGGCACCGGCAGCGACCACATC
CGCGAGAAGGACGGCCTGTGGGCCATCGTCGCCTGGCTCAACATCATCGCCGCCCTCGGCGTCCGCAAGCCCGAC
GTGGCCCCCTCCATCCGCCAGATCCAGCGCGACTTCTGGGCCCAGTACGGCCGCACCTTCTTCACCCGCTACGAC
TACGAGAACGTCGACTCGGACGGCGCCAACAAGGTCGTCGCCGAGCTGCAGCGCCTCGTCGCCGACCCGGCCTTT
GTCGGCAGCAAGATTGGCGAACGCACCGTGACCAAGGCCGGCAACTTCTCGTACGAGGACCTGGACGGCTCCGTC
GCCTCCAACCAGGGCCTGTACGCCTGCTTCTCGTCGGGCAGCCGCATCGTCGTCCGCCTCTCCGGCACCGGCTCC
TCGGGCGCCACCATCCGCCTCTACGTCGAGCAGCACAGCGCCGACCCGGCCACGTACGACATGGACGCCCAGCAG
TTCCTGCGCGCCGAGGTCGCCTTCGCCACCGACCTGCTCAAGTTCAAGCAGCACGTCGGCCGCGACGAGCCCGAC
GTCCGGACCTGA
Gene >Hirsu2|7406
ATGGACGTCAAGACGGTCGAGTTCAAGCCCTTCCAGGACCAGAAGCCCGGCACGTACGTCTGAAGCCCGTGCCTC
GCCTCCCCCGTCTCCCGTCGTCCGTCTTCTCATCCGCATCGTCTCCTCCAGGTCCGGCCTGCGCAAAAAGGTCAC
CGTCTTCCAGCAGCCGCACTACAGCGAGTCGTTCGTCGCCAGCATCCTGCTCTCCATCCCGGAAGGCGTCAAGGG
TACGTACGGGCCGCCTCGGGCCTCCCGTCTCCCCGTCTTCCTCTCCAATTCCATCTGACCGCGCCAGGCTCCTTT
CTCGTCATCGGCGGCGATGGCCGCTTCTGGAACCCCGAGGTCATCCAGCTCATTGCCAAGATCGGCGCCGCCTAT
GGCGTCAAGAAGCTCCTGATCGGCCAGAACGGCATTCTGTCCACGCCGGCCGCCAGCCATGTCATCCGCCTGCGA
AAGGCCACCGGCGGCATCCTGCTGACCGCCAGCCACAACCCGGGCGGTAAGGCTCGAACCCTCCCGTCCGAGCCC
GCCGACTGACGCGGAGCCAGGCCCCAGCAACGACTTCGGCATCAAGTACAACCTTGCCAACGGCGGCCCGGCCCC
CGAGTCCGTCACCAACAAGATCTACGACGCCTCCAAGAGCCTGACGTCGTACAAGCTCGCCTCCATCCCCGACGT
CGACATCGCCAGCCTCGGCTCCCGCACCTACGGCTCGCTCGAGGTCGAGGTCATCGACAGCACCGCCGACTACGT
CGCCATGCTCAAGGACATCTTCGACTTCGACACCATCCGCGCCTTCTTCTCCGCCCACCCCGACTTCAAGATGCT
CTTCGACGGCCTGCACGGCGTCACCGGCCCCTACGGCAAGGCCATCTTCGAGACGGAGCTCGGCCTGGCCGGCTC
GACCCAGAACTGCGAGCCCAGCCCCGACTTCAACGGCGGCCACCCGGACCCCAACCTGACGTATGCCCGCTCGCT
CGTCGACGCCGTCGACAAGGCCGCCATCCCCTTCGGCGCCGCCTCGGACGGCGACGGCGACCGCAACATGATCTA
CGGCGCCAACGCCTTCGTCTCGCCCGGCGACTCGCTCGCCATCATCGCCCACCACGCCCAGCTGATACCCTACTT
CCGCAAGAACGGCGTCCACGGCCTGGCCCGCTCCATGCCCACCTCGGGCGCCGTCGACCTCGTCGCCAAGGCCCA
GGCCCTCGCCTGCTACGAGGTCCCGACCGGCTGGAAGTTCTTCTGCGCCCTCTTCGACGCCCGCAAGCTGTCCAT
CTGCGGCGAGGAGAGCTTCGGCACCGGCAGCGACCACATCCGCGAGAAGGACGGCCTGTGGGCCATCGTCGCCTG
GCTCAACATCATCGCCGCCCTCGGCGTCCGCAAGCCCGACGTGGCCCCCTCCATCCGCCAGATCCAGCGCGACTT
CTGGGCCCAGTACGGCCGCACCTTCTTCACCCGCTACGACTACGAGAACGTCGACTCGGACGGCGCCAACAAGGT
CGTCGCCGAGCTGCAGCGCCTCGTCGCCGACCCGGCCTTTGTCGGCAGCAAGATTGGCGGTGAGTTGAACTGCCC
CCCCCCCTGGAAAAGAAGATGACGAAGTGATTTGTTGCTGACGGTAGGGGGTAAAAAAATACAGAACGCACCGTG
ACCAAGGCCGGCAACTTCTCGTACGAGGACCTGGACGGCTCCGTCGCCTCCAACCAGGGCCTGTACGCCTGCTTC
TCGTCGGGCAGCCGCATCGTCGTCCGCCTCTCCGGCACCGGCTCCTCGGGCGCCACCATCCGCCTCTACGTCGAG
CAGCACAGCGCCGACCCGGCCACGTACGACATGGACGCCCAGCAGTTCCTGCGCGCCGAGGTCGCCTTCGCCACC
GACCTGCTCAAGTTCAAGCAGCACGTCGGCCGCGACGAGCCCGACGTCCGGACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail