Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7404
Gene name
LocationContig_43:14077..14506
Strand+
Gene length (bp)429
Transcript length (bp)300
Coding sequence length (bp)300
Protein length (aa) 100

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 2.8E-25 24 92
PF09011 HMG_box_2 HMG-box domain 1.4E-17 21 92

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S045|NHP6_NEUCR Non-histone chromosomal protein 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nhp-1 PE=3 SV=1 1 97 8.0E-55
sp|Q4IQX3|NHP6_GIBZE Non-histone chromosomal protein 6 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NHP6 PE=3 SV=1 15 97 7.0E-49
sp|Q4WY33|NHP6_ASPFU Non-histone chromosomal protein 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nhp6 PE=3 SV=1 1 97 2.0E-43
sp|Q5B995|NHP6_EMENI Non-histone chromosomal protein 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nhp6 PE=3 SV=1 1 93 2.0E-41
sp|Q6CVH3|NHP6_KLULA Non-histone chromosomal protein 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NHP6 PE=3 SV=1 15 93 4.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S045|NHP6_NEUCR Non-histone chromosomal protein 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nhp-1 PE=3 SV=1 1 97 8.0E-55
sp|Q4IQX3|NHP6_GIBZE Non-histone chromosomal protein 6 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NHP6 PE=3 SV=1 15 97 7.0E-49
sp|Q4WY33|NHP6_ASPFU Non-histone chromosomal protein 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nhp6 PE=3 SV=1 1 97 2.0E-43
sp|Q5B995|NHP6_EMENI Non-histone chromosomal protein 6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nhp6 PE=3 SV=1 1 93 2.0E-41
sp|Q6CVH3|NHP6_KLULA Non-histone chromosomal protein 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NHP6 PE=3 SV=1 15 93 4.0E-37
sp|P11633|NHP6B_YEAST Non-histone chromosomal protein 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP6B PE=1 SV=3 1 93 2.0E-36
sp|Q75B82|NHP6_ASHGO Non-histone chromosomal protein 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NHP6 PE=3 SV=1 20 93 2.0E-35
sp|Q6CC79|NHP6_YARLI Non-histone chromosomal protein 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NHP6 PE=3 SV=1 1 93 2.0E-33
sp|P11632|NHP6A_YEAST Non-histone chromosomal protein 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP6A PE=1 SV=1 20 93 4.0E-33
sp|Q9UVL1|NHP6_CANAL Non-histone chromosomal protein 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NHP6 PE=3 SV=1 20 91 5.0E-32
sp|Q6BRB4|NHP6_DEBHA Non-histone chromosomal protein 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NHP6 PE=3 SV=1 20 91 1.0E-30
sp|P87057|NHP6_SCHPO Non-histone chromosomal protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nhp6 PE=3 SV=1 1 93 8.0E-26
sp|P0CO24|NHP6_CRYNJ Non-histone chromosomal protein 6 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NHP6 PE=3 SV=1 1 91 4.0E-25
sp|P0CO25|NHP6_CRYNB Non-histone chromosomal protein 6 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NHP6 PE=3 SV=1 1 91 4.0E-25
sp|O04235|SSRP1_VICFA FACT complex subunit SSRP1 OS=Vicia faba GN=SSRP1 PE=2 SV=1 20 91 6.0E-24
sp|P40632|NHP1_BABBO High mobility group protein homolog NHP1 OS=Babesia bovis PE=1 SV=1 5 91 4.0E-20
sp|Q4PBZ9|NHP6_USTMA Non-histone chromosomal protein 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NHP6 PE=3 SV=2 16 92 4.0E-18
sp|Q05153|SSRP1_ARATH FACT complex subunit SSRP1 OS=Arabidopsis thaliana GN=SSRP1 PE=1 SV=2 26 91 4.0E-18
sp|O15347|HMGB3_HUMAN High mobility group protein B3 OS=Homo sapiens GN=HMGB3 PE=1 SV=4 20 95 8.0E-17
sp|Q24537|HMG2_DROME High mobility group protein DSP1 OS=Drosophila melanogaster GN=Dsp1 PE=2 SV=1 2 95 3.0E-16
sp|O54879|HMGB3_MOUSE High mobility group protein B3 OS=Mus musculus GN=Hmgb3 PE=1 SV=3 20 95 3.0E-16
sp|Q09390|HMG12_CAEEL High mobility group protein 1.2 OS=Caenorhabditis elegans GN=hmg-1.2 PE=1 SV=2 4 94 3.0E-16
sp|Q39601|SSRP1_CATRO FACT complex subunit SSRP1 OS=Catharanthus roseus GN=SSRP1 PE=2 SV=1 20 91 8.0E-16
sp|P07746|HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss PE=2 SV=2 19 95 1.0E-15
sp|P40618|HMGB3_CHICK High mobility group protein B3 OS=Gallus gallus GN=HMGB3 PE=2 SV=3 20 95 1.0E-15
sp|Q32L31|HMGB3_BOVIN High mobility group protein B3 OS=Bos taurus GN=HMGB3 PE=2 SV=2 20 95 1.0E-15
sp|Q55C24|NHP6_DICDI Non-histone chromosomal protein 6 homolog OS=Dictyostelium discoideum GN=nhp6 PE=3 SV=1 20 92 3.0E-15
sp|P52925|HMGB2_RAT High mobility group protein B2 OS=Rattus norvegicus GN=Hmgb2 PE=2 SV=2 22 95 8.0E-15
sp|P26583|HMGB2_HUMAN High mobility group protein B2 OS=Homo sapiens GN=HMGB2 PE=1 SV=2 22 95 9.0E-15
sp|P40673|HMGB2_BOVIN High mobility group protein B2 OS=Bos taurus GN=HMGB2 PE=1 SV=3 22 95 9.0E-15
sp|P26584|HMGB2_CHICK High mobility group protein B2 OS=Gallus gallus GN=HMGB2 PE=2 SV=2 20 93 1.0E-14
sp|O49596|HMGB2_ARATH High mobility group B protein 2 OS=Arabidopsis thaliana GN=HMGB2 PE=1 SV=1 16 92 2.0E-14
sp|O49595|HMGB1_ARATH High mobility group B protein 1 OS=Arabidopsis thaliana GN=HMGB1 PE=1 SV=1 2 99 2.0E-14
sp|P30681|HMGB2_MOUSE High mobility group protein B2 OS=Mus musculus GN=Hmgb2 PE=1 SV=3 22 95 4.0E-14
sp|P17741|HMGB2_PIG High mobility group protein B2 OS=Sus scrofa GN=HMGB2 PE=1 SV=2 22 91 1.0E-13
sp|Q196Z2|VF401_IIV3 High mobility group protein homolog 068R OS=Invertebrate iridescent virus 3 GN=IIV3-068R PE=3 SV=1 16 89 1.0E-13
sp|P63159|HMGB1_RAT High mobility group protein B1 OS=Rattus norvegicus GN=Hmgb1 PE=1 SV=2 19 95 4.0E-13
sp|A9RA84|HMGB1_PAPAN High mobility group protein B1 OS=Papio anubis GN=HMGB1 PE=3 SV=1 19 95 4.0E-13
sp|P63158|HMGB1_MOUSE High mobility group protein B1 OS=Mus musculus GN=Hmgb1 PE=1 SV=2 19 95 4.0E-13
sp|Q4R844|HMGB1_MACFA High mobility group protein B1 OS=Macaca fascicularis GN=HMGB1 PE=2 SV=3 19 95 4.0E-13
sp|P09429|HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens GN=HMGB1 PE=1 SV=3 19 95 4.0E-13
sp|Q08IE6|HMGB1_HORSE High mobility group protein B1 OS=Equus caballus GN=HMGB1 PE=2 SV=3 19 95 4.0E-13
sp|Q6YKA4|HMGB1_CANLF High mobility group protein B1 OS=Canis lupus familiaris GN=HMGB1 PE=2 SV=3 19 95 4.0E-13
sp|B1MTB0|HMGB1_CALMO High mobility group protein B1 OS=Callicebus moloch GN=HMGB1 PE=3 SV=1 19 95 4.0E-13
sp|B0CM99|HMGB1_CALJA High mobility group protein B1 OS=Callithrix jacchus GN=HMGB1 PE=3 SV=1 19 95 4.0E-13
sp|P10103|HMGB1_BOVIN High mobility group protein B1 OS=Bos taurus GN=HMGB1 PE=1 SV=3 19 95 4.0E-13
sp|P93047|HMGB3_ARATH High mobility group B protein 3 OS=Arabidopsis thaliana GN=HMGB3 PE=1 SV=1 19 92 4.0E-13
sp|P07156|HMGB1_CRIGR High mobility group protein B1 (Fragment) OS=Cricetulus griseus GN=HMGB1 PE=1 SV=1 19 95 4.0E-13
sp|Q04678|SSRP1_CHICK FACT complex subunit SSRP1 OS=Gallus gallus GN=SSRP1 PE=2 SV=2 9 93 5.0E-13
sp|P12682|HMGB1_PIG High mobility group protein B1 OS=Sus scrofa GN=HMGB1 PE=2 SV=3 19 95 5.0E-13
sp|Q9YH06|HMGB1_CHICK High mobility group protein B1 OS=Gallus gallus GN=HMGB1 PE=1 SV=1 19 95 6.0E-13
sp|Q42344|HMGB4_ARATH High mobility group B protein 4 OS=Arabidopsis thaliana GN=HMGB4 PE=1 SV=1 9 92 6.0E-13
sp|P27347|MNB1B_MAIZE DNA-binding protein MNB1B OS=Zea mays GN=MNB1B PE=1 SV=1 15 92 2.0E-12
sp|P40621|HMGL_WHEAT HMG1/2-like protein OS=Triticum aestivum PE=2 SV=1 20 92 2.0E-12
sp|Q6DIJ5|HM20A_XENTR High mobility group protein 20A OS=Xenopus tropicalis GN=hmg20a PE=2 SV=1 1 91 5.0E-12
sp|P40620|HMGL_VICFA HMG1/2-like protein OS=Vicia faba PE=2 SV=1 19 97 6.0E-12
sp|P40644|HMGH_STRPU High mobility group protein 1 homolog OS=Strongylocentrotus purpuratus GN=HMG1 PE=2 SV=1 20 95 8.0E-12
sp|Q9SUP7|HMGB6_ARATH High mobility group B protein 6 OS=Arabidopsis thaliana GN=HMGB6 PE=2 SV=1 20 84 1.0E-11
sp|P26585|HMGL_SOYBN HMG1/2-like protein OS=Glycine max PE=2 SV=1 2 92 2.0E-11
sp|Q08943|SSRP1_MOUSE FACT complex subunit SSRP1 OS=Mus musculus GN=Ssrp1 PE=1 SV=2 19 99 2.0E-11
sp|Q9W602|SSRP1_XENLA FACT complex subunit SSRP1 OS=Xenopus laevis GN=ssrp1 PE=1 SV=1 19 93 3.0E-11
sp|Q05783|HMGD_DROME High mobility group protein D OS=Drosophila melanogaster GN=HmgD PE=1 SV=1 24 85 3.0E-11
sp|Q08945|SSRP1_HUMAN FACT complex subunit SSRP1 OS=Homo sapiens GN=SSRP1 PE=1 SV=1 9 91 3.0E-11
sp|Q293F6|SSRP1_DROPS FACT complex subunit Ssrp1 OS=Drosophila pseudoobscura pseudoobscura GN=Ssrp PE=3 SV=2 24 93 4.0E-11
sp|B2RPK0|HGB1A_HUMAN Putative high mobility group protein B1-like 1 OS=Homo sapiens GN=HMGB1P1 PE=5 SV=1 19 95 4.0E-11
sp|Q04931|SSRP1_RAT FACT complex subunit SSRP1 OS=Rattus norvegicus GN=Ssrp1 PE=1 SV=2 20 99 8.0E-11
sp|P11873|HMGC_TETTH High mobility group protein C OS=Tetrahymena thermophila PE=1 SV=1 21 91 1.0E-10
sp|P40622|HMG1A_CHITE Mobility group protein 1A OS=Chironomus tentans GN=HMG1A PE=3 SV=1 24 99 1.0E-10
sp|P40619|HMGL_IPONI HMG1/2-like protein OS=Ipomoea nil PE=2 SV=1 3 92 1.0E-10
sp|P26583|HMGB2_HUMAN High mobility group protein B2 OS=Homo sapiens GN=HMGB2 PE=1 SV=2 17 91 2.0E-10
sp|P40673|HMGB2_BOVIN High mobility group protein B2 OS=Bos taurus GN=HMGB2 PE=1 SV=3 17 91 2.0E-10
sp|P17741|HMGB2_PIG High mobility group protein B2 OS=Sus scrofa GN=HMGB2 PE=1 SV=2 17 91 2.0E-10
sp|Q6DJL0|TOX4A_XENLA TOX high mobility group box family member 4-A OS=Xenopus laevis GN=tox4-a PE=2 SV=1 20 93 2.0E-10
sp|A4QNP0|TOX4_XENTR TOX high mobility group box family member 4 OS=Xenopus tropicalis GN=tox4 PE=2 SV=1 20 93 2.0E-10
sp|Q05344|SSRP1_DROME FACT complex subunit Ssrp1 OS=Drosophila melanogaster GN=Ssrp PE=1 SV=2 26 98 2.0E-10
sp|Q6IRR0|TOX4B_XENLA TOX high mobility group box family member 4-B OS=Xenopus laevis GN=tox4-b PE=2 SV=1 20 93 2.0E-10
sp|Q6AZF8|HM20A_XENLA High mobility group protein 20A OS=Xenopus laevis GN=hmg20a PE=2 SV=1 1 91 2.0E-10
sp|P52925|HMGB2_RAT High mobility group protein B2 OS=Rattus norvegicus GN=Hmgb2 PE=2 SV=2 17 91 3.0E-10
sp|P30681|HMGB2_MOUSE High mobility group protein B2 OS=Mus musculus GN=Hmgb2 PE=1 SV=3 17 91 3.0E-10
sp|P63159|HMGB1_RAT High mobility group protein B1 OS=Rattus norvegicus GN=Hmgb1 PE=1 SV=2 17 91 3.0E-10
sp|A9RA84|HMGB1_PAPAN High mobility group protein B1 OS=Papio anubis GN=HMGB1 PE=3 SV=1 17 91 3.0E-10
sp|P63158|HMGB1_MOUSE High mobility group protein B1 OS=Mus musculus GN=Hmgb1 PE=1 SV=2 17 91 3.0E-10
sp|Q4R844|HMGB1_MACFA High mobility group protein B1 OS=Macaca fascicularis GN=HMGB1 PE=2 SV=3 17 91 3.0E-10
sp|P09429|HMGB1_HUMAN High mobility group protein B1 OS=Homo sapiens GN=HMGB1 PE=1 SV=3 17 91 3.0E-10
sp|Q08IE6|HMGB1_HORSE High mobility group protein B1 OS=Equus caballus GN=HMGB1 PE=2 SV=3 17 91 3.0E-10
sp|Q6YKA4|HMGB1_CANLF High mobility group protein B1 OS=Canis lupus familiaris GN=HMGB1 PE=2 SV=3 17 91 3.0E-10
sp|B1MTB0|HMGB1_CALMO High mobility group protein B1 OS=Callicebus moloch GN=HMGB1 PE=3 SV=1 17 91 3.0E-10
sp|B0CM99|HMGB1_CALJA High mobility group protein B1 OS=Callithrix jacchus GN=HMGB1 PE=3 SV=1 17 91 3.0E-10
sp|P10103|HMGB1_BOVIN High mobility group protein B1 OS=Bos taurus GN=HMGB1 PE=1 SV=3 17 91 3.0E-10
sp|P12682|HMGB1_PIG High mobility group protein B1 OS=Sus scrofa GN=HMGB1 PE=2 SV=3 17 91 3.0E-10
sp|Q9YH06|HMGB1_CHICK High mobility group protein B1 OS=Gallus gallus GN=HMGB1 PE=1 SV=1 17 91 3.0E-10
sp|Q32L34|HMGB4_BOVIN High mobility group protein B4 OS=Bos taurus GN=HMGB4 PE=2 SV=1 20 91 3.0E-10
sp|Q8BU11|TOX4_MOUSE TOX high mobility group box family member 4 OS=Mus musculus GN=Tox4 PE=1 SV=3 20 91 3.0E-10
sp|Q0P5K4|TOX4_BOVIN TOX high mobility group box family member 4 OS=Bos taurus GN=TOX4 PE=2 SV=1 20 91 4.0E-10
sp|Q5R6A9|TOX4_PONAB TOX high mobility group box family member 4 OS=Pongo abelii GN=TOX4 PE=2 SV=2 20 91 4.0E-10
sp|Q99PM1|TOX4_RAT TOX high mobility group box family member 4 OS=Rattus norvegicus GN=Tox4 PE=1 SV=1 20 91 4.0E-10
sp|O94842|TOX4_HUMAN TOX high mobility group box family member 4 OS=Homo sapiens GN=TOX4 PE=1 SV=1 20 91 4.0E-10
sp|O49597|HMGB5_ARATH High mobility group B protein 5 OS=Arabidopsis thaliana GN=HMGB5 PE=2 SV=1 9 94 4.0E-10
sp|P40623|HMG1B_CHITE Mobility group protein 1B OS=Chironomus tentans GN=HMG1B PE=3 SV=1 24 91 4.0E-10
sp|B7SBD2|TOX3_RAT TOX high mobility group box family member 3 OS=Rattus norvegicus GN=Tox3 PE=1 SV=1 20 93 5.0E-10
sp|Q80W03|TOX3_MOUSE TOX high mobility group box family member 3 OS=Mus musculus GN=Tox3 PE=2 SV=1 20 93 5.0E-10
sp|O15405|TOX3_HUMAN TOX high mobility group box family member 3 OS=Homo sapiens GN=TOX3 PE=1 SV=2 20 93 5.0E-10
sp|Q9P0W2|HM20B_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Homo sapiens GN=HMG20B PE=1 SV=1 14 92 7.0E-10
sp|Q06943|HMGZ_DROME High mobility group protein Z OS=Drosophila melanogaster GN=HmgZ PE=1 SV=1 24 99 1.0E-09
sp|Q6P8W9|HMGB4_MOUSE High mobility group protein B4 OS=Mus musculus GN=Hmgb4 PE=2 SV=1 20 91 1.0E-09
sp|Q32L68|HM20B_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Bos taurus GN=HMG20B PE=2 SV=1 14 92 1.0E-09
sp|Q9SUP7|HMGB6_ARATH High mobility group B protein 6 OS=Arabidopsis thaliana GN=HMGB6 PE=2 SV=1 20 92 2.0E-09
sp|Q9Z104|HM20B_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Mus musculus GN=Hmg20b PE=1 SV=1 14 92 2.0E-09
sp|Q9DC33|HM20A_MOUSE High mobility group protein 20A OS=Mus musculus GN=Hmg20a PE=1 SV=1 19 91 2.0E-09
sp|Q9NP66|HM20A_HUMAN High mobility group protein 20A OS=Homo sapiens GN=HMG20A PE=1 SV=1 19 91 2.0E-09
sp|P26584|HMGB2_CHICK High mobility group protein B2 OS=Gallus gallus GN=HMGB2 PE=2 SV=2 17 91 3.0E-09
sp|P40625|HMG_TETPY High mobility group protein OS=Tetrahymena pyriformis GN=HMG PE=1 SV=1 21 91 3.0E-09
sp|P40628|HMGH_IIV6 High mobility group protein homolog OS=Invertebrate iridescent virus 6 GN=EF1 PE=3 SV=2 22 90 3.0E-09
sp|Q4H2R2|SSRP1_CIOIN FACT complex subunit SSRP1 OS=Ciona intestinalis GN=SSRP1 PE=2 SV=1 15 95 3.0E-09
sp|Q65WY8|SSP1B_ORYSJ FACT complex subunit SSRP1-B OS=Oryza sativa subsp. japonica GN=SSRP1-B PE=2 SV=1 24 91 3.0E-09
sp|P26586|HMGL_TRYBR High mobility group protein homolog TDP-1 OS=Trypanosoma brucei rhodesiense PE=2 SV=1 5 95 4.0E-09
sp|Q5ZKF4|HM20A_CHICK High mobility group protein 20A OS=Gallus gallus GN=HMG20A PE=2 SV=1 19 91 4.0E-09
sp|P07746|HMGT_ONCMY High mobility group-T protein OS=Oncorhynchus mykiss PE=2 SV=2 19 91 5.0E-09
sp|Q76IQ7|TOX2_RAT TOX high mobility group box family member 2 OS=Rattus norvegicus GN=Tox2 PE=2 SV=1 20 93 5.0E-09
sp|Q8WW32|HMGB4_HUMAN High mobility group protein B4 OS=Homo sapiens GN=HMGB4 PE=1 SV=2 20 96 5.0E-09
sp|Q9T012|HMG13_ARATH High mobility group B protein 13 OS=Arabidopsis thaliana GN=HMGB13 PE=2 SV=1 8 92 5.0E-09
sp|Q9T012|HMG13_ARATH High mobility group B protein 13 OS=Arabidopsis thaliana GN=HMGB13 PE=2 SV=1 20 91 5.0E-09
sp|P26586|HMGL_TRYBR High mobility group protein homolog TDP-1 OS=Trypanosoma brucei rhodesiense PE=2 SV=1 10 90 1.0E-08
sp|Q9LGR0|SSP1A_ORYSJ FACT complex subunit SSRP1-A OS=Oryza sativa subsp. japonica GN=SSRP1-A PE=2 SV=1 26 91 1.0E-08
sp|Q03435|NHP10_YEAST Non-histone protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP10 PE=1 SV=1 19 92 2.0E-08
sp|O01683|SSP1B_CAEEL FACT complex subunit ssrp1-B OS=Caenorhabditis elegans GN=hmg-3 PE=3 SV=1 20 95 3.0E-08
sp|Q9USU7|YHHB_SCHPO HMG box-containing protein C28F2.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC28F2.11 PE=1 SV=1 15 99 5.0E-08
sp|P40618|HMGB3_CHICK High mobility group protein B3 OS=Gallus gallus GN=HMGB3 PE=2 SV=3 28 91 9.0E-08
sp|Q32L34|HMGB4_BOVIN High mobility group protein B4 OS=Bos taurus GN=HMGB4 PE=2 SV=1 17 91 9.0E-08
sp|Q66JW3|TOX_MOUSE Thymocyte selection-associated high mobility group box protein TOX OS=Mus musculus GN=Tox PE=1 SV=2 20 93 1.0E-07
sp|Q9LEF5|SSRP1_MAIZE FACT complex subunit SSRP1 OS=Zea mays GN=SSRP1 PE=1 SV=1 10 94 1.0E-07
sp|O94900|TOX_HUMAN Thymocyte selection-associated high mobility group box protein TOX OS=Homo sapiens GN=TOX PE=2 SV=3 20 93 1.0E-07
sp|O54879|HMGB3_MOUSE High mobility group protein B3 OS=Mus musculus GN=Hmgb3 PE=1 SV=3 28 91 2.0E-07
sp|B2RPK0|HGB1A_HUMAN Putative high mobility group protein B1-like 1 OS=Homo sapiens GN=HMGB1P1 PE=5 SV=1 17 91 2.0E-07
sp|Q9MAT6|HMG15_ARATH High mobility group B protein 15 OS=Arabidopsis thaliana GN=HMGB15 PE=2 SV=1 20 91 2.0E-07
sp|Q59PR9|HMO1_CANAL Transcriptional regulator HMO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HMO1 PE=2 SV=1 14 94 2.0E-07
sp|O15347|HMGB3_HUMAN High mobility group protein B3 OS=Homo sapiens GN=HMGB3 PE=1 SV=4 28 91 3.0E-07
sp|Q32L31|HMGB3_BOVIN High mobility group protein B3 OS=Bos taurus GN=HMGB3 PE=2 SV=2 28 91 3.0E-07
sp|Q9SUP7|HMGB6_ARATH High mobility group B protein 6 OS=Arabidopsis thaliana GN=HMGB6 PE=2 SV=1 25 91 4.0E-07
sp|Q6P8W9|HMGB4_MOUSE High mobility group protein B4 OS=Mus musculus GN=Hmgb4 PE=2 SV=1 17 91 4.0E-07
sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 1 90 4.0E-07
sp|B3DM43|SOX5_XENTR Transcription factor Sox-5 OS=Xenopus tropicalis GN=sox5 PE=2 SV=1 11 85 1.0E-06
sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 1 74 1.0E-06
sp|Q8WW32|HMGB4_HUMAN High mobility group protein B4 OS=Homo sapiens GN=HMGB4 PE=1 SV=2 17 91 2.0E-06
sp|P35710|SOX5_MOUSE Transcription factor SOX-5 OS=Mus musculus GN=Sox5 PE=1 SV=2 11 85 2.0E-06
sp|P35711|SOX5_HUMAN Transcription factor SOX-5 OS=Homo sapiens GN=SOX5 PE=1 SV=3 11 85 2.0E-06
sp|Q96NM4|TOX2_HUMAN TOX high mobility group box family member 2 OS=Homo sapiens GN=TOX2 PE=2 SV=2 2 70 2.0E-06
sp|P40647|SOX5_XENLA Transcription factor Sox-5 OS=Xenopus laevis GN=sox5 PE=2 SV=2 11 85 2.0E-06
sp|P17480|UBF1_HUMAN Nucleolar transcription factor 1 OS=Homo sapiens GN=UBTF PE=1 SV=1 24 85 2.0E-06
sp|P25976|UBF1_MOUSE Nucleolar transcription factor 1 OS=Mus musculus GN=Ubtf PE=1 SV=1 24 85 3.0E-06
sp|P25977|UBF1_RAT Nucleolar transcription factor 1 OS=Rattus norvegicus GN=Ubtf PE=1 SV=1 24 85 3.0E-06
sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 1 74 3.0E-06
sp|Q9N1Q5|SP100_HYLLA Nuclear autoantigen Sp-100 (Fragment) OS=Hylobates lar GN=SP100 PE=2 SV=1 20 69 3.0E-06
sp|Q23045|EGL13_CAEEL Transcription factor egl-13 OS=Caenorhabditis elegans GN=egl-13 PE=1 SV=2 15 91 4.0E-06
sp|Q24537|HMG2_DROME High mobility group protein DSP1 OS=Drosophila melanogaster GN=Dsp1 PE=2 SV=1 24 91 5.0E-06
sp|Q03973|HMO1_YEAST High mobility group protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMO1 PE=1 SV=1 11 91 6.0E-06
sp|P40644|HMGH_STRPU High mobility group protein 1 homolog OS=Strongylocentrotus purpuratus GN=HMG1 PE=2 SV=1 19 91 8.0E-06
sp|Q66JF1|SOX11_XENTR Transcription factor Sox-11 OS=Xenopus tropicalis GN=sox11 PE=2 SV=1 25 73 8.0E-06
sp|O64702|HMG14_ARATH High mobility group B protein 14 OS=Arabidopsis thaliana GN=HMGB14 PE=2 SV=2 24 73 8.0E-06
sp|P40650|SX11B_XENLA Transcription factor Sox-11-B OS=Xenopus laevis GN=sox11-b PE=1 SV=2 25 73 9.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4338 0.7905 0.0838 0.114 0.0964 0.0292 0.0376 0.0077 0.0216 0.0126

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3795
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5383
Ophiocordyceps australis map64 (Brazil) OphauB2|2954
Ophiocordyceps camponoti-floridani Ophcf2|00201
Ophiocordyceps camponoti-rufipedis Ophun1|6256
Ophiocordyceps kimflemingae Ophio5|6554
Ophiocordyceps subramaniannii Hirsu2|7404 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7404
MPKAAAGKRGKEVKRRGKKDPNAPKRGLSAYMFFANEQRENVREENPGISFGQVGKILGERWKALNDKQRAPYEA
KAAADKKRYEDEKQAYNAEGDDSS*
Coding >Hirsu2|7404
ATGCCCAAGGCCGCTGCCGGGAAGCGAGGGAAGGAGGTCAAGAGACGTGGCAAGAAGGACCCCAACGCGCCCAAG
CGTGGTCTGTCCGCCTACATGTTCTTCGCAAATGAGCAGCGCGAGAACGTGCGCGAGGAGAACCCCGGCATCTCA
TTTGGCCAGGTCGGCAAGATCCTGGGCGAGCGATGGAAGGCGCTCAACGACAAGCAGCGGGCCCCCTACGAGGCC
AAGGCTGCTGCCGACAAGAAGCGCTACGAGGACGAGAAGCAGGCTTACAACGCTGAGGGTGACGACTCGTCGTAG
Transcript >Hirsu2|7404
ATGCCCAAGGCCGCTGCCGGGAAGCGAGGGAAGGAGGTCAAGAGACGTGGCAAGAAGGACCCCAACGCGCCCAAG
CGTGGTCTGTCCGCCTACATGTTCTTCGCAAATGAGCAGCGCGAGAACGTGCGCGAGGAGAACCCCGGCATCTCA
TTTGGCCAGGTCGGCAAGATCCTGGGCGAGCGATGGAAGGCGCTCAACGACAAGCAGCGGGCCCCCTACGAGGCC
AAGGCTGCTGCCGACAAGAAGCGCTACGAGGACGAGAAGCAGGCTTACAACGCTGAGGGTGACGACTCGTCGTAG
Gene >Hirsu2|7404
ATGCCCAAGGCCGCTGCCGGGAAGCGAGGGAAGGAGGTCAAGAGACGTGGCAAGAAGGGTAAGTCGCCGGCCCCC
GGCGTGCGAGCAGCCCACGGGCATCTGACACGGTCCGCAGACCCCAACGCGCCCAAGCGTGGTCTGTCCGCCTAC
ATGTTCTTCGCAAATGAGCAGCGCGAGAACGTGCGCGAGGAGAACCCCGGCATCTCATTTGGCCAGGTCGGCAAG
ATCCTGGGCGAGCGATGGAAGGCGCTCAACGACAAGCAGCGGGCCCCCTACGAGGCCAAGGCTGCTGCCGACAAG
AAGCGCTACGAGGACGAGAAGCAGGCTTACAACGTAGGAACGCCACGCTTTGCTCGCCGAGAGGCTCCGTCATGA
CGCGCGACACTAATCTTGTTCTCTTTGCAGGCTGAGGGTGACGACTCGTCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail