Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7399
Gene name
LocationContig_43:450..4846
Strand-
Gene length (bp)4396
Transcript length (bp)4203
Coding sequence length (bp)4203
Protein length (aa) 1401

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10377 ATG11 Autophagy-related protein 11 6.3E-43 1096 1233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S055|ATG11_NEUCR Autophagy-related protein 11 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-8 PE=3 SV=2 1 1332 0.0E+00
sp|Q51UJ9|ATG11_MAGO7 Autophagy-related protein 11 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG11 PE=3 SV=3 1 1335 0.0E+00
sp|Q4WY31|ATG11_ASPFU Autophagy-related protein 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg11 PE=3 SV=1 45 1305 0.0E+00
sp|Q5B993|ATG11_EMENI Autophagy-related protein 11 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg11 PE=3 SV=2 45 1291 0.0E+00
sp|Q6CFR0|ATG11_YARLI Autophagy-related protein 11 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG11 PE=3 SV=1 899 1235 8.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S055|ATG11_NEUCR Autophagy-related protein 11 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-8 PE=3 SV=2 1 1332 0.0E+00
sp|Q51UJ9|ATG11_MAGO7 Autophagy-related protein 11 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG11 PE=3 SV=3 1 1335 0.0E+00
sp|Q4WY31|ATG11_ASPFU Autophagy-related protein 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg11 PE=3 SV=1 45 1305 0.0E+00
sp|Q5B993|ATG11_EMENI Autophagy-related protein 11 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg11 PE=3 SV=2 45 1291 0.0E+00
sp|Q6CFR0|ATG11_YARLI Autophagy-related protein 11 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG11 PE=3 SV=1 899 1235 8.0E-33
sp|O14261|ATG11_SCHPO Taz1-interacting factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf1 PE=1 SV=2 861 1236 5.0E-25
sp|A3GG92|ATG11_PICST Autophagy-related protein 11 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG11 PE=3 SV=2 863 1235 9.0E-21
sp|Q6BRA6|ATG11_DEBHA Autophagy-related protein 11 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG11 PE=3 SV=2 1092 1235 6.0E-18
sp|Q67C55|ATG11_PICAN Autophagy-related protein 11 OS=Pichia angusta GN=ATG11 PE=3 SV=1 1076 1236 1.0E-17
sp|A5DPN3|ATG11_PICGU Autophagy-related protein 11 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG11 PE=3 SV=2 892 1234 1.0E-16
sp|Q5AMN3|ATG11_CANAL Autophagy-related protein 11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG11 PE=3 SV=1 1092 1235 6.0E-15
sp|Q9C438|ATG11_PICPA Autophagy-related protein 11 (Fragment) OS=Komagataella pastoris GN=ATG11 PE=3 SV=1 887 1238 1.0E-14
sp|A3GG92|ATG11_PICST Autophagy-related protein 11 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG11 PE=3 SV=2 8 580 7.0E-10
sp|Q6CFR0|ATG11_YARLI Autophagy-related protein 11 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG11 PE=3 SV=1 21 739 1.0E-08
sp|Q75B79|ATG11_ASHGO Autophagy-related protein 11 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG11 PE=3 SV=1 1081 1228 3.0E-07
sp|Q6CVG9|ATG11_KLULA Autophagy-related protein 11 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG11 PE=3 SV=1 847 1153 5.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7399
MATQVLIAHTGQRLEVDAALFSTLDDLKAWVARNTSVSLQHMVALTPQGRSVKFASLHAEKEIYIYDIRVAQTSA
SSPSPSLVTETPPPRRHSIPAAPNSIDDVQAISSWQHLYEERRGWALQLADTCSRMNSAALARYDEIDAMIKCLD
AAVANLEISVKQIEPKYTELKAWVDPALSEHEKLASGWEHYLALARDVAVSPAMVKFMTRGEVDKADATLEDLVE
LETANKAGKLAPTARRRFSDKAAELDRLASQMYQGFEGLVADFEKLMGRSALGHNNDTVLLLQDIEAVASQIDAD
YHTSLDYGGSQRDLAQASKTASNHTERLVPSLKKRVKEMEEMLQYATRARNALVHDSAAHMRTITDITALHSSVK
NQINTLNQSEDDMTTFDYLRLIHQLPYMYASFVVEAIRRREWVDKVRTDSSTLANEMALFQDEEAKRRRKWQRMV
GSMYGPGFDTNVVGLEVNLLGDDVPWPSMTKDELDGFHQSVQSRGVDPEIVDDVGKLIHELSSPTKQQLKRLRAF
KNGSVHEAALGRSGLMIRGDDELIRNLQDDKSKLESKLKTADSRVRRLEDLLHRQSQASRPGSLFQSQRTQAHER
QDSAASVKSHRPDDRRRGSDGVDPLLRRIEQLEGELREEKQRCAQFEKDLAARTTQYDDMKDQIQEVNSTKKDLL
ENMEALKREFLDERKSLEDEVRTLKARLEDTEDEMENFGESRENEKAAYDEKVQSLEAEVEQLTKGLKDESLKSQ
GQVDYLRKETQVQRNRLDASERQIQATTEENRSLLAKLEAALGTIQNQARALGKLHGELAPSASAPAELAELTES
LRSHAGSVLVRLRNTESDSALVKADLGKALDSVQGLKAEVAGLKGKLADEEERAKQLRESLAGEQAKITALETEA
AEGRVHLDELRCQLSNGETGSEALRKNLQAEEEKAAALAEDLASRQSQIGSLEEEVYVHRQSAESVQAKLSALAA
RYESRDARTKDLTQRLYTQNDRLVRLLERIGYVVSREAGQMIITKIPRSERNVQNPNDSSDPGSSLRRSVSLGLG
TRAMAESVDLELLYWMDSADGATEAAKYDSFVQTLGSFEMDLFSETIYIRIKEAEHKARKWQREARAYRDRAHVL
QKDAHDKIAFKHFKEGDLALFLPTRNQQAGAWAAFNVGFPHYFLREQDAHRLRHREWLVARISRIQERVVDLSKS
LQPANDSESINDEENDNPFQLSDGLRWYLIDAHEDKPGAPATPGMGKSTVAANNVEATADIQSHAAKVRGKNRDS
VTSIEGINKSLSKSLDSRRSSSASKKALPLPGIGGTALLKNSALASETNSLRAAAPDTPAGTSPVQGGFATVGGD
QRAQAERQAGSTAGETTARGGGGKSPEREECESPSKRSVLLDSLWSVDYS*
Coding >Hirsu2|7399
ATGGCGACGCAGGTGTTGATCGCCCATACGGGCCAACGCCTCGAGGTCGACGCCGCGCTCTTCTCGACGCTCGAT
GATCTCAAAGCATGGGTCGCGCGAAATACCTCCGTCTCCCTGCAACACATGGTTGCTCTGACTCCCCAGGGGCGC
AGCGTCAAGTTTGCCAGCCTTCATGCCGAGAAGGAGATATACATCTACGACATTCGAGTCGCCCAGACGTCGGCC
TCGTCGCCCTCGCCCTCTCTCGTCACCGAAACCCCCCCGCCGAGACGCCACTCCATCCCGGCCGCGCCCAACTCC
ATCGACGACGTGCAGGCCATTTCCTCGTGGCAGCACCTGTACGAGGAGCGTCGCGGATGGGCCCTGCAGCTGGCC
GACACGTGCTCGCGCATGAACTCGGCCGCCCTGGCCCGTTACGACGAGATCGATGCCATGATCAAGTGCCTCGAC
GCGGCCGTTGCCAACCTCGAGATTAGCGTCAAGCAGATCGAGCCCAAGTACACCGAGCTCAAGGCATGGGTCGAC
CCCGCCCTGTCGGAGCACGAGAAGCTCGCGTCCGGCTGGGAGCATTACCTTGCCTTGGCCCGCGACGTGGCCGTG
TCACCCGCCATGGTCAAGTTCATGACCCGAGGCGAGGTCGACAAGGCCGACGCCACCCTCGAGGACTTGGTCGAA
CTGGAGACGGCCAACAAGGCCGGGAAGCTCGCGCCGACGGCGCGCCGCAGGTTCAGCGACAAGGCCGCCGAGCTG
GACAGGCTGGCGTCGCAAATGTACCAGGGCTTCGAGGGCCTCGTGGCCGACTTCGAGAAGCTCATGGGCCGGTCC
GCCCTGGGGCACAACAACGATACCGTGCTGCTGCTGCAGGACATTGAAGCCGTCGCCAGCCAGATCGACGCCGAC
TACCACACATCCCTCGACTACGGCGGCTCGCAGCGCGACCTCGCGCAGGCCTCCAAGACGGCCTCCAACCACACC
GAGAGACTGGTCCCCTCGCTCAAGAAGCGGGTCAAGGAAATGGAAGAGATGCTGCAGTATGCGACGCGCGCTCGC
AACGCCCTCGTCCACGACTCTGCCGCCCACATGCGGACCATCACTGACATCACGGCGCTGCACAGCAGCGTCAAG
AACCAGATCAACACCCTTAACCAGTCGGAAGACGACATGACCACGTTCGACTATCTCCGCCTCATCCACCAGCTG
CCCTACATGTACGCCTCTTTTGTCGTCGAGGCCATCCGCCGCAGGGAATGGGTCGACAAGGTTCGGACCGATTCC
TCGACACTCGCCAACGAGATGGCCCTGTTCCAGGACGAAGAGGCGAAGCGCCGCCGGAAGTGGCAGAGAATGGTG
GGCAGCATGTACGGGCCCGGCTTCGACACAAACGTCGTCGGGCTCGAGGTCAACCTGCTCGGCGACGACGTGCCA
TGGCCGTCCATGACCAAGGACGAGCTGGATGGCTTCCACCAGAGCGTCCAGAGCCGGGGCGTCGACCCGGAGATC
GTCGATGACGTCGGCAAACTGATACACGAGCTTAGCAGCCCGACGAAGCAGCAGCTGAAGAGGCTCAGGGCGTTC
AAGAACGGCAGCGTCCACGAGGCCGCCCTGGGCCGGAGCGGGCTGATGATCCGCGGCGACGACGAGCTCATCCGC
AACCTGCAGGACGACAAGTCCAAGCTCGAGAGCAAGCTCAAGACGGCAGACAGCAGGGTCCGCCGTCTGGAGGAC
CTGCTGCACAGGCAGAGCCAGGCGTCGCGTCCGGGCAGCCTGTTTCAGTCCCAGCGGACGCAAGCGCACGAAAGA
CAGGACTCCGCTGCCTCCGTGAAGTCGCATCGCCCGGATGACCGCCGGCGTGGGTCTGACGGGGTGGACCCCCTG
CTACGGCGGATCGAGCAGCTCGAGGGCGAGCTCCGGGAAGAGAAACAGCGTTGCGCCCAGTTCGAAAAGGACCTG
GCCGCGCGCACGACACAGTATGACGACATGAAGGACCAGATCCAGGAGGTCAATTCGACCAAGAAGGACCTGCTC
GAAAACATGGAGGCCCTGAAGCGCGAGTTTCTCGACGAACGAAAGTCCCTGGAGGATGAGGTCAGGACGTTGAAG
GCCCGCCTGGAGGACACCGAGGACGAGATGGAGAATTTCGGCGAGTCGCGGGAGAACGAGAAGGCCGCGTACGAC
GAAAAGGTGCAGTCTCTCGAGGCTGAAGTCGAGCAGCTGACCAAGGGGCTCAAGGACGAGTCGCTCAAATCCCAG
GGCCAAGTCGACTATCTCAGGAAGGAAACTCAGGTGCAACGGAACAGGCTCGACGCGTCGGAGCGGCAGATCCAG
GCGACGACGGAGGAGAACCGCTCCCTGCTTGCGAAACTCGAGGCCGCCCTGGGGACCATCCAGAATCAGGCCCGG
GCTCTGGGCAAGCTCCACGGCGAGCTGGCTCCCAGCGCTTCCGCGCCGGCGGAGCTGGCGGAACTGACCGAGTCT
TTGCGCTCGCACGCGGGAAGCGTCTTGGTCAGGCTGCGCAATACCGAGAGCGATTCCGCCCTCGTGAAGGCGGAT
CTAGGAAAGGCCCTAGACTCGGTCCAGGGCCTGAAGGCCGAGGTGGCTGGCCTGAAGGGCAAGCTGGCGGACGAG
GAGGAGCGGGCGAAGCAGCTCCGCGAGAGCCTGGCGGGGGAGCAGGCAAAGATCACGGCCCTCGAGACGGAGGCC
GCCGAGGGCCGAGTGCACCTGGACGAGCTGCGCTGCCAGCTTTCCAACGGCGAGACAGGCTCGGAGGCTCTTCGC
AAAAACCTCCAGGCGGAGGAGGAGAAGGCGGCCGCACTGGCGGAAGACTTGGCATCGCGTCAGTCGCAGATAGGC
AGCCTGGAGGAGGAGGTTTACGTGCACAGGCAGAGCGCGGAGAGCGTCCAGGCCAAGCTGTCCGCCCTCGCAGCC
CGCTACGAGTCCCGCGACGCCAGGACGAAGGATTTGACGCAGCGGCTGTACACGCAAAACGACCGGCTCGTCCGT
CTGCTCGAGCGCATCGGGTATGTCGTGAGCCGAGAGGCCGGGCAGATGATCATCACCAAGATTCCGCGGTCCGAG
AGGAACGTCCAGAATCCGAACGACTCGTCCGACCCCGGGTCCAGCCTCCGCCGCTCGGTTAGCCTCGGGCTCGGG
ACACGAGCCATGGCCGAGAGTGTAGATCTCGAGCTGTTGTACTGGATGGACAGCGCCGACGGCGCGACCGAGGCG
GCCAAGTACGACTCGTTCGTCCAGACGCTCGGCTCATTCGAGATGGACCTCTTCTCCGAAACGATCTACATCCGG
ATCAAGGAAGCGGAACACAAGGCCCGCAAGTGGCAGCGCGAAGCGCGAGCCTATCGGGACCGGGCGCACGTCCTC
CAAAAGGACGCGCACGACAAGATCGCCTTCAAACACTTCAAGGAGGGCGACTTGGCCCTCTTCCTGCCGACCCGC
AACCAGCAGGCGGGCGCGTGGGCAGCGTTCAACGTGGGGTTTCCGCACTACTTCCTCCGCGAGCAGGACGCGCAC
CGGCTGCGCCATCGGGAGTGGCTGGTGGCACGCATCTCGCGCATCCAGGAGCGCGTGGTAGATCTGTCGAAGAGT
CTCCAGCCGGCCAACGACAGCGAATCGATCAACGACGAGGAGAACGACAACCCGTTCCAGCTGTCGGACGGCCTG
CGGTGGTATCTAATCGACGCCCACGAGGACAAGCCTGGGGCGCCGGCGACGCCCGGCATGGGCAAGTCGACGGTG
GCGGCCAACAACGTGGAGGCGACGGCCGACATCCAATCGCACGCGGCCAAGGTCAGGGGCAAGAACCGCGACAGT
GTGACGAGCATCGAGGGCATCAACAAGTCGCTGTCCAAGAGCCTGGACAGCCGGCGGAGCAGCTCGGCGTCCAAG
AAGGCACTGCCCCTGCCGGGCATCGGCGGCACGGCGCTGCTCAAGAACAGCGCGCTGGCGAGCGAGACGAACTCG
CTGCGGGCGGCGGCGCCGGACACGCCAGCCGGCACGAGCCCCGTGCAGGGAGGCTTCGCGACAGTCGGCGGCGAC
CAGCGAGCCCAGGCCGAGAGGCAGGCGGGAAGCACGGCGGGCGAGACGACGGCACGGGGCGGCGGCGGGAAGTCG
CCCGAGCGGGAAGAATGCGAGAGCCCGAGCAAGAGGTCGGTGCTGTTGGACTCGCTGTGGAGCGTCGATTACAGC
TGA
Transcript >Hirsu2|7399
ATGGCGACGCAGGTGTTGATCGCCCATACGGGCCAACGCCTCGAGGTCGACGCCGCGCTCTTCTCGACGCTCGAT
GATCTCAAAGCATGGGTCGCGCGAAATACCTCCGTCTCCCTGCAACACATGGTTGCTCTGACTCCCCAGGGGCGC
AGCGTCAAGTTTGCCAGCCTTCATGCCGAGAAGGAGATATACATCTACGACATTCGAGTCGCCCAGACGTCGGCC
TCGTCGCCCTCGCCCTCTCTCGTCACCGAAACCCCCCCGCCGAGACGCCACTCCATCCCGGCCGCGCCCAACTCC
ATCGACGACGTGCAGGCCATTTCCTCGTGGCAGCACCTGTACGAGGAGCGTCGCGGATGGGCCCTGCAGCTGGCC
GACACGTGCTCGCGCATGAACTCGGCCGCCCTGGCCCGTTACGACGAGATCGATGCCATGATCAAGTGCCTCGAC
GCGGCCGTTGCCAACCTCGAGATTAGCGTCAAGCAGATCGAGCCCAAGTACACCGAGCTCAAGGCATGGGTCGAC
CCCGCCCTGTCGGAGCACGAGAAGCTCGCGTCCGGCTGGGAGCATTACCTTGCCTTGGCCCGCGACGTGGCCGTG
TCACCCGCCATGGTCAAGTTCATGACCCGAGGCGAGGTCGACAAGGCCGACGCCACCCTCGAGGACTTGGTCGAA
CTGGAGACGGCCAACAAGGCCGGGAAGCTCGCGCCGACGGCGCGCCGCAGGTTCAGCGACAAGGCCGCCGAGCTG
GACAGGCTGGCGTCGCAAATGTACCAGGGCTTCGAGGGCCTCGTGGCCGACTTCGAGAAGCTCATGGGCCGGTCC
GCCCTGGGGCACAACAACGATACCGTGCTGCTGCTGCAGGACATTGAAGCCGTCGCCAGCCAGATCGACGCCGAC
TACCACACATCCCTCGACTACGGCGGCTCGCAGCGCGACCTCGCGCAGGCCTCCAAGACGGCCTCCAACCACACC
GAGAGACTGGTCCCCTCGCTCAAGAAGCGGGTCAAGGAAATGGAAGAGATGCTGCAGTATGCGACGCGCGCTCGC
AACGCCCTCGTCCACGACTCTGCCGCCCACATGCGGACCATCACTGACATCACGGCGCTGCACAGCAGCGTCAAG
AACCAGATCAACACCCTTAACCAGTCGGAAGACGACATGACCACGTTCGACTATCTCCGCCTCATCCACCAGCTG
CCCTACATGTACGCCTCTTTTGTCGTCGAGGCCATCCGCCGCAGGGAATGGGTCGACAAGGTTCGGACCGATTCC
TCGACACTCGCCAACGAGATGGCCCTGTTCCAGGACGAAGAGGCGAAGCGCCGCCGGAAGTGGCAGAGAATGGTG
GGCAGCATGTACGGGCCCGGCTTCGACACAAACGTCGTCGGGCTCGAGGTCAACCTGCTCGGCGACGACGTGCCA
TGGCCGTCCATGACCAAGGACGAGCTGGATGGCTTCCACCAGAGCGTCCAGAGCCGGGGCGTCGACCCGGAGATC
GTCGATGACGTCGGCAAACTGATACACGAGCTTAGCAGCCCGACGAAGCAGCAGCTGAAGAGGCTCAGGGCGTTC
AAGAACGGCAGCGTCCACGAGGCCGCCCTGGGCCGGAGCGGGCTGATGATCCGCGGCGACGACGAGCTCATCCGC
AACCTGCAGGACGACAAGTCCAAGCTCGAGAGCAAGCTCAAGACGGCAGACAGCAGGGTCCGCCGTCTGGAGGAC
CTGCTGCACAGGCAGAGCCAGGCGTCGCGTCCGGGCAGCCTGTTTCAGTCCCAGCGGACGCAAGCGCACGAAAGA
CAGGACTCCGCTGCCTCCGTGAAGTCGCATCGCCCGGATGACCGCCGGCGTGGGTCTGACGGGGTGGACCCCCTG
CTACGGCGGATCGAGCAGCTCGAGGGCGAGCTCCGGGAAGAGAAACAGCGTTGCGCCCAGTTCGAAAAGGACCTG
GCCGCGCGCACGACACAGTATGACGACATGAAGGACCAGATCCAGGAGGTCAATTCGACCAAGAAGGACCTGCTC
GAAAACATGGAGGCCCTGAAGCGCGAGTTTCTCGACGAACGAAAGTCCCTGGAGGATGAGGTCAGGACGTTGAAG
GCCCGCCTGGAGGACACCGAGGACGAGATGGAGAATTTCGGCGAGTCGCGGGAGAACGAGAAGGCCGCGTACGAC
GAAAAGGTGCAGTCTCTCGAGGCTGAAGTCGAGCAGCTGACCAAGGGGCTCAAGGACGAGTCGCTCAAATCCCAG
GGCCAAGTCGACTATCTCAGGAAGGAAACTCAGGTGCAACGGAACAGGCTCGACGCGTCGGAGCGGCAGATCCAG
GCGACGACGGAGGAGAACCGCTCCCTGCTTGCGAAACTCGAGGCCGCCCTGGGGACCATCCAGAATCAGGCCCGG
GCTCTGGGCAAGCTCCACGGCGAGCTGGCTCCCAGCGCTTCCGCGCCGGCGGAGCTGGCGGAACTGACCGAGTCT
TTGCGCTCGCACGCGGGAAGCGTCTTGGTCAGGCTGCGCAATACCGAGAGCGATTCCGCCCTCGTGAAGGCGGAT
CTAGGAAAGGCCCTAGACTCGGTCCAGGGCCTGAAGGCCGAGGTGGCTGGCCTGAAGGGCAAGCTGGCGGACGAG
GAGGAGCGGGCGAAGCAGCTCCGCGAGAGCCTGGCGGGGGAGCAGGCAAAGATCACGGCCCTCGAGACGGAGGCC
GCCGAGGGCCGAGTGCACCTGGACGAGCTGCGCTGCCAGCTTTCCAACGGCGAGACAGGCTCGGAGGCTCTTCGC
AAAAACCTCCAGGCGGAGGAGGAGAAGGCGGCCGCACTGGCGGAAGACTTGGCATCGCGTCAGTCGCAGATAGGC
AGCCTGGAGGAGGAGGTTTACGTGCACAGGCAGAGCGCGGAGAGCGTCCAGGCCAAGCTGTCCGCCCTCGCAGCC
CGCTACGAGTCCCGCGACGCCAGGACGAAGGATTTGACGCAGCGGCTGTACACGCAAAACGACCGGCTCGTCCGT
CTGCTCGAGCGCATCGGGTATGTCGTGAGCCGAGAGGCCGGGCAGATGATCATCACCAAGATTCCGCGGTCCGAG
AGGAACGTCCAGAATCCGAACGACTCGTCCGACCCCGGGTCCAGCCTCCGCCGCTCGGTTAGCCTCGGGCTCGGG
ACACGAGCCATGGCCGAGAGTGTAGATCTCGAGCTGTTGTACTGGATGGACAGCGCCGACGGCGCGACCGAGGCG
GCCAAGTACGACTCGTTCGTCCAGACGCTCGGCTCATTCGAGATGGACCTCTTCTCCGAAACGATCTACATCCGG
ATCAAGGAAGCGGAACACAAGGCCCGCAAGTGGCAGCGCGAAGCGCGAGCCTATCGGGACCGGGCGCACGTCCTC
CAAAAGGACGCGCACGACAAGATCGCCTTCAAACACTTCAAGGAGGGCGACTTGGCCCTCTTCCTGCCGACCCGC
AACCAGCAGGCGGGCGCGTGGGCAGCGTTCAACGTGGGGTTTCCGCACTACTTCCTCCGCGAGCAGGACGCGCAC
CGGCTGCGCCATCGGGAGTGGCTGGTGGCACGCATCTCGCGCATCCAGGAGCGCGTGGTAGATCTGTCGAAGAGT
CTCCAGCCGGCCAACGACAGCGAATCGATCAACGACGAGGAGAACGACAACCCGTTCCAGCTGTCGGACGGCCTG
CGGTGGTATCTAATCGACGCCCACGAGGACAAGCCTGGGGCGCCGGCGACGCCCGGCATGGGCAAGTCGACGGTG
GCGGCCAACAACGTGGAGGCGACGGCCGACATCCAATCGCACGCGGCCAAGGTCAGGGGCAAGAACCGCGACAGT
GTGACGAGCATCGAGGGCATCAACAAGTCGCTGTCCAAGAGCCTGGACAGCCGGCGGAGCAGCTCGGCGTCCAAG
AAGGCACTGCCCCTGCCGGGCATCGGCGGCACGGCGCTGCTCAAGAACAGCGCGCTGGCGAGCGAGACGAACTCG
CTGCGGGCGGCGGCGCCGGACACGCCAGCCGGCACGAGCCCCGTGCAGGGAGGCTTCGCGACAGTCGGCGGCGAC
CAGCGAGCCCAGGCCGAGAGGCAGGCGGGAAGCACGGCGGGCGAGACGACGGCACGGGGCGGCGGCGGGAAGTCG
CCCGAGCGGGAAGAATGCGAGAGCCCGAGCAAGAGGTCGGTGCTGTTGGACTCGCTGTGGAGCGTCGATTACAGC
TGA
Gene >Hirsu2|7399
ATGGCGACGCAGGTGTTGATCGCCCATACGGGCCAACGCCTCGAGGTCGACGCCGCGCTCTTCTCGACGTATGCA
GAACCCCGTCCTCCTCCGTTTCACCCGCCCGGCCCTCCGGTCCTGACCCTTGTTTTCGCGGCAGGCTCGATGATC
TCAAAGCATGGGTCGCGCGAAATACCTCCGTCTCCCTGCAACACATGGTTGCTCTGACTCCCCAGGGGCGCAGCG
TCAAGTTTGCCAGCCTTCATGCCGAGGTGGGAAGCCCGTGCCGGTCGCGTCCCATCCTCGGGGCCACGTGTTGAC
CCTCGCACAGAAGGAGATATACATCTACGACATTCGAGTCGCCCAGACGTCGGCCTCGTCGCCCTCGCCCTCTCT
CGTCACCGAAACCCCCCCGCCGAGACGCCACTCCATCCCGGCCGCGCCCAACTCCATCGACGACGTGCAGGCCAT
TTCCTCGTGGCAGCACCTGTACGAGGAGCGTCGCGGATGGGCCCTGCAGCTGGCCGACACGTGCTCGCGCATGAA
CTCGGCCGCCCTGGCCCGTTACGACGAGATCGATGCCATGATCAAGTGCCTCGACGCGGCCGTTGCCAACCTCGA
GATTAGCGTCAAGCAGATCGAGCCCAAGTACACCGAGCTCAAGGCATGGGTCGACCCCGCCCTGTCGGAGCACGA
GAAGCTCGCGTCCGGCTGGGAGCATTACCTTGCCTTGGCCCGCGACGTGGCCGTGTCACCCGCCATGGTCAAGTT
CATGACCCGAGGCGAGGTCGACAAGGCCGACGCCACCCTCGAGGACTTGGTCGAACTGGAGACGGCCAACAAGGC
CGGGAAGCTCGCGCCGACGGCGCGCCGCAGGTTCAGCGACAAGGCCGCCGAGCTGGACAGGCTGGCGTCGCAAAT
GTACCAGGGCTTCGAGGGCCTCGTGGCCGACTTCGAGAAGCTCATGGGCCGGTCCGCCCTGGGGCACAACAACGA
TACCGTGCTGCTGCTGCAGGACATTGAAGCCGTCGCCAGCCAGATCGACGCCGACTACCACACATCCCTCGACTA
CGGCGGCTCGCAGCGCGACCTCGCGCAGGCCTCCAAGACGGCCTCCAACCACACCGAGAGACTGGTCCCCTCGCT
CAAGAAGCGGGTCAAGGAAATGGAAGAGATGCTGCAGTATGCGACGCGCGCTCGCAACGCCCTCGTCCACGACTC
TGCCGCCCACATGCGGACCATCACTGACATCACGGCGCTGCACAGCAGCGTCAAGAACCAGATCAACACCCTTAA
CCAGTCGGAAGACGACATGACCACGTTCGACTATCTCCGCCTCATCCACCAGCTGCCCTACATGTACGCCTCTTT
TGTCGTCGAGGCCATCCGCCGCAGGGAATGGGTCGACAAGGTTCGGACCGATTCCTCGACACTCGCCAACGAGAT
GGCCCTGTTCCAGGACGAAGAGGCGAAGCGCCGCCGGAAGTGGCAGAGAATGGTGGGCAGCATGTACGGGCCCGG
CTTCGACACAAACGTCGTCGGGCTCGAGGTCAACCTGCTCGGCGACGACGTGCCATGGCCGTCCATGACCAAGGA
CGAGCTGGATGGCTTCCACCAGAGCGTCCAGAGCCGGGGCGTCGACCCGGAGATCGTCGATGACGTCGGCAAACT
GATACACGAGCTTAGCAGCCCGACGAAGCAGCAGCTGAAGAGGCTCAGGGCGTTCAAGAACGGCAGCGTCCACGA
GGCCGCCCTGGGCCGGAGCGGGCTGATGATCCGCGGCGACGACGAGCTCATCCGCAACCTGCAGGACGACAAGTC
CAAGCTCGAGAGCAAGCTCAAGACGGCAGACAGCAGGGTCCGCCGTCTGGAGGACCTGCTGCACAGGCAGAGCCA
GGCGTCGCGTCCGGGCAGCCTGTTTCAGTCCCAGCGGACGCAAGCGCACGAAAGACAGGACTCCGCTGCCTCCGT
GAAGTCGCATCGCCCGGATGACCGCCGGCGTGGGTCTGACGGGGTGGACCCCCTGCTACGGCGGATCGAGCAGCT
CGAGGGCGAGCTCCGGGAAGAGAAACAGCGTTGCGCCCAGTTCGAAAAGGACCTGGCCGCGCGCACGACACAGTA
TGACGACATGAAGGACCAGATCCAGGAGGTCAATTCGACCAAGAAGGACCTGCTCGAAAACATGGAGGCCCTGAA
GCGCGAGTTTCTCGACGAACGAAAGTCCCTGGAGGATGAGGTCAGGACGTTGAAGGCCCGCCTGGAGGACACCGA
GGACGAGATGGAGAATTTCGGCGAGTCGCGGGAGAACGAGAAGGCCGCGTACGACGAAAAGGTGCAGTCTCTCGA
GGCTGAAGTCGAGCAGCTGACCAAGGGGCTCAAGGACGAGTCGCTCAAATCCCAGGGCCAAGTCGACTATCTCAG
GAAGGAAACTCAGGTGCAACGGAACAGGCTCGACGCGTCGGAGCGGCAGATCCAGGCGACGACGGAGGAGAACCG
CTCCCTGCTTGCGAAACTCGAGGCCGCCCTGGGGACCATCCAGAATCAGGCCCGGGCTCTGGGCAAGCTCCACGG
CGAGCTGGCTCCCAGCGCTTCCGCGCCGGCGGAGCTGGCGGAACTGACCGAGTCTTTGCGCTCGCACGCGGGAAG
CGTCTTGGTCAGGCTGCGCAATACCGAGAGCGATTCCGCCCTCGTGAAGGCGGATCTAGGAAAGGCCCTAGACTC
GGTCCAGGGCCTGAAGGCCGAGGTGGCTGGCCTGAAGGGCAAGCTGGCGGACGAGGAGGAGCGGGCGAAGCAGCT
CCGCGAGAGCCTGGCGGGGGAGCAGGCAAAGATCACGGCCCTCGAGACGGAGGCCGCCGAGGGCCGAGTGCACCT
GGACGAGCTGCGCTGCCAGCTTTCCAACGGCGAGACAGGCTCGGAGGCTCTTCGCAAAAACCTCCAGGCGGAGGA
GGAGAAGGCGGCCGCACTGGCGGAAGACTTGGCATCGCGTCAGTCGCAGATAGGCAGCCTGGAGGAGGAGGTTTA
CGTGCACAGGCAGAGCGCGGAGAGCGTCCAGGCCAAGCTGTCCGCCCTCGCAGCCCGCTACGAGTCCCGCGACGC
CAGGACGAAGGATTTGACGCAGCGGCTGTACACGCAAAACGACCGGCTCGTCCGTCTGCTCGAGCGCATCGGGTA
TGTCGTGAGCCGAGAGGCCGGGCAGATGATCATCACCAAGATTCCGCGGTCCGAGAGGAACGTCCAGAATCCGAA
CGACTCGTCCGACCCCGGGTCCAGCCTCCGCCGCTCGGTTAGCCTCGGGCTCGGGACACGAGCCATGGCCGAGAG
TGTAGATCTCGAGCTGTTGTACTGGATGGACAGCGCCGACGGCGCGACCGAGGCGGCCAAGTACGACTCGTTCGT
CCAGACGCTCGGCTCATTCGAGATGGACCTCTTCTCCGAAACGATCTACATCCGGATCAAGGAAGCGGAACACAA
GGCCCGCAAGTGGCAGCGCGAAGCGCGAGCCTATCGGGACCGGGCGCACGTCCTCCAAAAGGACGCGCACGACAA
GATCGCCTTCAAACACTTCAAGGAGGGCGACTTGGCCCTCTTCCTGCCGACCCGCAACCAGCAGGCGGGCGCGTG
GGCAGCGTTCAACGTGGGGTTTCCGCACTACTTCCTCCGCGAGCAGGACGCGCACCGGCTGCGCCATCGGGAGTG
GCTGGTGGCACGCATCTCGCGCATCCAGGAGCGCGTGGTAGATCTGTCGAAGAGTCTCCAGCCGGCCAACGACAG
CGAATCGATCAACGACGAGGAGAACGACAACCCGTTCCAGCTGTCGGACGGCCTGCGGTGGTATCTAATCGACGC
CCACGAGGACAAGCCTGGGGCGCCGGCGACGCCCGGCATGGGCAAGTCGACGGTGGCGGCCAACAACGTGGAGGC
GACGGCCGACATCCAATCGCACGCGGCCAAGGTCAGGGGCAAGAACCGCGACAGTGTGACGAGCATCGAGGGCAT
CAACAAGTCGCTGTCCAAGAGCCTGGACAGCCGGCGGAGCAGCTCGGCGTCCAAGAAGGCACTGCCCCTGCCGGG
CATCGGCGGCACGGCGCTGCTCAAGAACAGCGCGCTGGCGAGCGAGACGAACTCGCTGCGGGCGGCGGCGCCGGA
CACGCCAGCCGGCACGAGCCCCGTGCAGGGAGGCTTCGCGACAGTCGGCGGCGACCAGCGAGCCCAGGCCGAGAG
GCAGGCGGGAAGCACGGCGGGCGAGACGACGGCACGGGGCGGCGGCGGGAAGTCGCCCGAGGTACGAAACGTCGA
CTCCCTCCTCGGACCCTAGGTGGACTGATGGGTAACCTGGTGGCCGCAGCGGGAAGAATGCGAGAGCCCGAGCAA
GAGGTCGGTGCTGTTGGACTCGCTGTGGAGCGTCGATTACAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail