Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7397
Gene name
LocationContig_429:18351..19265
Strand+
Gene length (bp)914
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00403 HMA Heavy-metal-associated domain 3.4E-07 39 93

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38360|ATU1_YEAST P-type cation-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCA1 PE=1 SV=2 3 267 2.0E-78
sp|Q9SH30|HMA5_ARATH Probable copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=1 SV=2 5 271 8.0E-11
sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 30 265 1.0E-09
sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 29 265 9.0E-07

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0030001 metal ion transport Yes
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 184 206 22
2 211 233 22
3 240 262 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7397
MPHASLTLKRVRADKANAVPSASDVENQAVGSEHVVLCVSGMTCTGCETKLNRTLATVHGVGSLKTSLVLSRAEF
DVDLRLVAVADVIKHLERTTEFKCERIADRGSSLDVLVAGDGTSFVDRPWPEGVMDMSLADKGVVRITFDPAIVG
ARDLLTTHLGPDVRLAPVCADASLKAGGKHVRHVGFVTMLSSVLTVPVLVMAWAPLPKHEMAYSSASLALATIVQ
IFVAGPFYPKALKALVFSRVIEMDLLIVLSTSAAYVFSTVSFSRRARCS*
Coding >Hirsu2|7397
ATGCCGCACGCCTCTCTCACGCTCAAGCGCGTCCGAGCGGACAAAGCCAACGCCGTGCCCTCGGCAAGTGATGTT
GAGAACCAGGCCGTTGGCAGCGAACACGTCGTCCTCTGCGTCTCCGGCATGACCTGCACCGGCTGCGAGACGAAG
CTGAACCGGACCCTGGCGACGGTCCACGGCGTCGGGAGCCTGAAGACGAGCTTGGTTCTCTCGCGGGCCGAGTTC
GACGTCGACCTCCGACTGGTCGCCGTCGCCGACGTCATAAAGCACCTGGAACGAACGACCGAGTTCAAGTGCGAG
CGGATCGCCGACAGGGGATCGAGCTTGGACGTCCTCGTCGCCGGAGACGGGACCAGCTTCGTCGACCGGCCGTGG
CCCGAGGGGGTCATGGACATGAGTCTCGCCGACAAGGGCGTGGTGCGGATCACATTCGACCCGGCCATCGTCGGC
GCCAGAGATCTCCTCACGACGCACCTGGGCCCCGACGTGAGACTTGCTCCCGTGTGCGCCGACGCTTCGCTCAAG
GCCGGGGGCAAACACGTCCGCCACGTCGGCTTCGTGACGATGCTGTCCTCGGTCTTGACCGTGCCGGTCCTGGTC
ATGGCGTGGGCCCCGCTGCCGAAACATGAGATGGCCTACAGCTCGGCGTCGCTGGCCCTGGCCACCATCGTCCAG
ATCTTCGTCGCGGGACCCTTCTACCCCAAGGCGCTCAAGGCGCTCGTCTTCTCCCGCGTCATCGAAATGGACCTG
CTCATCGTGCTCAGCACCAGCGCCGCCTACGTCTTCTCTACCGTCTCTTTTTCGAGACGAGCACGCTGCTCGTGA
Transcript >Hirsu2|7397
ATGCCGCACGCCTCTCTCACGCTCAAGCGCGTCCGAGCGGACAAAGCCAACGCCGTGCCCTCGGCAAGTGATGTT
GAGAACCAGGCCGTTGGCAGCGAACACGTCGTCCTCTGCGTCTCCGGCATGACCTGCACCGGCTGCGAGACGAAG
CTGAACCGGACCCTGGCGACGGTCCACGGCGTCGGGAGCCTGAAGACGAGCTTGGTTCTCTCGCGGGCCGAGTTC
GACGTCGACCTCCGACTGGTCGCCGTCGCCGACGTCATAAAGCACCTGGAACGAACGACCGAGTTCAAGTGCGAG
CGGATCGCCGACAGGGGATCGAGCTTGGACGTCCTCGTCGCCGGAGACGGGACCAGCTTCGTCGACCGGCCGTGG
CCCGAGGGGGTCATGGACATGAGTCTCGCCGACAAGGGCGTGGTGCGGATCACATTCGACCCGGCCATCGTCGGC
GCCAGAGATCTCCTCACGACGCACCTGGGCCCCGACGTGAGACTTGCTCCCGTGTGCGCCGACGCTTCGCTCAAG
GCCGGGGGCAAACACGTCCGCCACGTCGGCTTCGTGACGATGCTGTCCTCGGTCTTGACCGTGCCGGTCCTGGTC
ATGGCGTGGGCCCCGCTGCCGAAACATGAGATGGCCTACAGCTCGGCGTCGCTGGCCCTGGCCACCATCGTCCAG
ATCTTCGTCGCGGGACCCTTCTACCCCAAGGCGCTCAAGGCGCTCGTCTTCTCCCGCGTCATCGAAATGGACCTG
CTCATCGTGCTCAGCACCAGCGCCGCCTACGTCTTCTCTACCGTCTCTTTTTCGAGACGAGCACGCTGCTCGTGA
Gene >Hirsu2|7397
ATGCCGCGTCAGTGCCACTGCCGCCGCCGCCCCGGCTCCGGGCCAAGATGCAGACGCCTCTCTCACGCTCAAGCG
CGTCCGAGCGGACAAAGCCAACGCCGTGCCCTCGGCAAGTGATGTTGAGAACCAGGCCGTTGGCAGCGAACACGT
CGTCCTCTGCGTCTCCGGCATGACCTGCACCGGCTGCGAGACGAAGCTGAACCGGACCCTGGCGACGGTCCACGG
CGTCGGGAGCCTGAAGACGAGCTTGGTTCTCTCGCGGGCCGAGTTCGACGTCGACCTCCGACTGGTCGCCGTCGC
CGACGTCATAAAGCACCTGGAACGAACGACCGAGTTCAAGTGCGAGCGGATCGCCGACAGGGGATCGAGCTTGGA
CGTCCTCGTCGCCGGAGACGGGACCAGCTTCGTCGACCGGCCGTGGCCCGAGGGGGTCATGGACATGAGTCTCGC
CGACAAGGGCGTGGTGCGGATCACATTCGACCCGGCCATCGTCGGCGCCAGAGATCTCCTCACGACGCACCTGGG
CCCCGACGTGAGACTTGCTCCCGTGTGCGCCGACGCTTCGCTCAAGGCCGGGGGCAAACACGTCCGCCACGTCGG
CTTCGTGACGATGCTGTCCTCGGTCTTGACCGTGCCGGTCCTGGTCATGGCGTGGGCCCCGCTGCCGAAACATGA
GATGGCCTACAGCTCGGCGTCGCTGGCCCTGGCCACCATCGTCCAGATCTTCGTCGCGGGACCCTTCTACCCCAA
GGCGCTCAAGGCGCTCGTCTTCTCCCGCGTCATCGAAATGGACCTGCTCATCGTGCTCAGCACCAGCGCCGCCTA
CGTCTTCTCTACCGTCTCGTTCGCCTATCTCGTCGCGGGCAGGCCGCTCTCGACCGGCCAGTTTTTCGAGACGAG
CACGCTGCTCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail