Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7394
Gene name
LocationContig_429:7303..9987
Strand-
Gene length (bp)2684
Transcript length (bp)2115
Coding sequence length (bp)2115
Protein length (aa) 705

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04818 CID CID domain 2.4E-11 10 130
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 6.4E-06 473 521

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTE3|SEB1_SCHPO Rpb7-binding protein seb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=seb1 PE=1 SV=3 8 606 3.0E-91
sp|P53617|NRD1_YEAST Protein NRD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRD1 PE=1 SV=1 453 619 3.0E-49
sp|P53617|NRD1_YEAST Protein NRD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRD1 PE=1 SV=1 8 149 2.0E-18

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3486 0.9138 0.0972 0.0178 0.0337 0.011 0.098 0.0035 0.0042 0.0015

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3789
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|305
Ophiocordyceps australis map64 (Brazil) OphauB2|1386
Ophiocordyceps camponoti-floridani Ophcf2|01583
Ophiocordyceps camponoti-rufipedis Ophun1|6124
Ophiocordyceps kimflemingae Ophio5|6235
Ophiocordyceps subramaniannii Hirsu2|7394 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7394
MLNLKPPGVSGSRITSLTSLCVSNIQSESVLIQKIYTHFKKAPGTHKLGVLYVVDSVTRKWLEQAKAQGQPVNSS
AQDGTYAAGVHRVTELMPVLMNDILQSAPEEQKEKIKKLLDIWEKGQTFPAPMLESFRQKMSAPAPMADCFAFDP
DASTTPPGSPPPGGPLAALQDRPQASTTPAAPNGSSILEALANMARQNTTASTNNKPVTPTPAAPFGLPTGAVPQ
QPATSSVHQQALNALNPSAYPPASQPVNGSSLPFSLPQMAGQGAQQPAALAAATNAALNPYAAAASTPAATAGGL
GLDSNTQQQIMLIKALADQGVPFDKIPALIQSMTGAASANAQAAFQPPVPAAQGTFSTAQQAWGANTAHGFQDGT
RSPSRYQGRSRSRSPDRGWGSRGSPRNGGAHDGLDHNHHEERERGGRRGNGYRQRSPQGRRARSASPPSEFPHIE
RWVEWDPTLPAGHIRVLSRTLFVGGVTCSEADLRKIFSRYGTVQTCIVNKEKRHAFVKMLTRKDAVHAKDSTEDT
RNLELPLRTRWGVGYGPRDCSDYATGISVIPIHKLTEADRKWMLTAPYGGSGGRPIETGMCVEEPDIEIGAGVSS
KAISRRMQTDKGGSNGPKSTRNREEESSGRGRRGRGRGEQADNGAASQQQQQQQQQQQQQQQQQQQAAAMSAFAP
FGMNSLPNGIPNFPTGGYAFPNSGAGNGA*
Coding >Hirsu2|7394
ATGCTCAACTTGAAACCTCCCGGAGTGTCGGGATCACGTATCACTAGCCTCACCTCACTCTGCGTCTCCAACATT
CAGTCCGAGTCCGTCCTGATCCAAAAAATATACACTCACTTCAAGAAGGCGCCCGGGACGCACAAGTTGGGGGTA
CTCTACGTAGTAGACTCTGTAACCCGGAAATGGCTCGAGCAAGCAAAGGCCCAAGGGCAGCCAGTAAACAGCTCT
GCACAGGACGGCACGTATGCCGCCGGCGTACACCGAGTGACGGAACTGATGCCCGTTTTGATGAATGACATTCTT
CAGTCTGCGCCCGAGGAGCAAAAGGAAAAGATCAAGAAGCTCCTTGACATCTGGGAGAAGGGCCAGACCTTCCCG
GCGCCGATGCTCGAGTCCTTCCGCCAAAAAATGAGTGCTCCGGCCCCAATGGCTGACTGCTTCGCCTTCGACCCA
GATGCTTCGACGACGCCCCCCGGCAGCCCTCCTCCCGGCGGCCCGCTGGCCGCCCTGCAAGACAGACCTCAGGCC
TCGACCACGCCGGCGGCCCCGAACGGCTCGTCCATTCTTGAAGCGCTCGCCAACATGGCGCGCCAGAACACGACG
GCGTCGACCAACAACAAGCCCGTCACGCCGACGCCCGCGGCGCCGTTCGGACTGCCGACCGGGGCCGTGCCACAG
CAGCCGGCGACGTCTTCGGTCCATCAGCAGGCGCTCAATGCCCTGAACCCATCGGCGTACCCCCCCGCCTCGCAG
CCGGTGAACGGCTCGTCCCTGCCCTTCTCGCTACCTCAGATGGCCGGTCAGGGCGCCCAGCAGCCGGCGGCGTTG
GCCGCCGCGACGAATGCGGCTCTCAACCCATACGCCGCCGCCGCTTCGACGCCGGCCGCCACTGCCGGAGGACTC
GGCCTCGACTCAAATACGCAGCAGCAGATCATGCTGATCAAGGCCCTCGCGGACCAGGGCGTGCCTTTCGACAAG
ATACCCGCCCTGATCCAGAGCATGACTGGCGCCGCCAGCGCCAACGCGCAGGCCGCCTTTCAGCCGCCCGTGCCG
GCCGCCCAAGGGACCTTCTCGACGGCGCAGCAGGCGTGGGGGGCGAACACGGCCCACGGCTTCCAAGACGGCACG
AGATCGCCCAGCAGATACCAGGGACGCTCCCGATCCCGCTCTCCCGACCGCGGCTGGGGCTCACGCGGATCCCCT
CGCAACGGGGGGGCGCATGACGGGCTCGACCACAACCATCACGAGGAGCGCGAGCGCGGCGGCCGCCGGGGCAAT
GGCTACCGGCAGCGGAGCCCACAGGGGCGCCGGGCTCGCAGCGCCTCCCCACCGTCCGAGTTCCCCCATATAGAG
AGATGGGTCGAGTGGGATCCAACGCTGCCGGCGGGCCACATCAGGGTGCTGAGCCGAACGCTCTTTGTTGGGGGA
GTGACATGCAGCGAGGCGGACCTGCGCAAGATCTTCAGCCGTTACGGCACGGTTCAGACGTGCATCGTGAATAAG
GAGAAGCGACACGCGTTTGTCAAGATGCTGACGCGCAAGGATGCGGTGCATGCCAAGGACAGCACGGAAGACACC
AGGAACCTGGAGCTGCCTCTTCGGACACGCTGGGGCGTCGGCTACGGCCCTCGGGACTGCAGCGACTACGCGACG
GGCATCAGCGTGATCCCGATCCACAAGCTTACCGAGGCGGACCGAAAGTGGATGCTGACGGCGCCCTACGGCGGC
AGCGGAGGACGGCCGATCGAGACGGGCATGTGCGTCGAGGAGCCAGACATTGAGATAGGGGCCGGGGTGTCGTCC
AAGGCGATCAGCCGGCGGATGCAGACGGACAAGGGCGGCAGCAACGGACCCAAGTCGACGCGGAATCGCGAGGAG
GAGTCGTCGGGCCGGGGACGTCGCGGGCGAGGGCGCGGCGAGCAGGCAGACAACGGGGCGGCAAGCCAACAACAA
CAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCAGCGGCGATGTCGGCCTTTGCCCCC
TTTGGCATGAACAGCCTGCCGAACGGCATCCCCAACTTCCCGACGGGGGGGTATGCGTTCCCGAACAGCGGTGCA
GGAAACGGAGCGTGA
Transcript >Hirsu2|7394
ATGCTCAACTTGAAACCTCCCGGAGTGTCGGGATCACGTATCACTAGCCTCACCTCACTCTGCGTCTCCAACATT
CAGTCCGAGTCCGTCCTGATCCAAAAAATATACACTCACTTCAAGAAGGCGCCCGGGACGCACAAGTTGGGGGTA
CTCTACGTAGTAGACTCTGTAACCCGGAAATGGCTCGAGCAAGCAAAGGCCCAAGGGCAGCCAGTAAACAGCTCT
GCACAGGACGGCACGTATGCCGCCGGCGTACACCGAGTGACGGAACTGATGCCCGTTTTGATGAATGACATTCTT
CAGTCTGCGCCCGAGGAGCAAAAGGAAAAGATCAAGAAGCTCCTTGACATCTGGGAGAAGGGCCAGACCTTCCCG
GCGCCGATGCTCGAGTCCTTCCGCCAAAAAATGAGTGCTCCGGCCCCAATGGCTGACTGCTTCGCCTTCGACCCA
GATGCTTCGACGACGCCCCCCGGCAGCCCTCCTCCCGGCGGCCCGCTGGCCGCCCTGCAAGACAGACCTCAGGCC
TCGACCACGCCGGCGGCCCCGAACGGCTCGTCCATTCTTGAAGCGCTCGCCAACATGGCGCGCCAGAACACGACG
GCGTCGACCAACAACAAGCCCGTCACGCCGACGCCCGCGGCGCCGTTCGGACTGCCGACCGGGGCCGTGCCACAG
CAGCCGGCGACGTCTTCGGTCCATCAGCAGGCGCTCAATGCCCTGAACCCATCGGCGTACCCCCCCGCCTCGCAG
CCGGTGAACGGCTCGTCCCTGCCCTTCTCGCTACCTCAGATGGCCGGTCAGGGCGCCCAGCAGCCGGCGGCGTTG
GCCGCCGCGACGAATGCGGCTCTCAACCCATACGCCGCCGCCGCTTCGACGCCGGCCGCCACTGCCGGAGGACTC
GGCCTCGACTCAAATACGCAGCAGCAGATCATGCTGATCAAGGCCCTCGCGGACCAGGGCGTGCCTTTCGACAAG
ATACCCGCCCTGATCCAGAGCATGACTGGCGCCGCCAGCGCCAACGCGCAGGCCGCCTTTCAGCCGCCCGTGCCG
GCCGCCCAAGGGACCTTCTCGACGGCGCAGCAGGCGTGGGGGGCGAACACGGCCCACGGCTTCCAAGACGGCACG
AGATCGCCCAGCAGATACCAGGGACGCTCCCGATCCCGCTCTCCCGACCGCGGCTGGGGCTCACGCGGATCCCCT
CGCAACGGGGGGGCGCATGACGGGCTCGACCACAACCATCACGAGGAGCGCGAGCGCGGCGGCCGCCGGGGCAAT
GGCTACCGGCAGCGGAGCCCACAGGGGCGCCGGGCTCGCAGCGCCTCCCCACCGTCCGAGTTCCCCCATATAGAG
AGATGGGTCGAGTGGGATCCAACGCTGCCGGCGGGCCACATCAGGGTGCTGAGCCGAACGCTCTTTGTTGGGGGA
GTGACATGCAGCGAGGCGGACCTGCGCAAGATCTTCAGCCGTTACGGCACGGTTCAGACGTGCATCGTGAATAAG
GAGAAGCGACACGCGTTTGTCAAGATGCTGACGCGCAAGGATGCGGTGCATGCCAAGGACAGCACGGAAGACACC
AGGAACCTGGAGCTGCCTCTTCGGACACGCTGGGGCGTCGGCTACGGCCCTCGGGACTGCAGCGACTACGCGACG
GGCATCAGCGTGATCCCGATCCACAAGCTTACCGAGGCGGACCGAAAGTGGATGCTGACGGCGCCCTACGGCGGC
AGCGGAGGACGGCCGATCGAGACGGGCATGTGCGTCGAGGAGCCAGACATTGAGATAGGGGCCGGGGTGTCGTCC
AAGGCGATCAGCCGGCGGATGCAGACGGACAAGGGCGGCAGCAACGGACCCAAGTCGACGCGGAATCGCGAGGAG
GAGTCGTCGGGCCGGGGACGTCGCGGGCGAGGGCGCGGCGAGCAGGCAGACAACGGGGCGGCAAGCCAACAACAA
CAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCAGCGGCGATGTCGGCCTTTGCCCCC
TTTGGCATGAACAGCCTGCCGAACGGCATCCCCAACTTCCCGACGGGGGGGTATGCGTTCCCGAACAGCGGTGCA
GGAAACGGAGCGTGA
Gene >Hirsu2|7394
ATGCTCAACTTGAAACCTCCCGGAGTGTCGGGATCACGTATCACTAGCCTCACCTCACTCTGCGTCTCCAACATT
CAGGTATGCAACGTCCGCTTCGTCTTGCCGGCCGTCCGCCCCGCGCTGACCAACGGCCGTACAGTCCGAGTCCGT
CCTGATCCAAAAAATATACACTCACTTCAAGAAGGCGCCCGGGACGCACAAGTTGGGGGTACTCTACGTAGTAGA
CTCTGTAACCCGGAAATGGCTCGAGCAAGCAAAGGCCCAAGGGCAGCCAGTAAACAGCTCTGCACAGGACGGCAC
GTATGCCGCCGGCGTACACCGAGTGACGGAACTGATGCCCGTTTTGATGAATGACATTCTTCAGTCTGCGCCCGA
GGAGCAAAAGGTACGCATCTTATTTTCCGATGACCACACTCCCAGATGCTCTGCCTCGTAGCAGTATCCCTCTGT
CGGCCGCTGGCCAGCCGCGTGCGACTCTTGGCCACGAAGACGTCTCTTCAACGCCGTCGTCGCCATCCTCGTGTC
TCGCGCCCAGCCCTCGTGGGTCGGCGTCGCAATCGAGAGATGCAAGATGACCGACGCGACGCGCCAGTCAGCCCG
TCATGGAACTCGTTCCCTCGTTGGCACACTAGCATCCATGTCCGGAGTACAGTGACTTACCAGACGACTCGCCGT
GTAGGAAAAGATCAAGAAGCTCCTTGACATCTGGGAGAAGGGCCAGACCTTCCCGGCGCCGATGCTCGAGTCCTT
CCGCCAAAAAATGAGTGCTCCGGCCCCAAGTATGTTGTCCTCGGCTCCTGTCCTCCCAGCTGCCTCGACCAGGCC
CAGGCCGTGGTGCCGGTCGAGCCGCCGCGCGCCGTGTCCAGTGGCTGACTGCTTCGCCTTCGACCCAGATGCTTC
GACGACGCCCCCCGGCAGCCCTCCTCCCGGCGGCCCGCTGGCCGCCCTGCAAGACAGACCTCAGGCCTCGACCAC
GCCGGCGGCCCCGAACGGCTCGTCCATTCTTGAAGCGCTCGCCAACATGGCGCGCCAGAACACGACGGCGTCGAC
CAACAACAAGCCCGTCACGCCGACGCCCGCGGCGCCGTTCGGACTGCCGACCGGGGCCGTGCCACAGCAGCCGGC
GACGTCTTCGGTCCATCAGCAGGCGCTCAATGCCCTGAACCCATCGGCGTACCCCCCCGCCTCGCAGCCGGTGAA
CGGCTCGTCCCTGCCCTTCTCGCTACCTCAGATGGCCGGTCAGGGCGCCCAGCAGCCGGCGGCGTTGGCCGCCGC
GACGAATGCGGCTCTCAACCCATACGCCGCCGCCGCTTCGACGCCGGCCGCCACTGCCGGAGGACTCGGCCTCGA
CTCAAATACGCAGCAGCAGATCATGCTGATCAAGGCCCTCGCGGACCAGGGCGTGCCTTTCGACAAGATACCCGC
CCTGATCCAGAGCATGACTGGCGCCGCCAGCGCCAACGCGCAGGCCGCCTTTCAGCCGCCCGTGCCGGCCGCCCA
AGGGACCTTCTCGACGGCGCAGCAGGCGTGGGGGGCGAACACGGCCCACGGCTTCCAAGACGGCACGAGATCGCC
CAGCAGATACCAGGGACGCTCCCGATCCCGCTCTCCCGACCGCGGCTGGGGCTCACGCGGATCCCCTCGCAACGG
GGGGGCGCATGACGGGCTCGACCACAACCATCACGAGGAGCGCGAGCGCGGCGGCCGCCGGGGCAATGGCTACCG
GCAGCGGAGCCCACAGGGGCGCCGGGCTCGCAGCGCCTCCCCACCGTCCGAGTTCCCCCATATAGAGAGATGGGT
CGAGTGGGATCCAACGCTGCCGGCGGGCCACATCAGGGTGCTGAGCCGAACGCTCTTTGTTGGGGGAGTGACGTG
AGTATCCGGTCGTTGGCTTCCCCCTGCCGCGGACGAGCTGCTAACTAGGGCAACAGATGCAGCGAGGCGGACCTG
CGCAAGATCTTCAGCCGTTACGGCACGGTTCAGACGTGCATCGTGAATAAGGAGAAGCGACACGCGTTTGTCAAG
ATGCTGACGCGCAAGGATGCGGTGCATGCCAAGGACAGCACGGAAGACACCAGGAACCTGGAGCTGCCTCTTCGG
GTGAGTCTTGTCGGGTTCGGCCGGGAGAGGGGGAGAGGGAGGACGAGTGCTAACGGCGAGCTCGACAGACACGCT
GGGGCGTCGGCTACGGCCCTCGGGACTGCAGCGACTACGCGACGGGCATCAGCGTGATCCCGATCCACAAGCTTA
CCGAGGCGGACCGAAAGTGGATGCTGACGGCGCCCTACGGCGGCAGCGGAGGACGGCCGATCGAGACGGGCATGT
GCGTCGAGGAGCCAGACATTGAGATAGGGGCCGGGGTGTCGTCCAAGGCGATCAGCCGGCGGATGCAGACGGACA
AGGGCGGCAGCAACGGACCCAAGTCGACGCGGAATCGCGAGGAGGAGTCGTCGGGCCGGGGACGTCGCGGGCGAG
GGCGCGGCGAGCAGGCAGACAACGGGGCGGCAAGCCAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGC
AGCAGCAGCAGCAGCAGGCAGCGGCGATGTCGGCCTTTGCCCCCTTTGGCATGAACAGCCTGCCGAACGGCATCC
CCAACTTCCCGACGGGGGGGTATGCGTTCCCGAACAGCGGTGCAGGAAACGGAGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail