Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7394
Gene name
LocationContig_429:7303..9987
Strand-
Gene length (bp)2684
Transcript length (bp)2115
Coding sequence length (bp)2115
Protein length (aa) 705

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04818 CTD_bind RNA polymerase II-binding domain. 2.0E-09 47 124
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.3E-06 475 521

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTE3|SEB1_SCHPO Rpb7-binding protein seb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=seb1 PE=1 SV=3 8 606 3.0E-91
sp|P53617|NRD1_YEAST Protein NRD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRD1 PE=1 SV=1 453 619 3.0E-49
sp|P53617|NRD1_YEAST Protein NRD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRD1 PE=1 SV=1 8 149 2.0E-18

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7394
MLNLKPPGVSGSRITSLTSLCVSNIQSESVLIQKIYTHFKKAPGTHKLGVLYVVDSVTRKWLEQAKAQGQPVNSS
AQDGTYAAGVHRVTELMPVLMNDILQSAPEEQKEKIKKLLDIWEKGQTFPAPMLESFRQKMSAPAPMADCFAFDP
DASTTPPGSPPPGGPLAALQDRPQASTTPAAPNGSSILEALANMARQNTTASTNNKPVTPTPAAPFGLPTGAVPQ
QPATSSVHQQALNALNPSAYPPASQPVNGSSLPFSLPQMAGQGAQQPAALAAATNAALNPYAAAASTPAATAGGL
GLDSNTQQQIMLIKALADQGVPFDKIPALIQSMTGAASANAQAAFQPPVPAAQGTFSTAQQAWGANTAHGFQDGT
RSPSRYQGRSRSRSPDRGWGSRGSPRNGGAHDGLDHNHHEERERGGRRGNGYRQRSPQGRRARSASPPSEFPHIE
RWVEWDPTLPAGHIRVLSRTLFVGGVTCSEADLRKIFSRYGTVQTCIVNKEKRHAFVKMLTRKDAVHAKDSTEDT
RNLELPLRTRWGVGYGPRDCSDYATGISVIPIHKLTEADRKWMLTAPYGGSGGRPIETGMCVEEPDIEIGAGVSS
KAISRRMQTDKGGSNGPKSTRNREEESSGRGRRGRGRGEQADNGAASQQQQQQQQQQQQQQQQQQQAAAMSAFAP
FGMNSLPNGIPNFPTGGYAFPNSGAGNGA*
Coding >Hirsu2|7394
ATGCTCAACTTGAAACCTCCCGGAGTGTCGGGATCACGTATCACTAGCCTCACCTCACTCTGCGTCTCCAACATT
CAGTCCGAGTCCGTCCTGATCCAAAAAATATACACTCACTTCAAGAAGGCGCCCGGGACGCACAAGTTGGGGGTA
CTCTACGTAGTAGACTCTGTAACCCGGAAATGGCTCGAGCAAGCAAAGGCCCAAGGGCAGCCAGTAAACAGCTCT
GCACAGGACGGCACGTATGCCGCCGGCGTACACCGAGTGACGGAACTGATGCCCGTTTTGATGAATGACATTCTT
CAGTCTGCGCCCGAGGAGCAAAAGGAAAAGATCAAGAAGCTCCTTGACATCTGGGAGAAGGGCCAGACCTTCCCG
GCGCCGATGCTCGAGTCCTTCCGCCAAAAAATGAGTGCTCCGGCCCCAATGGCTGACTGCTTCGCCTTCGACCCA
GATGCTTCGACGACGCCCCCCGGCAGCCCTCCTCCCGGCGGCCCGCTGGCCGCCCTGCAAGACAGACCTCAGGCC
TCGACCACGCCGGCGGCCCCGAACGGCTCGTCCATTCTTGAAGCGCTCGCCAACATGGCGCGCCAGAACACGACG
GCGTCGACCAACAACAAGCCCGTCACGCCGACGCCCGCGGCGCCGTTCGGACTGCCGACCGGGGCCGTGCCACAG
CAGCCGGCGACGTCTTCGGTCCATCAGCAGGCGCTCAATGCCCTGAACCCATCGGCGTACCCCCCCGCCTCGCAG
CCGGTGAACGGCTCGTCCCTGCCCTTCTCGCTACCTCAGATGGCCGGTCAGGGCGCCCAGCAGCCGGCGGCGTTG
GCCGCCGCGACGAATGCGGCTCTCAACCCATACGCCGCCGCCGCTTCGACGCCGGCCGCCACTGCCGGAGGACTC
GGCCTCGACTCAAATACGCAGCAGCAGATCATGCTGATCAAGGCCCTCGCGGACCAGGGCGTGCCTTTCGACAAG
ATACCCGCCCTGATCCAGAGCATGACTGGCGCCGCCAGCGCCAACGCGCAGGCCGCCTTTCAGCCGCCCGTGCCG
GCCGCCCAAGGGACCTTCTCGACGGCGCAGCAGGCGTGGGGGGCGAACACGGCCCACGGCTTCCAAGACGGCACG
AGATCGCCCAGCAGATACCAGGGACGCTCCCGATCCCGCTCTCCCGACCGCGGCTGGGGCTCACGCGGATCCCCT
CGCAACGGGGGGGCGCATGACGGGCTCGACCACAACCATCACGAGGAGCGCGAGCGCGGCGGCCGCCGGGGCAAT
GGCTACCGGCAGCGGAGCCCACAGGGGCGCCGGGCTCGCAGCGCCTCCCCACCGTCCGAGTTCCCCCATATAGAG
AGATGGGTCGAGTGGGATCCAACGCTGCCGGCGGGCCACATCAGGGTGCTGAGCCGAACGCTCTTTGTTGGGGGA
GTGACATGCAGCGAGGCGGACCTGCGCAAGATCTTCAGCCGTTACGGCACGGTTCAGACGTGCATCGTGAATAAG
GAGAAGCGACACGCGTTTGTCAAGATGCTGACGCGCAAGGATGCGGTGCATGCCAAGGACAGCACGGAAGACACC
AGGAACCTGGAGCTGCCTCTTCGGACACGCTGGGGCGTCGGCTACGGCCCTCGGGACTGCAGCGACTACGCGACG
GGCATCAGCGTGATCCCGATCCACAAGCTTACCGAGGCGGACCGAAAGTGGATGCTGACGGCGCCCTACGGCGGC
AGCGGAGGACGGCCGATCGAGACGGGCATGTGCGTCGAGGAGCCAGACATTGAGATAGGGGCCGGGGTGTCGTCC
AAGGCGATCAGCCGGCGGATGCAGACGGACAAGGGCGGCAGCAACGGACCCAAGTCGACGCGGAATCGCGAGGAG
GAGTCGTCGGGCCGGGGACGTCGCGGGCGAGGGCGCGGCGAGCAGGCAGACAACGGGGCGGCAAGCCAACAACAA
CAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCAGCGGCGATGTCGGCCTTTGCCCCC
TTTGGCATGAACAGCCTGCCGAACGGCATCCCCAACTTCCCGACGGGGGGGTATGCGTTCCCGAACAGCGGTGCA
GGAAACGGAGCGTGA
Transcript >Hirsu2|7394
ATGCTCAACTTGAAACCTCCCGGAGTGTCGGGATCACGTATCACTAGCCTCACCTCACTCTGCGTCTCCAACATT
CAGTCCGAGTCCGTCCTGATCCAAAAAATATACACTCACTTCAAGAAGGCGCCCGGGACGCACAAGTTGGGGGTA
CTCTACGTAGTAGACTCTGTAACCCGGAAATGGCTCGAGCAAGCAAAGGCCCAAGGGCAGCCAGTAAACAGCTCT
GCACAGGACGGCACGTATGCCGCCGGCGTACACCGAGTGACGGAACTGATGCCCGTTTTGATGAATGACATTCTT
CAGTCTGCGCCCGAGGAGCAAAAGGAAAAGATCAAGAAGCTCCTTGACATCTGGGAGAAGGGCCAGACCTTCCCG
GCGCCGATGCTCGAGTCCTTCCGCCAAAAAATGAGTGCTCCGGCCCCAATGGCTGACTGCTTCGCCTTCGACCCA
GATGCTTCGACGACGCCCCCCGGCAGCCCTCCTCCCGGCGGCCCGCTGGCCGCCCTGCAAGACAGACCTCAGGCC
TCGACCACGCCGGCGGCCCCGAACGGCTCGTCCATTCTTGAAGCGCTCGCCAACATGGCGCGCCAGAACACGACG
GCGTCGACCAACAACAAGCCCGTCACGCCGACGCCCGCGGCGCCGTTCGGACTGCCGACCGGGGCCGTGCCACAG
CAGCCGGCGACGTCTTCGGTCCATCAGCAGGCGCTCAATGCCCTGAACCCATCGGCGTACCCCCCCGCCTCGCAG
CCGGTGAACGGCTCGTCCCTGCCCTTCTCGCTACCTCAGATGGCCGGTCAGGGCGCCCAGCAGCCGGCGGCGTTG
GCCGCCGCGACGAATGCGGCTCTCAACCCATACGCCGCCGCCGCTTCGACGCCGGCCGCCACTGCCGGAGGACTC
GGCCTCGACTCAAATACGCAGCAGCAGATCATGCTGATCAAGGCCCTCGCGGACCAGGGCGTGCCTTTCGACAAG
ATACCCGCCCTGATCCAGAGCATGACTGGCGCCGCCAGCGCCAACGCGCAGGCCGCCTTTCAGCCGCCCGTGCCG
GCCGCCCAAGGGACCTTCTCGACGGCGCAGCAGGCGTGGGGGGCGAACACGGCCCACGGCTTCCAAGACGGCACG
AGATCGCCCAGCAGATACCAGGGACGCTCCCGATCCCGCTCTCCCGACCGCGGCTGGGGCTCACGCGGATCCCCT
CGCAACGGGGGGGCGCATGACGGGCTCGACCACAACCATCACGAGGAGCGCGAGCGCGGCGGCCGCCGGGGCAAT
GGCTACCGGCAGCGGAGCCCACAGGGGCGCCGGGCTCGCAGCGCCTCCCCACCGTCCGAGTTCCCCCATATAGAG
AGATGGGTCGAGTGGGATCCAACGCTGCCGGCGGGCCACATCAGGGTGCTGAGCCGAACGCTCTTTGTTGGGGGA
GTGACATGCAGCGAGGCGGACCTGCGCAAGATCTTCAGCCGTTACGGCACGGTTCAGACGTGCATCGTGAATAAG
GAGAAGCGACACGCGTTTGTCAAGATGCTGACGCGCAAGGATGCGGTGCATGCCAAGGACAGCACGGAAGACACC
AGGAACCTGGAGCTGCCTCTTCGGACACGCTGGGGCGTCGGCTACGGCCCTCGGGACTGCAGCGACTACGCGACG
GGCATCAGCGTGATCCCGATCCACAAGCTTACCGAGGCGGACCGAAAGTGGATGCTGACGGCGCCCTACGGCGGC
AGCGGAGGACGGCCGATCGAGACGGGCATGTGCGTCGAGGAGCCAGACATTGAGATAGGGGCCGGGGTGTCGTCC
AAGGCGATCAGCCGGCGGATGCAGACGGACAAGGGCGGCAGCAACGGACCCAAGTCGACGCGGAATCGCGAGGAG
GAGTCGTCGGGCCGGGGACGTCGCGGGCGAGGGCGCGGCGAGCAGGCAGACAACGGGGCGGCAAGCCAACAACAA
CAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCAGCGGCGATGTCGGCCTTTGCCCCC
TTTGGCATGAACAGCCTGCCGAACGGCATCCCCAACTTCCCGACGGGGGGGTATGCGTTCCCGAACAGCGGTGCA
GGAAACGGAGCGTGA
Gene >Hirsu2|7394
ATGCTCAACTTGAAACCTCCCGGAGTGTCGGGATCACGTATCACTAGCCTCACCTCACTCTGCGTCTCCAACATT
CAGGTATGCAACGTCCGCTTCGTCTTGCCGGCCGTCCGCCCCGCGCTGACCAACGGCCGTACAGTCCGAGTCCGT
CCTGATCCAAAAAATATACACTCACTTCAAGAAGGCGCCCGGGACGCACAAGTTGGGGGTACTCTACGTAGTAGA
CTCTGTAACCCGGAAATGGCTCGAGCAAGCAAAGGCCCAAGGGCAGCCAGTAAACAGCTCTGCACAGGACGGCAC
GTATGCCGCCGGCGTACACCGAGTGACGGAACTGATGCCCGTTTTGATGAATGACATTCTTCAGTCTGCGCCCGA
GGAGCAAAAGGTACGCATCTTATTTTCCGATGACCACACTCCCAGATGCTCTGCCTCGTAGCAGTATCCCTCTGT
CGGCCGCTGGCCAGCCGCGTGCGACTCTTGGCCACGAAGACGTCTCTTCAACGCCGTCGTCGCCATCCTCGTGTC
TCGCGCCCAGCCCTCGTGGGTCGGCGTCGCAATCGAGAGATGCAAGATGACCGACGCGACGCGCCAGTCAGCCCG
TCATGGAACTCGTTCCCTCGTTGGCACACTAGCATCCATGTCCGGAGTACAGTGACTTACCAGACGACTCGCCGT
GTAGGAAAAGATCAAGAAGCTCCTTGACATCTGGGAGAAGGGCCAGACCTTCCCGGCGCCGATGCTCGAGTCCTT
CCGCCAAAAAATGAGTGCTCCGGCCCCAAGTATGTTGTCCTCGGCTCCTGTCCTCCCAGCTGCCTCGACCAGGCC
CAGGCCGTGGTGCCGGTCGAGCCGCCGCGCGCCGTGTCCAGTGGCTGACTGCTTCGCCTTCGACCCAGATGCTTC
GACGACGCCCCCCGGCAGCCCTCCTCCCGGCGGCCCGCTGGCCGCCCTGCAAGACAGACCTCAGGCCTCGACCAC
GCCGGCGGCCCCGAACGGCTCGTCCATTCTTGAAGCGCTCGCCAACATGGCGCGCCAGAACACGACGGCGTCGAC
CAACAACAAGCCCGTCACGCCGACGCCCGCGGCGCCGTTCGGACTGCCGACCGGGGCCGTGCCACAGCAGCCGGC
GACGTCTTCGGTCCATCAGCAGGCGCTCAATGCCCTGAACCCATCGGCGTACCCCCCCGCCTCGCAGCCGGTGAA
CGGCTCGTCCCTGCCCTTCTCGCTACCTCAGATGGCCGGTCAGGGCGCCCAGCAGCCGGCGGCGTTGGCCGCCGC
GACGAATGCGGCTCTCAACCCATACGCCGCCGCCGCTTCGACGCCGGCCGCCACTGCCGGAGGACTCGGCCTCGA
CTCAAATACGCAGCAGCAGATCATGCTGATCAAGGCCCTCGCGGACCAGGGCGTGCCTTTCGACAAGATACCCGC
CCTGATCCAGAGCATGACTGGCGCCGCCAGCGCCAACGCGCAGGCCGCCTTTCAGCCGCCCGTGCCGGCCGCCCA
AGGGACCTTCTCGACGGCGCAGCAGGCGTGGGGGGCGAACACGGCCCACGGCTTCCAAGACGGCACGAGATCGCC
CAGCAGATACCAGGGACGCTCCCGATCCCGCTCTCCCGACCGCGGCTGGGGCTCACGCGGATCCCCTCGCAACGG
GGGGGCGCATGACGGGCTCGACCACAACCATCACGAGGAGCGCGAGCGCGGCGGCCGCCGGGGCAATGGCTACCG
GCAGCGGAGCCCACAGGGGCGCCGGGCTCGCAGCGCCTCCCCACCGTCCGAGTTCCCCCATATAGAGAGATGGGT
CGAGTGGGATCCAACGCTGCCGGCGGGCCACATCAGGGTGCTGAGCCGAACGCTCTTTGTTGGGGGAGTGACGTG
AGTATCCGGTCGTTGGCTTCCCCCTGCCGCGGACGAGCTGCTAACTAGGGCAACAGATGCAGCGAGGCGGACCTG
CGCAAGATCTTCAGCCGTTACGGCACGGTTCAGACGTGCATCGTGAATAAGGAGAAGCGACACGCGTTTGTCAAG
ATGCTGACGCGCAAGGATGCGGTGCATGCCAAGGACAGCACGGAAGACACCAGGAACCTGGAGCTGCCTCTTCGG
GTGAGTCTTGTCGGGTTCGGCCGGGAGAGGGGGAGAGGGAGGACGAGTGCTAACGGCGAGCTCGACAGACACGCT
GGGGCGTCGGCTACGGCCCTCGGGACTGCAGCGACTACGCGACGGGCATCAGCGTGATCCCGATCCACAAGCTTA
CCGAGGCGGACCGAAAGTGGATGCTGACGGCGCCCTACGGCGGCAGCGGAGGACGGCCGATCGAGACGGGCATGT
GCGTCGAGGAGCCAGACATTGAGATAGGGGCCGGGGTGTCGTCCAAGGCGATCAGCCGGCGGATGCAGACGGACA
AGGGCGGCAGCAACGGACCCAAGTCGACGCGGAATCGCGAGGAGGAGTCGTCGGGCCGGGGACGTCGCGGGCGAG
GGCGCGGCGAGCAGGCAGACAACGGGGCGGCAAGCCAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGC
AGCAGCAGCAGCAGCAGGCAGCGGCGATGTCGGCCTTTGCCCCCTTTGGCATGAACAGCCTGCCGAACGGCATCC
CCAACTTCCCGACGGGGGGGTATGCGTTCCCGAACAGCGGTGCAGGAAACGGAGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail