Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|739
Gene name
LocationContig_1150:639..1526
Strand-
Gene length (bp)887
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06916 FAM210A-B_dom FAM210A/B-like domain 5.7E-25 91 225

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9URV4|YBL7_SCHPO Uncharacterized protein C106.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC106.07c PE=4 SV=1 85 231 2.0E-21
sp|P37293|NAT2_YEAST N-terminal acetyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAT2 PE=1 SV=2 92 243 3.0E-17

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.0676 0.0966 0.0201 0.0672 0.9655 0.078 0.0293 0.0336 0.079 0.0297

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3787
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6179
Ophiocordyceps australis map64 (Brazil) OphauB2|4978
Ophiocordyceps camponoti-floridani Ophcf2|02119
Ophiocordyceps camponoti-rufipedis Ophun1|6517
Ophiocordyceps kimflemingae Ophio5|8122
Ophiocordyceps subramaniannii Hirsu2|739 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|739
MAEPVWGSIWRRFLASGARSSITDLGQWQRTAGGSRLLRNVARESAKRPTIGTCGNSTLRTQRRGFKFSAWRRQT
DGKGGKAPEKLSLGARLKKLSKEYGWSAVGVYLGLSVLDFPFCFLLVRIVGTETIGKIEHYVVSAIKRIVPESVR
NSWHEYWSSVRKAETQQLGNGDIGDKVEMAGWGVKEAQERNEEEASLATQLALAYAIHKSFIFIRVPLTAAVTPK
VVKVLRSWGWNIGKRGSR*
Coding >Hirsu2|739
ATGGCAGAACCAGTCTGGGGCAGCATCTGGAGACGATTTCTCGCCTCGGGGGCGAGAAGCTCAATCACGGACCTC
GGGCAATGGCAAAGAACGGCCGGTGGATCGCGACTGCTTCGAAACGTGGCACGCGAGAGCGCGAAGCGACCGACG
ATCGGAACGTGCGGCAACTCGACCCTGAGGACGCAAAGACGAGGCTTCAAATTTTCGGCGTGGAGGAGACAGACG
GACGGAAAGGGGGGCAAGGCTCCGGAGAAGCTGTCTCTGGGCGCCAGGTTGAAGAAGCTTTCCAAGGAATACGGC
TGGTCGGCGGTCGGCGTCTACCTCGGGCTCAGCGTGCTGGACTTTCCCTTTTGCTTTCTCCTCGTCAGGATCGTG
GGCACAGAGACGATCGGCAAGATCGAGCACTACGTGGTGTCGGCCATCAAGCGCATCGTCCCCGAGTCGGTACGG
AACAGCTGGCACGAGTACTGGAGTTCGGTCAGGAAGGCAGAGACGCAGCAGCTGGGCAACGGCGACATCGGTGAC
AAGGTGGAAATGGCCGGCTGGGGCGTGAAGGAGGCGCAGGAGCGGAACGAGGAAGAAGCCAGCCTAGCGACGCAA
CTGGCGCTCGCGTACGCCATCCACAAGAGCTTCATCTTCATCCGGGTGCCGCTGACGGCGGCGGTGACGCCCAAG
GTCGTCAAGGTGCTCAGGTCCTGGGGCTGGAACATCGGCAAGCGAGGCTCGCGATGA
Transcript >Hirsu2|739
ATGGCAGAACCAGTCTGGGGCAGCATCTGGAGACGATTTCTCGCCTCGGGGGCGAGAAGCTCAATCACGGACCTC
GGGCAATGGCAAAGAACGGCCGGTGGATCGCGACTGCTTCGAAACGTGGCACGCGAGAGCGCGAAGCGACCGACG
ATCGGAACGTGCGGCAACTCGACCCTGAGGACGCAAAGACGAGGCTTCAAATTTTCGGCGTGGAGGAGACAGACG
GACGGAAAGGGGGGCAAGGCTCCGGAGAAGCTGTCTCTGGGCGCCAGGTTGAAGAAGCTTTCCAAGGAATACGGC
TGGTCGGCGGTCGGCGTCTACCTCGGGCTCAGCGTGCTGGACTTTCCCTTTTGCTTTCTCCTCGTCAGGATCGTG
GGCACAGAGACGATCGGCAAGATCGAGCACTACGTGGTGTCGGCCATCAAGCGCATCGTCCCCGAGTCGGTACGG
AACAGCTGGCACGAGTACTGGAGTTCGGTCAGGAAGGCAGAGACGCAGCAGCTGGGCAACGGCGACATCGGTGAC
AAGGTGGAAATGGCCGGCTGGGGCGTGAAGGAGGCGCAGGAGCGGAACGAGGAAGAAGCCAGCCTAGCGACGCAA
CTGGCGCTCGCGTACGCCATCCACAAGAGCTTCATCTTCATCCGGGTGCCGCTGACGGCGGCGGTGACGCCCAAG
GTCGTCAAGGTGCTCAGGTCCTGGGGCTGGAACATCGGCAAGCGAGGCTCGCGATGA
Gene >Hirsu2|739
ATGGCAGAACCAGTCTGGGGCAGCATCTGGAGACGATTTCTCGCCTCGGGGGCGAGAAGCTCAATCACGGACCTC
GGGCAATGGCAAAGAACGGCCGGTGGATCGCGACTGCTTCGAAACGTGGCACGCGAGAGCGCGAAGCGACCGACG
ATCGGAACGTGCGGCAACTCGACCCTGAGGACGCAAAGACGAGGCTTCAAATTTTCGGCGTGGAGGAGACAGACG
GACGGAAAGGGGGGCAAGGCTCCGGAGAAGCTGTCTCTGGGCGCCAGGTTGAAGAAGCTTTCCAAGGAATACGGC
TGGTCGGCGGTCGGCGTCTACCTCGGGCTCAGCGTGCTGGACTTTCCCTTTTGCTTTCTCCTCGTCAGGATCGTG
GGCACAGAGACGATCGGTGAGCGCCGTCGGGCGGGAGGAAGGAGAGCGTGGTGGCAGCGGCTGACGGGCTGGCAA
CAGGCAAGATCGAGCACTACGTGGTGTCGGCCATCAAGCGCATCGTCCCCGAGTCGGTACGGAACAGCTGGCACG
AGTACTGGAGTTCGGTCAGGAAGGCAGAGACGCAGCAGCTGGGCAACGGCGACATCGGTGACAAGGTGGAAATGG
CCGGCTGGGGCGTGAAGGAGGCGCAGGAGCGGAACGAGGAAGAAGCCAGTAAGTCACGGCACGGGGCTCTACGAG
GCGTCGTCGACGTTGCGGTCTGGGGATCCGACGGCTAACGGGTTCGGGGGGCGGGGGTGGAAACAGGCCTAGCGA
CGCAACTGGCGCTCGCGTACGCCATCCACAAGAGCTTCATCTTCATCCGGGTGCCGCTGACGGCGGCGGTGACGC
CCAAGGTCGTCAAGGTGCTCAGGTCCTGGGGCTGGAACATCGGCAAGCGAGGCTCGCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail