Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7384
Gene name
LocationContig_427:2691..5706
Strand-
Gene length (bp)3015
Transcript length (bp)2961
Coding sequence length (bp)2961
Protein length (aa) 987

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00488 MutS_V MutS domain V 5.4E-70 772 963
PF05192 MutS_III MutS domain III 1.6E-48 367 716
PF01624 MutS_I MutS domain I 2.0E-20 77 188
PF05188 MutS_II MutS domain II 2.8E-08 233 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13921|MSH1_SCHPO MutS protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msh1 PE=3 SV=2 34 964 0.0E+00
sp|P25846|MSH1_YEAST DNA mismatch repair protein MSH1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH1 PE=1 SV=2 61 964 3.0E-163
sp|Q3YSJ8|MUTS_EHRCJ DNA mismatch repair protein MutS OS=Ehrlichia canis (strain Jake) GN=mutS PE=3 SV=1 73 963 5.0E-115
sp|Q07V29|MUTS_RHOP5 DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain BisA53) GN=mutS PE=3 SV=1 89 964 8.0E-114
sp|A1B095|MUTS_PARDP DNA mismatch repair protein MutS OS=Paracoccus denitrificans (strain Pd 1222) GN=mutS PE=3 SV=1 72 963 4.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13921|MSH1_SCHPO MutS protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msh1 PE=3 SV=2 34 964 0.0E+00
sp|P25846|MSH1_YEAST DNA mismatch repair protein MSH1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH1 PE=1 SV=2 61 964 3.0E-163
sp|Q3YSJ8|MUTS_EHRCJ DNA mismatch repair protein MutS OS=Ehrlichia canis (strain Jake) GN=mutS PE=3 SV=1 73 963 5.0E-115
sp|Q07V29|MUTS_RHOP5 DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain BisA53) GN=mutS PE=3 SV=1 89 964 8.0E-114
sp|A1B095|MUTS_PARDP DNA mismatch repair protein MutS OS=Paracoccus denitrificans (strain Pd 1222) GN=mutS PE=3 SV=1 72 963 4.0E-113
sp|Q2GJL7|MUTS_ANAPZ DNA mismatch repair protein MutS OS=Anaplasma phagocytophilum (strain HZ) GN=mutS PE=3 SV=1 73 964 9.0E-112
sp|Q2GG13|MUTS_EHRCR DNA mismatch repair protein MutS OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=mutS PE=3 SV=1 73 964 2.0E-111
sp|Q13ED0|MUTS_RHOPS DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain BisB5) GN=mutS PE=3 SV=1 53 964 3.0E-111
sp|P61673|MUTS_WOLPM DNA mismatch repair protein MutS OS=Wolbachia pipientis wMel GN=mutS PE=3 SV=1 73 963 6.0E-109
sp|Q68X73|MUTS_RICTY DNA mismatch repair protein MutS OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=mutS PE=3 SV=1 87 963 2.0E-108
sp|A8I275|MUTS_AZOC5 DNA mismatch repair protein MutS OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=mutS PE=3 SV=1 87 963 2.0E-108
sp|Q2J2S1|MUTS_RHOP2 DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain HaA2) GN=mutS PE=3 SV=1 89 964 8.0E-108
sp|C0R5H4|MUTS_WOLWR DNA mismatch repair protein MutS OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=mutS PE=3 SV=1 73 963 1.0E-107
sp|A8EZG1|MUTS_RICCK DNA mismatch repair protein MutS OS=Rickettsia canadensis (strain McKiel) GN=mutS PE=3 SV=1 87 963 3.0E-107
sp|Q1RJJ5|MUTS_RICBR DNA mismatch repair protein MutS OS=Rickettsia bellii (strain RML369-C) GN=mutS PE=3 SV=1 87 972 4.0E-107
sp|A8GX86|MUTS_RICB8 DNA mismatch repair protein MutS OS=Rickettsia bellii (strain OSU 85-389) GN=mutS PE=3 SV=1 87 972 1.0E-106
sp|Q5NL79|MUTS_ZYMMO DNA mismatch repair protein MutS OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=mutS PE=3 SV=2 87 964 2.0E-106
sp|Q9ZDM9|MUTS_RICPR DNA mismatch repair protein MutS OS=Rickettsia prowazekii (strain Madrid E) GN=mutS PE=3 SV=1 87 963 3.0E-106
sp|Q6G542|MUTS_BARHE DNA mismatch repair protein MutS OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=mutS PE=3 SV=1 87 972 5.0E-105
sp|Q2JT35|MUTS_SYNJA DNA mismatch repair protein MutS OS=Synechococcus sp. (strain JA-3-3Ab) GN=mutS PE=3 SV=1 68 964 1.0E-104
sp|A8GRI6|MUTS_RICRS DNA mismatch repair protein MutS OS=Rickettsia rickettsii (strain Sheila Smith) GN=mutS PE=3 SV=1 87 963 6.0E-103
sp|Q5LWH0|MUTS_RUEPO DNA mismatch repair protein MutS OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=mutS PE=3 SV=1 85 963 6.0E-103
sp|B0BWY8|MUTS_RICRO DNA mismatch repair protein MutS OS=Rickettsia rickettsii (strain Iowa) GN=mutS PE=3 SV=1 87 963 1.0E-102
sp|Q3A4F1|MUTS_PELCD DNA mismatch repair protein MutS OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mutS PE=3 SV=1 84 978 2.0E-102
sp|Q2JIA6|MUTS_SYNJB DNA mismatch repair protein MutS OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=mutS PE=3 SV=1 68 982 5.0E-102
sp|A5CDU2|MUTS_ORITB DNA mismatch repair protein MutS OS=Orientia tsutsugamushi (strain Boryong) GN=mutS PE=3 SV=1 88 963 7.0E-102
sp|B0CF30|MUTS_ACAM1 DNA mismatch repair protein MutS OS=Acaryochloris marina (strain MBIC 11017) GN=mutS PE=3 SV=1 85 963 8.0E-102
sp|A8F164|MUTS_RICM5 DNA mismatch repair protein MutS OS=Rickettsia massiliae (strain Mtu5) GN=mutS PE=3 SV=1 87 963 4.0E-101
sp|Q1D5J6|MUTS_MYXXD DNA mismatch repair protein MutS OS=Myxococcus xanthus (strain DK 1622) GN=mutS PE=3 SV=1 62 963 7.0E-101
sp|P61667|MUTS_GEOSL DNA mismatch repair protein MutS OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mutS PE=3 SV=1 87 973 2.0E-100
sp|A1AMW9|MUTS_PELPD DNA mismatch repair protein MutS OS=Pelobacter propionicus (strain DSM 2379) GN=mutS PE=3 SV=1 85 963 7.0E-100
sp|C3PN02|MUTS_RICAE DNA mismatch repair protein MutS OS=Rickettsia africae (strain ESF-5) GN=mutS PE=3 SV=1 87 963 1.0E-99
sp|Q92IL9|MUTS_RICCN DNA mismatch repair protein MutS OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mutS PE=3 SV=1 87 963 3.0E-99
sp|A8GMX2|MUTS_RICAH DNA mismatch repair protein MutS OS=Rickettsia akari (strain Hartford) GN=mutS PE=3 SV=1 87 963 5.0E-98
sp|B8CX98|MUTS_HALOH DNA mismatch repair protein MutS OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=mutS PE=3 SV=1 73 964 4.0E-97
sp|Q8RA71|MUTS_CALS4 DNA mismatch repair protein MutS OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mutS PE=3 SV=1 77 963 7.0E-97
sp|A9ILT1|MUTS_BART1 DNA mismatch repair protein MutS OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=mutS PE=3 SV=1 72 972 9.0E-97
sp|Q98C21|MUTS_RHILO DNA mismatch repair protein MutS OS=Rhizobium loti (strain MAFF303099) GN=mutS PE=3 SV=1 52 963 3.0E-96
sp|A6TR79|MUTS_ALKMQ DNA mismatch repair protein MutS OS=Alkaliphilus metalliredigens (strain QYMF) GN=mutS PE=3 SV=1 73 964 1.0E-95
sp|Q187T6|MUTS_PEPD6 DNA mismatch repair protein MutS OS=Peptoclostridium difficile (strain 630) GN=mutS PE=3 SV=2 83 963 1.0E-94
sp|A4SFT1|MUTS_CHLPM DNA mismatch repair protein MutS OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=mutS PE=3 SV=1 83 965 4.0E-94
sp|A6U5G0|MUTS_SINMW DNA mismatch repair protein MutS OS=Sinorhizobium medicae (strain WSM419) GN=mutS PE=3 SV=1 61 964 5.0E-94
sp|B0T142|MUTS_CAUSK DNA mismatch repair protein MutS OS=Caulobacter sp. (strain K31) GN=mutS PE=3 SV=1 73 963 6.0E-94
sp|Q67NK1|MUTS_SYMTH DNA mismatch repair protein MutS OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mutS PE=3 SV=1 68 964 1.0E-93
sp|Q31KZ2|MUTS_SYNE7 DNA mismatch repair protein MutS OS=Synechococcus elongatus (strain PCC 7942) GN=mutS PE=3 SV=1 89 964 1.0E-93
sp|Q5N0X9|MUTS_SYNP6 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=mutS PE=3 SV=1 89 964 2.0E-93
sp|Q3M892|MUTS_ANAVT DNA mismatch repair protein MutS OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mutS PE=3 SV=1 84 964 4.0E-93
sp|Q9AC54|MUTS_CAUCR DNA mismatch repair protein MutS OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=mutS PE=3 SV=1 68 963 6.0E-93
sp|A5I2S2|MUTS_CLOBH DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=mutS PE=3 SV=1 87 963 2.0E-92
sp|A7FUL0|MUTS_CLOB1 DNA mismatch repair protein MutS OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=mutS PE=3 SV=1 87 963 2.0E-92
sp|P56883|MUTS_RHIME DNA mismatch repair protein MutS OS=Rhizobium meliloti (strain 1021) GN=mutS PE=3 SV=1 61 964 4.0E-92
sp|A0B976|MUTS_METTP DNA mismatch repair protein MutS OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=mutS PE=3 SV=1 77 963 5.0E-92
sp|B9MJU0|MUTS_CALBD DNA mismatch repair protein MutS OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=mutS PE=3 SV=1 73 963 2.0E-91
sp|Q47WN0|MUTS_COLP3 DNA mismatch repair protein MutS OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=mutS PE=3 SV=1 85 961 2.0E-91
sp|Q97I19|MUTS_CLOAB DNA mismatch repair protein MutS OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=mutS PE=3 SV=1 87 963 4.0E-91
sp|B9LB04|MUTS_CHLSY DNA mismatch repair protein MutS OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=mutS PE=3 SV=1 73 964 1.0E-90
sp|A9WFZ9|MUTS_CHLAA DNA mismatch repair protein MutS OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=mutS PE=3 SV=1 73 964 1.0E-90
sp|C3KX35|MUTS_CLOB6 DNA mismatch repair protein MutS OS=Clostridium botulinum (strain 657 / Type Ba4) GN=mutS PE=3 SV=1 87 963 1.0E-90
sp|Q64MG7|MUTS_BACFR DNA mismatch repair protein MutS OS=Bacteroides fragilis (strain YCH46) GN=mutS PE=3 SV=1 87 963 1.0E-90
sp|Q5L7B7|MUTS_BACFN DNA mismatch repair protein MutS OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=mutS PE=3 SV=1 87 963 1.0E-90
sp|C6DZZ3|MUTS_GEOSM DNA mismatch repair protein MutS OS=Geobacter sp. (strain M21) GN=mutS PE=3 SV=1 87 973 1.0E-90
sp|B1KSA3|MUTS_CLOBM DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=mutS PE=3 SV=1 87 963 3.0E-90
sp|B1IM68|MUTS_CLOBK DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Okra / Type B1) GN=mutS PE=3 SV=1 87 963 6.0E-90
sp|A3DDI3|MUTS_CLOTH DNA mismatch repair protein MutS OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=mutS PE=3 SV=1 73 963 1.0E-89
sp|Q2S254|MUTS_SALRD DNA mismatch repair protein MutS OS=Salinibacter ruber (strain DSM 13855 / M31) GN=mutS PE=3 SV=1 77 963 1.0E-89
sp|Q7V978|MUTS_PROMM DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9313) GN=mutS PE=3 SV=1 89 964 1.0E-89
sp|Q8KCC0|MUTS_CHLTE DNA mismatch repair protein MutS OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mutS PE=3 SV=1 72 965 1.0E-89
sp|B3QPY5|MUTS_CHLP8 DNA mismatch repair protein MutS OS=Chlorobaculum parvum (strain NCIB 8327) GN=mutS PE=3 SV=1 72 965 2.0E-89
sp|B3EP11|MUTS_CHLPB DNA mismatch repair protein MutS OS=Chlorobium phaeobacteroides (strain BS1) GN=mutS PE=3 SV=1 84 965 2.0E-89
sp|B0JFY0|MUTS_MICAN DNA mismatch repair protein MutS OS=Microcystis aeruginosa (strain NIES-843) GN=mutS PE=3 SV=1 85 964 3.0E-89
sp|C0QFS1|MUTS_DESAH DNA mismatch repair protein MutS OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=mutS PE=3 SV=1 83 965 3.0E-89
sp|Q6MBV4|MUTS_PARUW DNA mismatch repair protein MutS OS=Protochlamydia amoebophila (strain UWE25) GN=mutS PE=3 SV=1 75 963 4.0E-89
sp|Q8DRW8|MUTS_STRMU DNA mismatch repair protein MutS OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=mutS PE=3 SV=1 76 964 4.0E-89
sp|A8AZU4|MUTS_STRGC DNA mismatch repair protein MutS OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=mutS PE=3 SV=1 76 963 4.0E-89
sp|Q8A334|MUTS_BACTN DNA mismatch repair protein MutS OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=mutS PE=3 SV=1 87 963 5.0E-89
sp|Q24X61|MUTS_DESHY DNA mismatch repair protein MutS OS=Desulfitobacterium hafniense (strain Y51) GN=mutS PE=3 SV=1 69 963 7.0E-89
sp|Q0AYB5|MUTS_SYNWW DNA mismatch repair protein MutS OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=mutS PE=3 SV=1 87 965 1.0E-88
sp|Q9PLD0|MUTS_CHLMU DNA mismatch repair protein MutS OS=Chlamydia muridarum (strain MoPn / Nigg) GN=mutS PE=3 SV=1 73 963 5.0E-88
sp|A6LG92|MUTS_PARD8 DNA mismatch repair protein MutS OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mutS PE=3 SV=1 87 963 5.0E-88
sp|A4W4J7|MUTS_STRS2 DNA mismatch repair protein MutS OS=Streptococcus suis (strain 98HAH33) GN=mutS PE=3 SV=1 76 963 6.0E-88
sp|B2J434|MUTS_NOSP7 DNA mismatch repair protein MutS OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=mutS PE=3 SV=1 84 964 7.0E-88
sp|Q8Y789|MUTS_LISMO DNA mismatch repair protein MutS OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mutS PE=3 SV=1 71 963 9.0E-88
sp|C0MGC5|MUTS_STRS7 DNA mismatch repair protein MutS OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=mutS PE=3 SV=1 76 963 1.0E-87
sp|C5D9H5|MUTS_GEOSW DNA mismatch repair protein MutS OS=Geobacillus sp. (strain WCH70) GN=mutS PE=3 SV=1 73 964 2.0E-87
sp|Q9KAC0|MUTS_BACHD DNA mismatch repair protein MutS OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mutS PE=3 SV=1 84 985 4.0E-87
sp|A6LWJ5|MUTS_CLOB8 DNA mismatch repair protein MutS OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=mutS PE=3 SV=1 74 965 4.0E-87
sp|A8ZXH5|MUTS_DESOH DNA mismatch repair protein MutS OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=mutS PE=3 SV=1 73 963 5.0E-87
sp|C0MAS5|MUTS_STRE4 DNA mismatch repair protein MutS OS=Streptococcus equi subsp. equi (strain 4047) GN=mutS PE=3 SV=1 76 963 6.0E-87
sp|C1L2V9|MUTS_LISMC DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=mutS PE=3 SV=1 71 963 1.0E-86
sp|B3EEE1|MUTS_CHLL2 DNA mismatch repair protein MutS OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=mutS PE=3 SV=1 84 965 1.0E-86
sp|Q9CDK9|MUTS_LACLA DNA mismatch repair protein MutS OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=mutS PE=3 SV=1 76 963 1.0E-86
sp|Q6AQ04|MUTS_DESPS DNA mismatch repair protein MutS OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=mutS PE=3 SV=1 77 980 1.0E-86
sp|P73769|MUTS_SYNY3 DNA mismatch repair protein MutS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mutS PE=3 SV=2 73 964 2.0E-86
sp|B0BAP7|MUTS_CHLTB DNA mismatch repair protein MutS OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=mutS PE=3 SV=1 73 963 3.0E-86
sp|B0B918|MUTS_CHLT2 DNA mismatch repair protein MutS OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=mutS PE=3 SV=1 73 963 3.0E-86
sp|Q71ZR7|MUTS_LISMF DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mutS PE=3 SV=1 71 963 4.0E-86
sp|B8DFS4|MUTS_LISMH DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=mutS PE=3 SV=1 71 963 7.0E-86
sp|Q92BV3|MUTS_LISIN DNA mismatch repair protein MutS OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mutS PE=3 SV=1 71 963 8.0E-86
sp|A1BHN5|MUTS_CHLPD DNA mismatch repair protein MutS OS=Chlorobium phaeobacteroides (strain DSM 266) GN=mutS PE=3 SV=1 84 965 8.0E-86
sp|O84797|MUTS_CHLTR DNA mismatch repair protein MutS OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=mutS PE=3 SV=1 73 963 9.0E-86
sp|Q3KKQ0|MUTS_CHLTA DNA mismatch repair protein MutS OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=mutS PE=3 SV=1 73 963 1.0E-85
sp|Q02VS3|MUTS_LACLS DNA mismatch repair protein MutS OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=mutS PE=3 SV=1 76 963 4.0E-85
sp|A2RP10|MUTS_LACLM DNA mismatch repair protein MutS OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=mutS PE=3 SV=1 76 963 6.0E-85
sp|A0AIK5|MUTS_LISW6 DNA mismatch repair protein MutS OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=mutS PE=3 SV=1 71 963 7.0E-85
sp|Q82ZA2|MUTS_ENTFA DNA mismatch repair protein MutS OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=mutS PE=3 SV=1 84 965 1.0E-84
sp|Q46CE2|MUTS_METBF DNA mismatch repair protein MutS OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=mutS PE=3 SV=1 75 963 2.0E-84
sp|Q11YS6|MUTS_CYTH3 DNA mismatch repair protein MutS OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=mutS PE=3 SV=1 84 964 3.0E-84
sp|Q0IE05|MUTS_SYNS3 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9311) GN=mutS PE=3 SV=1 89 963 4.0E-84
sp|Q3AQZ8|MUTS_CHLCH DNA mismatch repair protein MutS OS=Chlorobium chlorochromatii (strain CaD3) GN=mutS PE=3 SV=1 84 965 4.0E-84
sp|Q8CXG6|MUTS_OCEIH DNA mismatch repair protein MutS OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=mutS PE=3 SV=1 85 963 4.0E-84
sp|B8J008|MUTS_DESDA DNA mismatch repair protein MutS OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=mutS PE=3 SV=1 85 964 6.0E-84
sp|B0VUC9|MUTS_ACIBS DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain SDF) GN=mutS PE=3 SV=1 73 961 7.0E-84
sp|B0VAU7|MUTS_ACIBY DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain AYE) GN=mutS PE=3 SV=1 73 961 9.0E-84
sp|B2HX50|MUTS_ACIBC DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain ACICU) GN=mutS PE=3 SV=1 73 961 9.0E-84
sp|B7IBV9|MUTS_ACIB5 DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain AB0057) GN=mutS PE=3 SV=1 73 961 9.0E-84
sp|B7GW85|MUTS_ACIB3 DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain AB307-0294) GN=mutS PE=3 SV=1 73 961 9.0E-84
sp|A2C5T5|MUTS_PROM3 DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9303) GN=mutS PE=3 SV=1 89 964 1.0E-83
sp|Q31F87|MUTS_THICR DNA mismatch repair protein MutS OS=Thiomicrospira crunogena (strain XCL-2) GN=mutS PE=3 SV=1 85 961 1.0E-83
sp|P61671|MUTS_THET2 DNA mismatch repair protein MutS OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=mutS PE=3 SV=1 75 965 1.0E-83
sp|Q56239|MUTS_THET8 DNA mismatch repair protein MutS OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=mutS PE=1 SV=3 75 964 1.0E-83
sp|B1I9E5|MUTS_STRPI DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=mutS PE=3 SV=1 76 963 4.0E-83
sp|C1CTY2|MUTS_STRZT DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=mutS PE=3 SV=1 76 963 6.0E-83
sp|Q8Y093|MUTS_RALSO DNA mismatch repair protein MutS OS=Ralstonia solanacearum (strain GMI1000) GN=mutS PE=3 SV=1 87 964 6.0E-83
sp|Q3ACA5|MUTS_CARHZ DNA mismatch repair protein MutS OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mutS PE=3 SV=1 83 964 7.0E-83
sp|Q048Y4|MUTS_LACDB DNA mismatch repair protein MutS OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=mutS PE=3 SV=1 66 956 7.0E-83
sp|A6W1Q6|MUTS_MARMS DNA mismatch repair protein MutS OS=Marinomonas sp. (strain MWYL1) GN=mutS PE=3 SV=1 87 961 7.0E-83
sp|C1CN23|MUTS_STRZP DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain P1031) GN=mutS PE=3 SV=1 76 963 1.0E-82
sp|C1CH06|MUTS_STRZJ DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain JJA) GN=mutS PE=3 SV=1 76 963 1.0E-82
sp|B8ZPK0|MUTS_STRPJ DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=mutS PE=3 SV=1 76 963 1.0E-82
sp|C1CAQ5|MUTS_STRP7 DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain 70585) GN=mutS PE=3 SV=1 76 963 1.0E-82
sp|Q04I96|MUTS_STRP2 DNA mismatch repair protein MutS OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=mutS PE=3 SV=1 76 963 1.0E-82
sp|P0A3R4|HEXA_STRR6 DNA mismatch repair protein HexA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=hexA PE=3 SV=1 76 963 1.0E-82
sp|P0A3R3|HEXA_STRPN DNA mismatch repair protein HexA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=hexA PE=3 SV=1 76 963 1.0E-82
sp|Q2LUL3|MUTS_SYNAS DNA mismatch repair protein MutS OS=Syntrophus aciditrophicus (strain SB) GN=mutS PE=3 SV=1 87 963 1.0E-82
sp|Q5L0E5|MUTS_GEOKA DNA mismatch repair protein MutS OS=Geobacillus kaustophilus (strain HTA426) GN=mutS PE=3 SV=1 75 971 1.0E-82
sp|Q1G938|MUTS_LACDA DNA mismatch repair protein MutS OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=mutS PE=3 SV=1 66 952 2.0E-82
sp|A4IMI0|MUTS_GEOTN DNA mismatch repair protein MutS OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mutS PE=3 SV=1 69 976 2.0E-82
sp|Q5QUB6|MUTS_IDILO DNA mismatch repair protein MutS OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=mutS PE=3 SV=2 87 985 2.0E-82
sp|Q89AD3|MUTS_BUCBP DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mutS PE=3 SV=1 85 961 3.0E-82
sp|Q12VC9|MUTS_METBU DNA mismatch repair protein MutS OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=mutS PE=3 SV=1 77 963 4.0E-82
sp|B8I2Q5|MUTS_CLOCE DNA mismatch repair protein MutS OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=mutS PE=3 SV=1 73 977 5.0E-82
sp|Q03MY4|MUTS_STRTD DNA mismatch repair protein MutS OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=mutS PE=3 SV=1 76 963 7.0E-82
sp|P0DC61|MUTS_STRPQ DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=mutS PE=3 SV=1 76 963 7.0E-82
sp|P0DC60|MUTS_STRP3 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=mutS PE=3 SV=1 76 963 7.0E-82
sp|B2U9E4|MUTS_RALPJ DNA mismatch repair protein MutS OS=Ralstonia pickettii (strain 12J) GN=mutS PE=3 SV=1 87 964 7.0E-82
sp|Q5M6I1|MUTS_STRT2 DNA mismatch repair protein MutS OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=mutS PE=3 SV=1 76 963 8.0E-82
sp|A5GHU5|MUTS_SYNPW DNA mismatch repair protein MutS OS=Synechococcus sp. (strain WH7803) GN=mutS PE=3 SV=1 89 963 9.0E-82
sp|Q48QT6|MUTS_STRPM DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=mutS PE=3 SV=1 76 963 1.0E-81
sp|Q5M1Z0|MUTS_STRT1 DNA mismatch repair protein MutS OS=Streptococcus thermophilus (strain CNRZ 1066) GN=mutS PE=3 SV=1 76 963 1.0E-81
sp|Q99XL8|MUTS_STRP1 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M1 GN=mutS PE=3 SV=1 76 963 1.0E-81
sp|Q1JEH0|MUTS_STRPD DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=mutS PE=3 SV=1 76 963 2.0E-81
sp|B5XJ75|MUTS_STRPZ DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=mutS PE=3 SV=1 76 963 3.0E-81
sp|P61672|MUTS_TREDE DNA mismatch repair protein MutS OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=mutS PE=3 SV=1 84 963 4.0E-81
sp|Q2SBR5|MUTS_HAHCH DNA mismatch repair protein MutS OS=Hahella chejuensis (strain KCTC 2396) GN=mutS PE=3 SV=2 89 961 4.0E-81
sp|Q8NZ24|MUTS_STRP8 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=mutS PE=3 SV=1 76 963 5.0E-81
sp|A2RGX2|MUTS_STRPG DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=mutS PE=3 SV=1 76 963 5.0E-81
sp|Q5X9F3|MUTS_STRP6 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=mutS PE=3 SV=1 76 963 5.0E-81
sp|B8CJQ5|MUTS_SHEPW DNA mismatch repair protein MutS OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=mutS PE=3 SV=1 61 961 6.0E-81
sp|B2KB17|MUTS_ELUMP DNA mismatch repair protein MutS OS=Elusimicrobium minutum (strain Pei191) GN=mutS PE=3 SV=1 82 963 8.0E-81
sp|Q1JJH0|MUTS_STRPC DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=mutS PE=3 SV=1 76 963 9.0E-81
sp|Q1J9C1|MUTS_STRPB DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=mutS PE=3 SV=1 76 963 9.0E-81
sp|Q9JWT7|MUTS_NEIMA DNA mismatch repair protein MutS OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=mutS PE=3 SV=1 89 965 9.0E-81
sp|Q1LPG5|MUTS_CUPMC DNA mismatch repair protein MutS OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=mutS PE=3 SV=1 74 964 9.0E-81
sp|Q6FC54|MUTS_ACIAD DNA mismatch repair protein MutS OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=mutS PE=3 SV=1 70 961 1.0E-80
sp|Q3ZYA0|MUTS_DEHMC DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain CBDB1) GN=mutS PE=3 SV=1 83 963 1.0E-80
sp|Q3JQS6|MUTS_BURP1 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 1710b) GN=mutS PE=3 SV=2 77 964 1.0E-80
sp|Q8TTB4|MUTS_METAC DNA mismatch repair protein MutS OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=mutS PE=3 SV=1 77 963 2.0E-80
sp|Q9ZIX6|MUTS_THECA DNA mismatch repair protein MutS OS=Thermus caldophilus GN=mutS PE=3 SV=1 75 965 4.0E-80
sp|Q63SR9|MUTS_BURPS DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain K96243) GN=mutS PE=3 SV=1 77 964 5.0E-80
sp|Q38YR4|MUTS_LACSS DNA mismatch repair protein MutS OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=mutS PE=3 SV=1 84 963 7.0E-80
sp|A1KWM6|MUTS_NEIMF DNA mismatch repair protein MutS OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=mutS PE=3 SV=1 89 965 7.0E-80
sp|Q88UZ7|MUTS_LACPL DNA mismatch repair protein MutS OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=mutS PE=3 SV=1 77 965 7.0E-80
sp|B3W9W4|MUTS_LACCB DNA mismatch repair protein MutS OS=Lactobacillus casei (strain BL23) GN=mutS PE=3 SV=1 73 963 9.0E-80
sp|A1V5I2|MUTS_BURMS DNA mismatch repair protein MutS OS=Burkholderia mallei (strain SAVP1) GN=mutS PE=3 SV=2 77 964 1.0E-79
sp|Q62J26|MUTS_BURMA DNA mismatch repair protein MutS OS=Burkholderia mallei (strain ATCC 23344) GN=mutS PE=3 SV=1 77 964 1.0E-79
sp|A2SAW7|MUTS_BURM9 DNA mismatch repair protein MutS OS=Burkholderia mallei (strain NCTC 10229) GN=mutS PE=3 SV=2 77 964 1.0E-79
sp|A3ML57|MUTS_BURM7 DNA mismatch repair protein MutS OS=Burkholderia mallei (strain NCTC 10247) GN=mutS PE=3 SV=2 77 964 1.0E-79
sp|B5E385|MUTS_STRP4 DNA mismatch repair protein MutS OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=mutS PE=3 SV=1 76 963 1.0E-79
sp|B9EBI4|MUTS_MACCJ DNA mismatch repair protein MutS OS=Macrococcus caseolyticus (strain JCSC5402) GN=mutS PE=3 SV=1 72 963 1.0E-79
sp|A3CR17|MUTS_STRSV DNA mismatch repair protein MutS OS=Streptococcus sanguinis (strain SK36) GN=mutS PE=3 SV=1 76 976 1.0E-79
sp|B6ENH6|MUTS_ALISL DNA mismatch repair protein MutS OS=Aliivibrio salmonicida (strain LFI1238) GN=mutS PE=3 SV=1 87 961 2.0E-79
sp|Q035Z2|MUTS_LACC3 DNA mismatch repair protein MutS OS=Lactobacillus casei (strain ATCC 334) GN=mutS PE=3 SV=1 73 963 2.0E-79
sp|Q2SXA6|MUTS_BURTA DNA mismatch repair protein MutS OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=mutS PE=3 SV=1 89 964 3.0E-79
sp|A3NWZ4|MUTS_BURP0 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 1106a) GN=mutS PE=3 SV=2 77 961 3.0E-79
sp|Q8PWA7|MUTS_METMA DNA mismatch repair protein MutS OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=mutS PE=3 SV=1 77 963 8.0E-79
sp|Q03VV4|MUTS_LEUMM DNA mismatch repair protein MutS OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=mutS PE=3 SV=1 84 965 1.0E-78
sp|Q03R33|MUTS_LACBA DNA mismatch repair protein MutS OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=mutS PE=3 SV=1 73 963 1.0E-78
sp|A6VL76|MUTS_ACTSZ DNA mismatch repair protein MutS OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=mutS PE=3 SV=1 87 964 2.0E-78
sp|Q30ZX3|MUTS_DESAG DNA mismatch repair protein MutS OS=Desulfovibrio alaskensis (strain G20) GN=mutS PE=3 SV=1 73 963 2.0E-78
sp|A5FQC0|MUTS_DEHMB DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=mutS PE=3 SV=1 83 963 2.0E-78
sp|Q8RFK2|MUTS_FUSNN DNA mismatch repair protein MutS OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=mutS PE=3 SV=1 73 963 4.0E-78
sp|A9GIM9|MUTS_SORC5 DNA mismatch repair protein MutS OS=Sorangium cellulosum (strain So ce56) GN=mutS PE=3 SV=1 63 964 5.0E-78
sp|Q2YB94|MUTS_NITMU DNA mismatch repair protein MutS OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=mutS PE=3 SV=1 87 963 9.0E-78
sp|B1N025|MUTS_LEUCK DNA mismatch repair protein MutS OS=Leuconostoc citreum (strain KM20) GN=mutS PE=3 SV=1 84 963 1.0E-77
sp|C1DSR1|MUTS_AZOVD DNA mismatch repair protein MutS OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=mutS PE=3 SV=1 77 964 3.0E-77
sp|C4L191|MUTS_EXISA DNA mismatch repair protein MutS OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=mutS PE=3 SV=1 85 964 3.0E-77
sp|B1YMD7|MUTS_EXIS2 DNA mismatch repair protein MutS OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=mutS PE=3 SV=1 68 964 5.0E-77
sp|Q82U08|MUTS_NITEU DNA mismatch repair protein MutS OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=mutS PE=3 SV=1 68 964 5.0E-77
sp|A8H1T4|MUTS_SHEPA DNA mismatch repair protein MutS OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=mutS PE=3 SV=1 87 960 5.0E-77
sp|A5EX62|MUTS_DICNV DNA mismatch repair protein MutS OS=Dichelobacter nodosus (strain VCS1703A) GN=mutS PE=3 SV=1 73 959 8.0E-77
sp|B0TK13|MUTS_SHEHH DNA mismatch repair protein MutS OS=Shewanella halifaxensis (strain HAW-EB4) GN=mutS PE=3 SV=1 87 960 1.0E-76
sp|Q7UA23|MUTS_SYNPX DNA mismatch repair protein MutS OS=Synechococcus sp. (strain WH8102) GN=mutS PE=3 SV=1 89 963 1.0E-76
sp|C0PWV2|MUTS_SALPC DNA mismatch repair protein MutS OS=Salmonella paratyphi C (strain RKS4594) GN=mutS PE=3 SV=1 88 961 1.0E-76
sp|Q7NRW7|MUTS_CHRVO DNA mismatch repair protein MutS OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=mutS PE=3 SV=1 63 964 2.0E-76
sp|B5FAC8|MUTS_VIBFM DNA mismatch repair protein MutS OS=Vibrio fischeri (strain MJ11) GN=mutS PE=3 SV=1 87 961 2.0E-76
sp|Q3ANH5|MUTS_SYNSC DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9605) GN=mutS PE=3 SV=1 89 963 3.0E-76
sp|P27345|MUTS_AZOVI DNA mismatch repair protein MutS OS=Azotobacter vinelandii GN=mutS PE=3 SV=1 77 964 4.0E-76
sp|A4VJN9|MUTS_PSEU5 DNA mismatch repair protein MutS OS=Pseudomonas stutzeri (strain A1501) GN=mutS PE=3 SV=2 70 959 8.0E-76
sp|Q1H2P1|MUTS_METFK DNA mismatch repair protein MutS OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=mutS1 PE=3 SV=1 84 983 9.0E-76
sp|Q1WT15|MUTS_LACS1 DNA mismatch repair protein MutS OS=Lactobacillus salivarius (strain UCC118) GN=mutS PE=3 SV=1 66 963 9.0E-76
sp|A8ANU8|MUTS_CITK8 DNA mismatch repair protein MutS OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mutS PE=3 SV=1 88 961 2.0E-75
sp|Q03EQ7|MUTS_PEDPA DNA mismatch repair protein MutS OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=mutS PE=3 SV=1 84 963 2.0E-75
sp|Q5PEE6|MUTS_SALPA DNA mismatch repair protein MutS OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mutS PE=3 SV=1 88 961 2.0E-75
sp|Q13X51|MUTS_BURXL DNA mismatch repair protein MutS OS=Burkholderia xenovorans (strain LB400) GN=mutS PE=3 SV=2 89 964 3.0E-75
sp|B0TX99|MUTS_FRAP2 DNA mismatch repair protein MutS OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=mutS PE=3 SV=1 67 965 3.0E-75
sp|Q48F92|MUTS_PSE14 DNA mismatch repair protein MutS OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mutS PE=3 SV=1 77 961 4.0E-75
sp|Q12PY3|MUTS_SHEDO DNA mismatch repair protein MutS OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=mutS PE=3 SV=1 89 960 4.0E-75
sp|Q4ZWP5|MUTS_PSEU2 DNA mismatch repair protein MutS OS=Pseudomonas syringae pv. syringae (strain B728a) GN=mutS PE=3 SV=1 70 961 4.0E-75
sp|Q87XW6|MUTS_PSESM DNA mismatch repair protein MutS OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mutS PE=3 SV=1 77 961 1.0E-74
sp|C0QPF0|MUTS_PERMH DNA mismatch repair protein MutS OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=mutS PE=3 SV=1 67 963 1.0E-74
sp|P0A1Y0|MUTS_SALTY DNA mismatch repair protein MutS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mutS PE=1 SV=1 88 961 2.0E-74
sp|P0A1Y1|MUTS_SALTI DNA mismatch repair protein MutS OS=Salmonella typhi GN=mutS PE=3 SV=1 88 961 2.0E-74
sp|A9N1F8|MUTS_SALPB DNA mismatch repair protein MutS OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mutS PE=3 SV=2 88 961 2.0E-74
sp|B4TFU6|MUTS_SALHS DNA mismatch repair protein MutS OS=Salmonella heidelberg (strain SL476) GN=mutS PE=3 SV=1 88 961 2.0E-74
sp|B5RDN2|MUTS_SALG2 DNA mismatch repair protein MutS OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mutS PE=3 SV=1 88 961 2.0E-74
sp|Q57KL5|MUTS_SALCH DNA mismatch repair protein MutS OS=Salmonella choleraesuis (strain SC-B67) GN=mutS PE=3 SV=1 88 961 2.0E-74
sp|B5F3Y8|MUTS_SALA4 DNA mismatch repair protein MutS OS=Salmonella agona (strain SL483) GN=mutS PE=3 SV=1 88 961 2.0E-74
sp|Q88ME7|MUTS_PSEPK DNA mismatch repair protein MutS OS=Pseudomonas putida (strain KT2440) GN=mutS PE=3 SV=1 70 961 2.0E-74
sp|Q3B0S2|MUTS_SYNS9 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9902) GN=mutS PE=3 SV=1 89 963 3.0E-74
sp|B0KSD2|MUTS_PSEPG DNA mismatch repair protein MutS OS=Pseudomonas putida (strain GB-1) GN=mutS PE=3 SV=2 70 961 3.0E-74
sp|B1KPS7|MUTS_SHEWM DNA mismatch repair protein MutS OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=mutS PE=3 SV=1 87 956 3.0E-74
sp|A6V1G8|MUTS_PSEA7 DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain PA7) GN=mutS PE=3 SV=1 89 961 4.0E-74
sp|A5W816|MUTS_PSEP1 DNA mismatch repair protein MutS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=mutS PE=3 SV=1 77 961 4.0E-74
sp|B4TTU0|MUTS_SALSV DNA mismatch repair protein MutS OS=Salmonella schwarzengrund (strain CVM19633) GN=mutS PE=3 SV=1 88 961 5.0E-74
sp|B4T436|MUTS_SALNS DNA mismatch repair protein MutS OS=Salmonella newport (strain SL254) GN=mutS PE=3 SV=1 88 961 6.0E-74
sp|B7V8C8|MUTS_PSEA8 DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain LESB58) GN=mutS PE=3 SV=1 89 961 6.0E-74
sp|Q02R92|MUTS_PSEAB DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mutS PE=3 SV=1 89 961 6.0E-74
sp|Q9HY08|MUTS_PSEAE DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mutS PE=3 SV=1 89 961 7.0E-74
sp|B1JB25|MUTS_PSEPW DNA mismatch repair protein MutS OS=Pseudomonas putida (strain W619) GN=mutS PE=3 SV=1 70 961 8.0E-74
sp|A1K764|MUTS_AZOSB DNA mismatch repair protein MutS OS=Azoarcus sp. (strain BH72) GN=mutS PE=3 SV=2 77 952 3.0E-73
sp|Q0KCC0|MUTS_CUPNH DNA mismatch repair protein MutS OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=mutS PE=3 SV=1 87 964 3.0E-73
sp|Q65QA9|MUTS_MANSM DNA mismatch repair protein MutS OS=Mannheimia succiniciproducens (strain MBEL55E) GN=mutS PE=3 SV=1 87 965 3.0E-73
sp|Q7V9M5|MUTS_PROMA DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=mutS PE=3 SV=1 89 963 3.0E-73
sp|P61668|MUTS_LACJO DNA mismatch repair protein MutS OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=mutS PE=3 SV=1 77 963 4.0E-73
sp|Q1I659|MUTS_PSEE4 DNA mismatch repair protein MutS OS=Pseudomonas entomophila (strain L48) GN=mutS PE=3 SV=1 70 961 5.0E-73
sp|Q3IUH3|MUTS_NATPD DNA mismatch repair protein MutS OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=mutS PE=3 SV=1 84 965 7.0E-73
sp|C3KCT2|MUTS_PSEFS DNA mismatch repair protein MutS OS=Pseudomonas fluorescens (strain SBW25) GN=mutS PE=3 SV=1 77 961 8.0E-73
sp|Q5NEV8|MUTS_FRATT DNA mismatch repair protein MutS OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=mutS PE=3 SV=1 73 961 1.0E-72
sp|Q14GB1|MUTS_FRAT1 DNA mismatch repair protein MutS OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=mutS PE=3 SV=1 73 961 1.0E-72
sp|A3QC86|MUTS_SHELP DNA mismatch repair protein MutS OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=mutS PE=3 SV=1 87 960 1.0E-72
sp|Q4KHE3|MUTS_PSEF5 DNA mismatch repair protein MutS OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mutS PE=3 SV=1 77 961 2.0E-72
sp|A8LPD4|MUTS_DINSH DNA mismatch repair protein MutS OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=mutS PE=3 SV=1 614 971 2.0E-72
sp|Q87LQ9|MUTS_VIBPA DNA mismatch repair protein MutS OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mutS PE=3 SV=1 89 959 1.0E-71
sp|Q89VX1|MUTS_BRADU DNA mismatch repair protein MutS OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mutS PE=3 SV=1 681 964 8.0E-70
sp|Q1QQJ4|MUTS_NITHX DNA mismatch repair protein MutS OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=mutS PE=3 SV=1 614 964 3.0E-69
sp|Q3SVD4|MUTS_NITWN DNA mismatch repair protein MutS OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=mutS PE=3 SV=1 614 964 4.0E-69
sp|Q28VY6|MUTS_JANSC DNA mismatch repair protein MutS OS=Jannaschia sp. (strain CCS1) GN=mutS PE=3 SV=1 614 963 5.0E-69
sp|Q3KH79|MUTS_PSEPF DNA mismatch repair protein MutS OS=Pseudomonas fluorescens (strain Pf0-1) GN=mutS PE=3 SV=1 77 956 7.0E-69
sp|Q1GCK9|MUTS_RUEST DNA mismatch repair protein MutS OS=Ruegeria sp. (strain TM1040) GN=mutS PE=3 SV=1 608 970 1.0E-68
sp|A0KU91|MUTS_SHESA DNA mismatch repair protein MutS OS=Shewanella sp. (strain ANA-3) GN=mutS PE=3 SV=1 87 960 1.0E-68
sp|A4WVX8|MUTS_RHOS5 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=mutS PE=3 SV=1 614 963 1.0E-68
sp|B1LAW3|MUTS_THESQ DNA mismatch repair protein MutS OS=Thermotoga sp. (strain RQ2) GN=mutS PE=3 SV=1 77 963 4.0E-68
sp|Q3IYI5|MUTS_RHOS4 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mutS PE=3 SV=1 614 971 5.0E-68
sp|A1S4E6|MUTS_SHEAM DNA mismatch repair protein MutS OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=mutS PE=3 SV=1 87 960 6.0E-68
sp|A4YKQ0|MUTS_BRASO DNA mismatch repair protein MutS OS=Bradyrhizobium sp. (strain ORS278) GN=mutS PE=3 SV=1 681 964 8.0E-68
sp|Q8UIF2|MUTS_AGRFC DNA mismatch repair protein MutS OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mutS PE=3 SV=1 617 963 9.0E-68
sp|Q0HXG1|MUTS_SHESR DNA mismatch repair protein MutS OS=Shewanella sp. (strain MR-7) GN=mutS PE=3 SV=1 87 960 9.0E-68
sp|A5ETJ3|MUTS_BRASB DNA mismatch repair protein MutS OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mutS PE=3 SV=1 681 964 1.0E-67
sp|Q21CE8|MUTS_RHOPB DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain BisB18) GN=mutS PE=3 SV=2 681 964 1.0E-67
sp|A3PNR5|MUTS_RHOS1 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mutS PE=3 SV=1 614 971 3.0E-67
sp|A6WV86|MUTS_OCHA4 DNA mismatch repair protein MutS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mutS PE=3 SV=1 608 963 3.0E-67
sp|Q2N5V9|MUTS_ERYLH DNA mismatch repair protein MutS OS=Erythrobacter litoralis (strain HTCC2594) GN=mutS PE=3 SV=1 590 985 7.0E-67
sp|Q4UM86|MUTS_RICFE DNA mismatch repair protein MutS OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mutS PE=3 SV=1 570 963 2.0E-66
sp|Q2KWZ4|MUTS_BORA1 DNA mismatch repair protein MutS OS=Bordetella avium (strain 197N) GN=mutS PE=3 SV=1 89 961 6.0E-66
sp|Q0AK91|MUTS_MARMM DNA mismatch repair protein MutS OS=Maricaulis maris (strain MCS10) GN=mutS PE=3 SV=1 608 964 7.0E-66
sp|Q11B27|MUTS_CHESB DNA mismatch repair protein MutS OS=Chelativorans sp. (strain BNC1) GN=mutS PE=3 SV=1 608 963 1.0E-65
sp|A5ILG0|MUTS_THEP1 DNA mismatch repair protein MutS OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=mutS PE=3 SV=1 77 963 1.0E-65
sp|P61670|MUTS_RHOPA DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mutS PE=3 SV=1 699 964 1.0E-65
sp|A7HZ64|MUTS_PARL1 DNA mismatch repair protein MutS OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=mutS PE=3 SV=1 658 968 1.0E-65
sp|A5VN83|MUTS_BRUO2 DNA mismatch repair protein MutS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=mutS PE=3 SV=1 614 963 1.0E-65
sp|Q8YES6|MUTS_BRUME DNA mismatch repair protein MutS OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mutS PE=3 SV=2 614 963 1.0E-65
sp|Q16D05|MUTS_ROSDO DNA mismatch repair protein MutS OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=mutS PE=3 SV=1 617 963 2.0E-65
sp|Q57FM9|MUTS_BRUAB DNA mismatch repair protein MutS OS=Brucella abortus biovar 1 (strain 9-941) GN=mutS PE=3 SV=1 614 963 2.0E-65
sp|Q2YNZ0|MUTS_BRUA2 DNA mismatch repair protein MutS OS=Brucella abortus (strain 2308) GN=mutS PE=3 SV=1 614 963 2.0E-65
sp|B0CIQ5|MUTS_BRUSI DNA mismatch repair protein MutS OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=mutS PE=3 SV=1 614 963 2.0E-65
sp|Q0C5G6|MUTS_HYPNA DNA mismatch repair protein MutS OS=Hyphomonas neptunium (strain ATCC 15444) GN=mutS PE=3 SV=1 607 963 3.0E-65
sp|Q6G0X1|MUTS_BARQU DNA mismatch repair protein MutS OS=Bartonella quintana (strain Toulouse) GN=mutS PE=3 SV=1 658 972 5.0E-65
sp|Q8G310|MUTS_BRUSU DNA mismatch repair protein MutS OS=Brucella suis biovar 1 (strain 1330) GN=mutS PE=3 SV=1 614 963 6.0E-65
sp|A9M792|MUTS_BRUC2 DNA mismatch repair protein MutS OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mutS PE=3 SV=1 614 963 6.0E-65
sp|Q1MMA5|MUTS_RHIL3 DNA mismatch repair protein MutS OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=mutS PE=3 SV=1 614 963 6.0E-65
sp|Q2KD76|MUTS_RHIEC DNA mismatch repair protein MutS OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=mutS PE=3 SV=1 614 963 7.0E-65
sp|Q7MXR7|MUTS_PORGI DNA mismatch repair protein MutS OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=mutS PE=3 SV=1 57 963 2.0E-64
sp|A1UU95|MUTS_BARBK DNA mismatch repair protein MutS OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=mutS PE=3 SV=1 658 963 2.0E-64
sp|Q4FV41|MUTS_PSYA2 DNA mismatch repair protein MutS OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=mutS PE=3 SV=1 84 963 2.0E-64
sp|Q39VR6|MUTS_GEOMG DNA mismatch repair protein MutS OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mutS PE=3 SV=1 608 973 7.0E-64
sp|Q5FHE8|MUTS_EHRRG DNA mismatch repair protein MutS OS=Ehrlichia ruminantium (strain Gardel) GN=mutS PE=3 SV=1 607 963 9.0E-64
sp|Q5HBQ7|MUTS_EHRRW DNA mismatch repair protein MutS OS=Ehrlichia ruminantium (strain Welgevonden) GN=mutS PE=3 SV=1 607 963 1.0E-63
sp|B5YJY3|MUTS_THEYD DNA mismatch repair protein MutS OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mutS PE=3 SV=1 608 963 1.0E-63
sp|B3E6P2|MUTS_GEOLS DNA mismatch repair protein MutS OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=mutS PE=3 SV=1 608 963 2.0E-63
sp|B3CQY2|MUTS_ORITI DNA mismatch repair protein MutS OS=Orientia tsutsugamushi (strain Ikeda) GN=mutS PE=3 SV=1 578 963 2.0E-63
sp|Q2IIJ3|MUTS_ANADE DNA mismatch repair protein MutS OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=mutS PE=3 SV=1 608 963 2.0E-63
sp|Q18FJ9|MUTS_HALWD DNA mismatch repair protein MutS OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=mutS PE=3 SV=1 87 963 4.0E-63
sp|B8JA66|MUTS_ANAD2 DNA mismatch repair protein MutS OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=mutS PE=3 SV=1 608 963 4.0E-63
sp|O74502|MSH6_SCHPO DNA mismatch repair protein msh6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msh6 PE=1 SV=1 77 961 7.0E-63
sp|B0S1C1|MUTS_FINM2 DNA mismatch repair protein MutS OS=Finegoldia magna (strain ATCC 29328) GN=mutS PE=3 SV=1 582 963 7.0E-63
sp|B4UCY7|MUTS_ANASK DNA mismatch repair protein MutS OS=Anaeromyxobacter sp. (strain K) GN=mutS PE=3 SV=1 608 963 1.0E-62
sp|A5G447|MUTS_GEOUR DNA mismatch repair protein MutS OS=Geobacter uraniireducens (strain Rf4) GN=mutS PE=3 SV=1 617 977 2.0E-62
sp|Q2WAN4|MUTS_MAGSA DNA mismatch repair protein MutS OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mutS PE=3 SV=2 567 963 8.0E-62
sp|Q0BV38|MUTS_GRABC DNA mismatch repair protein MutS OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=mutS PE=3 SV=1 608 963 9.0E-62
sp|A5VA00|MUTS_SPHWW DNA mismatch repair protein MutS OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=mutS PE=3 SV=1 589 975 1.0E-61
sp|B2S2S5|MUTS_TREPS DNA mismatch repair protein MutS OS=Treponema pallidum subsp. pallidum (strain SS14) GN=mutS PE=3 SV=1 570 963 1.0E-60
sp|O83348|MUTS_TREPA DNA mismatch repair protein MutS OS=Treponema pallidum (strain Nichols) GN=mutS PE=3 SV=1 570 963 1.0E-60
sp|Q1IN52|MUTS_KORVE DNA mismatch repair protein MutS OS=Koribacter versatilis (strain Ellin345) GN=mutS PE=3 SV=1 578 963 1.0E-60
sp|A7HC64|MUTS_ANADF DNA mismatch repair protein MutS OS=Anaeromyxobacter sp. (strain Fw109-5) GN=mutS PE=3 SV=1 537 963 1.0E-60
sp|A9NGL6|MUTS_ACHLI DNA mismatch repair protein MutS OS=Acholeplasma laidlawii (strain PG-8A) GN=mutS PE=3 SV=1 71 973 2.0E-60
sp|Q7UP05|MUTS_RHOBA DNA mismatch repair protein MutS OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mutS PE=3 SV=1 681 964 2.0E-60
sp|Q87CI8|MUTS_XYLFT DNA mismatch repair protein MutS OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mutS PE=3 SV=1 607 964 2.0E-59
sp|A7GR99|MUTS_BACCN DNA mismatch repair protein MutS OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mutS PE=3 SV=1 607 964 2.0E-59
sp|O66652|MUTS_AQUAE DNA mismatch repair protein MutS OS=Aquifex aeolicus (strain VF5) GN=mutS PE=3 SV=1 607 963 3.0E-59
sp|Q2RNG0|MUTS_RHORT DNA mismatch repair protein MutS OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mutS PE=3 SV=1 658 964 3.0E-59
sp|C1FNT9|MUTS_CLOBJ DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Kyoto / Type A2) GN=mutS PE=3 SV=1 608 963 4.0E-59
sp|A7GE45|MUTS_CLOBL DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=mutS PE=3 SV=1 608 963 4.0E-59
sp|Q01X96|MUTS_SOLUE DNA mismatch repair protein MutS OS=Solibacter usitatus (strain Ellin6076) GN=mutS PE=3 SV=1 579 976 4.0E-59
sp|Q2RJG2|MUTS_MOOTA DNA mismatch repair protein MutS OS=Moorella thermoacetica (strain ATCC 39073) GN=mutS PE=3 SV=1 608 963 8.0E-59
sp|A4XL47|MUTS_CALS8 DNA mismatch repair protein MutS OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=mutS PE=3 SV=1 601 963 2.0E-58
sp|A9KL10|MUTS_CLOPH DNA mismatch repair protein MutS OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=mutS PE=3 SV=1 607 963 3.0E-58
sp|C5BMR5|MUTS_TERTT DNA mismatch repair protein MutS OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=mutS PE=3 SV=1 606 963 3.0E-58
sp|C0ZEZ4|MUTS_BREBN DNA mismatch repair protein MutS OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=mutS PE=3 SV=1 607 977 3.0E-58
sp|Q8PMX2|MUTS_XANAC DNA mismatch repair protein MutS OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mutS PE=3 SV=1 607 971 6.0E-58
sp|Q8PBB5|MUTS_XANCP DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mutS PE=3 SV=1 607 985 1.0E-57
sp|Q4US90|MUTS_XANC8 DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mutS PE=3 SV=2 607 971 1.0E-57
sp|Q5H2C5|MUTS_XANOR DNA mismatch repair protein MutS OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mutS PE=3 SV=1 607 971 2.0E-57
sp|A5UZK7|MUTS_ROSS1 DNA mismatch repair protein MutS OS=Roseiflexus sp. (strain RS-1) GN=mutS PE=3 SV=1 606 964 2.0E-57
sp|Q47DJ8|MUTS_DECAR DNA mismatch repair protein MutS OS=Dechloromonas aromatica (strain RCB) GN=mutS PE=3 SV=1 579 961 2.0E-57
sp|B7HLA3|MUTS_BACC7 DNA mismatch repair protein MutS OS=Bacillus cereus (strain AH187) GN=mutS PE=3 SV=1 607 964 2.0E-57
sp|Q636Q7|MUTS_BACCZ DNA mismatch repair protein MutS OS=Bacillus cereus (strain ZK / E33L) GN=mutS PE=3 SV=1 607 964 2.0E-57
sp|B7JJ47|MUTS_BACC0 DNA mismatch repair protein MutS OS=Bacillus cereus (strain AH820) GN=mutS PE=3 SV=1 607 964 3.0E-57
sp|A7NPT5|MUTS_ROSCS DNA mismatch repair protein MutS OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=mutS PE=3 SV=1 606 964 3.0E-57
sp|Q81WR3|MUTS_BACAN DNA mismatch repair protein MutS OS=Bacillus anthracis GN=mutS PE=3 SV=1 607 964 3.0E-57
sp|C3L822|MUTS_BACAC DNA mismatch repair protein MutS OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=mutS PE=3 SV=1 607 964 3.0E-57
sp|C3P5H5|MUTS_BACAA DNA mismatch repair protein MutS OS=Bacillus anthracis (strain A0248) GN=mutS PE=3 SV=1 607 964 3.0E-57
sp|Q6HF46|MUTS_BACHK DNA mismatch repair protein MutS OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mutS PE=3 SV=1 607 964 3.0E-57
sp|A0RHE1|MUTS_BACAH DNA mismatch repair protein MutS OS=Bacillus thuringiensis (strain Al Hakam) GN=mutS PE=3 SV=1 607 964 3.0E-57
sp|Q0AEI7|MUTS_NITEC DNA mismatch repair protein MutS OS=Nitrosomonas eutropha (strain C91) GN=mutS PE=3 SV=1 591 964 4.0E-57
sp|C1ENZ3|MUTS_BACC3 DNA mismatch repair protein MutS OS=Bacillus cereus (strain 03BB102) GN=mutS PE=3 SV=1 607 964 4.0E-57
sp|Q3BVY0|MUTS_XANC5 DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mutS PE=3 SV=1 607 971 4.0E-57
sp|A0LG76|MUTS_SYNFM DNA mismatch repair protein MutS OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mutS PE=3 SV=1 613 963 5.0E-57
sp|B7ITM1|MUTS_BACC2 DNA mismatch repair protein MutS OS=Bacillus cereus (strain G9842) GN=mutS PE=3 SV=1 607 964 7.0E-57
sp|A9VS13|MUTS_BACWK DNA mismatch repair protein MutS OS=Bacillus weihenstephanensis (strain KBAB4) GN=mutS PE=3 SV=1 607 964 7.0E-57
sp|Q8DGS4|MUTS_THEEB DNA mismatch repair protein MutS OS=Thermosynechococcus elongatus (strain BP-1) GN=mutS PE=3 SV=1 578 964 7.0E-57
sp|B7HDP4|MUTS_BACC4 DNA mismatch repair protein MutS OS=Bacillus cereus (strain B4264) GN=mutS PE=3 SV=1 607 964 9.0E-57
sp|P57504|MUTS_BUCAI DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mutS PE=3 SV=1 608 961 1.0E-56
sp|B8D7V9|MUTS_BUCAT DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=mutS PE=3 SV=1 608 961 1.0E-56
sp|B9IV59|MUTS_BACCQ DNA mismatch repair protein MutS OS=Bacillus cereus (strain Q1) GN=mutS PE=3 SV=1 607 964 1.0E-56
sp|P61665|MUTS_BACC1 DNA mismatch repair protein MutS OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mutS PE=3 SV=1 607 964 1.0E-56
sp|B8D9K7|MUTS_BUCA5 DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=mutS PE=3 SV=1 608 961 1.0E-56
sp|A7HMG4|MUTS_FERNB DNA mismatch repair protein MutS OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=mutS PE=3 SV=1 336 963 1.0E-56
sp|A8MFD4|MUTS_ALKOO DNA mismatch repair protein MutS OS=Alkaliphilus oremlandii (strain OhILAs) GN=mutS PE=3 SV=2 681 964 2.0E-56
sp|A6GWN3|MUTS_FLAPJ DNA mismatch repair protein MutS OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=mutS PE=3 SV=1 608 975 2.0E-56
sp|B2G6E5|MUTS_LACRJ DNA mismatch repair protein MutS OS=Lactobacillus reuteri (strain JCM 1112) GN=mutS PE=3 SV=1 681 963 3.0E-56
sp|A5VIW9|MUTS_LACRD DNA mismatch repair protein MutS OS=Lactobacillus reuteri (strain DSM 20016) GN=mutS PE=3 SV=1 681 963 3.0E-56
sp|A0Q0M6|MUTS_CLONN DNA mismatch repair protein MutS OS=Clostridium novyi (strain NT) GN=mutS PE=3 SV=1 608 963 3.0E-56
sp|A0L7L5|MUTS_MAGMM DNA mismatch repair protein MutS OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=mutS PE=3 SV=1 606 964 4.0E-56
sp|Q5WFY3|MUTS_BACSK DNA mismatch repair protein MutS OS=Bacillus clausii (strain KSM-K16) GN=mutS PE=3 SV=1 607 963 8.0E-56
sp|Q0TRD6|MUTS_CLOP1 DNA mismatch repair protein MutS OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=mutS PE=3 SV=1 606 963 9.0E-56
sp|Q65JE2|MUTS_BACLD DNA mismatch repair protein MutS OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mutS PE=3 SV=1 608 963 9.0E-56
sp|Q0STR4|MUTS_CLOPS DNA mismatch repair protein MutS OS=Clostridium perfringens (strain SM101 / Type A) GN=mutS PE=3 SV=1 606 963 9.0E-56
sp|A5N8I5|MUTS_CLOK5 DNA mismatch repair protein MutS OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=mutS PE=3 SV=1 681 963 1.0E-55
sp|B9E1Z0|MUTS_CLOK1 DNA mismatch repair protein MutS OS=Clostridium kluyveri (strain NBRC 12016) GN=mutS PE=3 SV=1 681 963 1.0E-55
sp|A4J5Q6|MUTS_DESRM DNA mismatch repair protein MutS OS=Desulfotomaculum reducens (strain MI-1) GN=mutS PE=3 SV=1 681 963 1.0E-55
sp|Q0SM54|MUTS_BORAP DNA mismatch repair protein MutS OS=Borrelia afzelii (strain PKo) GN=mutS PE=3 SV=1 590 965 1.0E-55
sp|Q7NLT8|MUTS_GLOVI DNA mismatch repair protein MutS OS=Gloeobacter violaceus (strain PCC 7421) GN=mutS PE=3 SV=1 545 964 1.0E-55
sp|Q473E4|MUTS_CUPPJ DNA mismatch repair protein MutS OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mutS PE=3 SV=2 591 964 1.0E-55
sp|Q0BDU3|MUTS_BURCM DNA mismatch repair protein MutS OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=mutS PE=3 SV=1 681 964 1.0E-55
sp|Q81A25|MUTS_BACCR DNA mismatch repair protein MutS OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mutS PE=3 SV=1 607 964 1.0E-55
sp|B1YSP3|MUTS_BURA4 DNA mismatch repair protein MutS OS=Burkholderia ambifaria (strain MC40-6) GN=mutS PE=3 SV=1 681 964 1.0E-55
sp|O04716|MSH6_ARATH DNA mismatch repair protein MSH6 OS=Arabidopsis thaliana GN=MSH6 PE=1 SV=2 77 959 1.0E-55
sp|A5FJ63|MUTS_FLAJ1 DNA mismatch repair protein MutS OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=mutS PE=3 SV=2 608 975 2.0E-55
sp|Q8XL87|MUTS_CLOPE DNA mismatch repair protein MutS OS=Clostridium perfringens (strain 13 / Type A) GN=mutS PE=3 SV=1 606 963 2.0E-55
sp|Q21LB1|MUTS_SACD2 DNA mismatch repair protein MutS OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=mutS PE=3 SV=1 681 956 2.0E-55
sp|B2V1M2|MUTS_CLOBA DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=mutS PE=3 SV=1 608 963 2.0E-55
sp|A4JFW7|MUTS_BURVG DNA mismatch repair protein MutS OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mutS PE=3 SV=1 591 964 3.0E-55
sp|Q60BA1|MUTS_METCA DNA mismatch repair protein MutS OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=mutS PE=3 SV=1 607 961 3.0E-55
sp|O24617|MSH2_ARATH DNA mismatch repair protein MSH2 OS=Arabidopsis thaliana GN=MSH2 PE=1 SV=1 354 959 3.0E-55
sp|A3NB64|MUTS_BURP6 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 668) GN=mutS PE=3 SV=1 591 964 4.0E-55
sp|Q0UXL8|MSH3_PHANO DNA mismatch repair protein MSH3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MSH3 PE=3 SV=3 498 960 4.0E-55
sp|O65607|MSH3_ARATH DNA mismatch repair protein MSH3 OS=Arabidopsis thaliana GN=MSH3 PE=1 SV=2 362 964 6.0E-55
sp|B2TIC3|MUTS_CLOBB DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=mutS PE=3 SV=1 608 963 7.0E-55
sp|Q1MRT4|MUTS_LAWIP DNA mismatch repair protein MutS OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=mutS PE=3 SV=1 666 964 7.0E-55
sp|Q1BHQ1|MUTS_BURCA DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain AU 1054) GN=mutS PE=3 SV=1 591 964 8.0E-55
sp|Q0VNJ1|MUTS_ALCBS DNA mismatch repair protein MutS OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mutS PE=3 SV=1 579 959 1.0E-54
sp|Q65ZX6|MUTS_BORBP DNA mismatch repair protein MutS OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=mutS PE=3 SV=1 590 963 2.0E-54
sp|Q9PCR2|MUTS_XYLFA DNA mismatch repair protein MutS OS=Xylella fastidiosa (strain 9a5c) GN=mutS PE=3 SV=2 607 944 3.0E-54
sp|Q0A8K3|MUTS_ALKEH DNA mismatch repair protein MutS OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=mutS PE=3 SV=1 607 964 3.0E-54
sp|Q10YG4|MUTS_TRIEI DNA mismatch repair protein MutS OS=Trichodesmium erythraeum (strain IMS101) GN=mutS PE=3 SV=1 589 963 4.0E-54
sp|P70755|MUTS_AQUPY DNA mismatch repair protein MutS OS=Aquifex pyrophilus GN=mutS PE=3 SV=1 617 963 6.0E-54
sp|Q4L5Z9|MUTS_STAHJ DNA mismatch repair protein MutS OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mutS PE=3 SV=1 681 963 7.0E-54
sp|Q255T1|MUTS_CHLFF DNA mismatch repair protein MutS OS=Chlamydophila felis (strain Fe/C-56) GN=mutS PE=3 SV=1 607 963 8.0E-54
sp|Q895H2|MUTS_CLOTE DNA mismatch repair protein MutS OS=Clostridium tetani (strain Massachusetts / E88) GN=mutS PE=3 SV=1 608 963 1.0E-53
sp|B9DPB9|MUTS_STACT DNA mismatch repair protein MutS OS=Staphylococcus carnosus (strain TM300) GN=mutS PE=3 SV=1 681 963 1.0E-53
sp|B7J0P3|MUTS_BORBZ DNA mismatch repair protein MutS OS=Borrelia burgdorferi (strain ZS7) GN=mutS PE=3 SV=1 653 963 1.0E-53
sp|O51737|MUTS_BORBU DNA mismatch repair protein MutS OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=mutS PE=3 SV=1 653 963 1.0E-53
sp|A8FDH3|MUTS_BACP2 DNA mismatch repair protein MutS OS=Bacillus pumilus (strain SAFR-032) GN=mutS PE=3 SV=1 608 963 2.0E-53
sp|P61666|MUTS_DESVH DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=mutS PE=3 SV=1 681 964 2.0E-53
sp|B1HRG8|MUTS_LYSSC DNA mismatch repair protein MutS OS=Lysinibacillus sphaericus (strain C3-41) GN=mutS PE=3 SV=1 607 972 2.0E-53
sp|Q9Z6W5|MUTS_CHLPN DNA mismatch repair protein MutS OS=Chlamydia pneumoniae GN=mutS PE=3 SV=2 607 963 2.0E-53
sp|P65494|MUTS_STAAW DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MW2) GN=mutS PE=3 SV=1 681 975 2.0E-53
sp|P0C1S1|MUTS_STAAU DNA mismatch repair protein MutS OS=Staphylococcus aureus GN=mutS PE=3 SV=1 681 975 2.0E-53
sp|A8Z1W6|MUTS_STAAT DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=mutS PE=3 SV=1 681 975 2.0E-53
sp|Q6G9R8|MUTS_STAAS DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MSSA476) GN=mutS PE=3 SV=1 681 975 2.0E-53
sp|P65493|MUTS_STAAN DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain N315) GN=mutS PE=3 SV=1 681 975 2.0E-53
sp|Q931S8|MUTS_STAAM DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mutS PE=3 SV=2 681 975 2.0E-53
sp|A6QGJ4|MUTS_STAAE DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Newman) GN=mutS PE=3 SV=1 681 975 2.0E-53
sp|Q5HGD6|MUTS_STAAC DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain COL) GN=mutS PE=3 SV=1 681 975 2.0E-53
sp|A5ISH9|MUTS_STAA9 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain JH9) GN=mutS PE=3 SV=1 681 975 2.0E-53
sp|A6U1B4|MUTS_STAA2 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain JH1) GN=mutS PE=3 SV=1 681 975 2.0E-53
sp|A7X1T6|MUTS_STAA1 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mutS PE=3 SV=1 681 975 2.0E-53
sp|Q2FYZ9|MUTS_STAA8 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain NCTC 8325) GN=mutS PE=3 SV=2 681 975 2.0E-53
sp|A1VDD9|MUTS_DESVV DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=mutS PE=3 SV=1 681 964 2.0E-53
sp|Q3JCL5|MUTS_NITOC DNA mismatch repair protein MutS OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=mutS PE=3 SV=1 606 961 3.0E-53
sp|Q1QE46|MUTS_PSYCK DNA mismatch repair protein MutS OS=Psychrobacter cryohalolentis (strain K5) GN=mutS PE=3 SV=1 552 963 3.0E-53
sp|Q6GHE0|MUTS_STAAR DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MRSA252) GN=mutS PE=3 SV=1 681 975 3.0E-53
sp|Q2YXR9|MUTS_STAAB DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=mutS PE=3 SV=1 681 964 5.0E-53
sp|A6SXI2|MUTS_JANMA DNA mismatch repair protein MutS OS=Janthinobacterium sp. (strain Marseille) GN=mutS PE=3 SV=1 681 964 5.0E-53
sp|Q5L554|MUTS_CHLAB DNA mismatch repair protein MutS OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=mutS PE=3 SV=1 607 963 5.0E-53
sp|Q5UZG9|MUTS1_HALMA DNA mismatch repair protein MutS 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=mutS1 PE=3 SV=2 669 963 5.0E-53
sp|Q9JX94|MUTS_NEIMB DNA mismatch repair protein MutS OS=Neisseria meningitidis serogroup B (strain MC58) GN=mutS PE=3 SV=1 600 965 6.0E-53
sp|A7Z4X5|MUTS_BACMF DNA mismatch repair protein MutS OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mutS PE=3 SV=1 608 963 6.0E-53
sp|A9M4L8|MUTS_NEIM0 DNA mismatch repair protein MutS OS=Neisseria meningitidis serogroup C (strain 053442) GN=mutS PE=3 SV=1 600 961 6.0E-53
sp|Q5B6T1|MSH3_EMENI DNA mismatch repair protein msh3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=msh3 PE=3 SV=2 614 986 7.0E-53
sp|Q5F5J4|MUTS_NEIG1 DNA mismatch repair protein MutS OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=mutS PE=3 SV=1 600 965 7.0E-53
sp|A4G717|MUTS_HERAR DNA mismatch repair protein MutS OS=Herminiimonas arsenicoxydans GN=mutS PE=3 SV=3 681 964 8.0E-53
sp|Q3Z767|MUTS_DEHM1 DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=mutS PE=3 SV=1 579 963 2.0E-52
sp|A1T004|MUTS_PSYIN DNA mismatch repair protein MutS OS=Psychromonas ingrahamii (strain 37) GN=mutS PE=3 SV=1 681 963 2.0E-52
sp|A1R0M2|MUTS_BORT9 DNA mismatch repair protein MutS OS=Borrelia turicatae (strain 91E135) GN=mutS PE=3 SV=1 651 965 2.0E-52
sp|A9KG24|MUTS_COXBN DNA mismatch repair protein MutS OS=Coxiella burnetii (strain Dugway 5J108-111) GN=mutS PE=3 SV=1 607 961 2.0E-52
sp|A6LLR1|MUTS_THEM4 DNA mismatch repair protein MutS OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=mutS PE=3 SV=1 579 963 3.0E-52
sp|A6KZM1|MUTS_BACV8 DNA mismatch repair protein MutS OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=mutS PE=3 SV=1 681 963 3.0E-52
sp|B2GB17|MUTS_LACF3 DNA mismatch repair protein MutS OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=mutS PE=3 SV=1 681 963 3.0E-52
sp|Q56215|MUTS_THEAQ DNA mismatch repair protein MutS OS=Thermus aquaticus GN=mutS PE=1 SV=1 677 963 4.0E-52
sp|Q821V6|MUTS_CHLCV DNA mismatch repair protein MutS OS=Chlamydophila caviae (strain GPIC) GN=mutS PE=3 SV=1 681 963 5.0E-52
sp|C6DAK6|MUTS_PECCP DNA mismatch repair protein MutS OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mutS PE=3 SV=1 681 961 5.0E-52
sp|B4RPP9|MUTS_NEIG2 DNA mismatch repair protein MutS OS=Neisseria gonorrhoeae (strain NCCP11945) GN=mutS PE=3 SV=1 600 965 5.0E-52
sp|C5BGI4|MUTS_EDWI9 DNA mismatch repair protein MutS OS=Edwardsiella ictaluri (strain 93-146) GN=mutS PE=3 SV=1 681 961 6.0E-52
sp|B4F220|MUTS_PROMH DNA mismatch repair protein MutS OS=Proteus mirabilis (strain HI4320) GN=mutS PE=3 SV=1 681 984 7.0E-52
sp|O13396|MSH2_NEUCR DNA mismatch repair protein msh-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msh-2 PE=3 SV=1 361 961 8.0E-52
sp|P49849|MUTS_BACSU DNA mismatch repair protein MutS OS=Bacillus subtilis (strain 168) GN=mutS PE=3 SV=3 608 971 8.0E-52
sp|Q1DQ73|MSH3_COCIM DNA mismatch repair protein MSH3 OS=Coccidioides immitis (strain RS) GN=MSH3 PE=3 SV=2 644 959 9.0E-52
sp|Q6D8C1|MUTS_PECAS DNA mismatch repair protein MutS OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mutS PE=3 SV=1 681 961 1.0E-51
sp|Q7VY01|MUTS_BORPE DNA mismatch repair protein MutS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=mutS PE=3 SV=1 607 961 1.0E-51
sp|B2S1E1|MUTS_BORHD DNA mismatch repair protein MutS OS=Borrelia hermsii (strain HS1 / DAH) GN=mutS PE=3 SV=1 651 963 1.0E-51
sp|Q39EX8|MUTS_BURL3 DNA mismatch repair protein MutS OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=mutS PE=3 SV=1 724 964 1.0E-51
sp|Q9XGC9|MSH2_MAIZE DNA mismatch repair protein MSH2 OS=Zea mays GN=MUS1 PE=3 SV=1 235 960 1.0E-51
sp|Q8CPF0|MUTS_STAES DNA mismatch repair protein MutS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mutS PE=3 SV=1 681 963 1.0E-51
sp|Q5HPP5|MUTS_STAEQ DNA mismatch repair protein MutS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mutS PE=3 SV=1 681 963 1.0E-51
sp|B1JUW8|MUTS_BURCC DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain MC0-3) GN=mutS PE=3 SV=1 724 964 2.0E-51
sp|Q7W880|MUTS_BORPA DNA mismatch repair protein MutS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mutS PE=3 SV=2 606 961 2.0E-51
sp|A5D2K2|MUTS_PELTS DNA mismatch repair protein MutS OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mutS PE=3 SV=1 681 963 2.0E-51
sp|Q7WLT5|MUTS_BORBR DNA mismatch repair protein MutS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mutS PE=3 SV=2 606 961 2.0E-51
sp|A0K8L2|MUTS_BURCH DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain HI2424) GN=mutS PE=3 SV=1 724 964 2.0E-51
sp|A1U2E8|MUTS_MARHV DNA mismatch repair protein MutS OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=mutS PE=3 SV=1 607 964 2.0E-51
sp|A9NCN3|MUTS_COXBR DNA mismatch repair protein MutS OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=mutS PE=3 SV=1 681 961 2.0E-51
sp|Q6LMU0|MUTS_PHOPR DNA mismatch repair protein MutS OS=Photobacterium profundum GN=mutS PE=3 SV=1 681 960 2.0E-51
sp|Q83CQ2|MUTS_COXBU DNA mismatch repair protein MutS OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mutS PE=3 SV=1 681 961 2.0E-51
sp|Q7N8K0|MUTS_PHOLL DNA mismatch repair protein MutS OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mutS PE=3 SV=1 681 961 2.0E-51
sp|B4ED83|MUTS_BURCJ DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=mutS PE=3 SV=1 724 964 3.0E-51
sp|B2SXQ9|MUTS_BURPP DNA mismatch repair protein MutS OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=mutS PE=3 SV=1 724 964 3.0E-51
sp|B2JIT0|MUTS_BURP8 DNA mismatch repair protein MutS OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=mutS PE=3 SV=1 724 964 3.0E-51
sp|Q49X88|MUTS_STAS1 DNA mismatch repair protein MutS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mutS PE=3 SV=1 607 963 4.0E-51
sp|P25847|MSH2_YEAST DNA mismatch repair protein MSH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH2 PE=1 SV=2 386 961 4.0E-51
sp|A1WRJ3|MUTS_VEREI DNA mismatch repair protein MutS OS=Verminephrobacter eiseniae (strain EF01-2) GN=mutS PE=3 SV=1 599 965 4.0E-51
sp|Q1QZX5|MUTS_CHRSD DNA mismatch repair protein MutS OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mutS PE=3 SV=1 606 983 6.0E-51
sp|A7EC69|MSH3_SCLS1 DNA mismatch repair protein msh3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=msh3 PE=3 SV=1 619 959 6.0E-51
sp|A1DCB2|MSH3_NEOFI DNA mismatch repair protein msh3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=msh3 PE=3 SV=1 539 961 8.0E-51
sp|Q7VKA1|MUTS_HAEDU DNA mismatch repair protein MutS OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=mutS PE=3 SV=1 681 961 9.0E-51
sp|A2BTM6|MUTS_PROMS DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain AS9601) GN=mutS PE=3 SV=1 675 963 9.0E-51
sp|A4TQ04|MUTS_YERPP DNA mismatch repair protein MutS OS=Yersinia pestis (strain Pestoides F) GN=mutS PE=3 SV=1 681 961 1.0E-50
sp|Q1CLQ9|MUTS_YERPN DNA mismatch repair protein MutS OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mutS PE=3 SV=1 681 961 1.0E-50
sp|A9R111|MUTS_YERPG DNA mismatch repair protein MutS OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mutS PE=3 SV=1 681 961 1.0E-50
sp|Q8ZBQ3|MUTS_YERPE DNA mismatch repair protein MutS OS=Yersinia pestis GN=mutS PE=3 SV=1 681 961 1.0E-50
sp|Q1C471|MUTS_YERPA DNA mismatch repair protein MutS OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mutS PE=3 SV=1 681 961 1.0E-50
sp|Q15QR9|MUTS_PSEA6 DNA mismatch repair protein MutS OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=mutS PE=3 SV=1 681 984 1.0E-50
sp|Q66EB5|MUTS_YERPS DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mutS PE=3 SV=1 681 961 1.0E-50
sp|B2K584|MUTS_YERPB DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mutS PE=3 SV=1 681 961 1.0E-50
sp|A7FLX1|MUTS_YERP3 DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mutS PE=3 SV=1 681 961 1.0E-50
sp|A9MF43|MUTS_SALAR DNA mismatch repair protein MutS OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mutS PE=3 SV=1 681 961 1.0E-50
sp|B1JJF1|MUTS_YERPY DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mutS PE=3 SV=1 681 961 1.0E-50
sp|Q4WGB7|MSH3_ASPFU DNA mismatch repair protein msh3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=msh3 PE=3 SV=1 608 961 2.0E-50
sp|B0YCF6|MSH3_ASPFC DNA mismatch repair protein msh3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=msh3 PE=3 SV=1 608 961 2.0E-50
sp|Q317Z7|MUTS_PROM9 DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9312) GN=mutS PE=3 SV=1 591 963 2.0E-50
sp|B7VK59|MUTS_VIBTL DNA mismatch repair protein MutS OS=Vibrio tasmaniensis (strain LGP32) GN=mutS PE=3 SV=1 681 959 2.0E-50
sp|A2R1F6|MSH3_ASPNC DNA mismatch repair protein msh3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=msh3 PE=3 SV=2 597 961 2.0E-50
sp|A3PFD3|MUTS_PROM0 DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9301) GN=mutS PE=3 SV=1 675 963 2.0E-50
sp|B6I6B9|MUTS_ECOSE DNA mismatch repair protein MutS OS=Escherichia coli (strain SE11) GN=mutS PE=3 SV=1 681 961 2.0E-50
sp|Q5ZUJ3|MUTS_LEGPH DNA mismatch repair protein MutS OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=mutS PE=3 SV=2 681 961 3.0E-50
sp|A5ICW2|MUTS_LEGPC DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Corby) GN=mutS PE=3 SV=2 681 961 3.0E-50
sp|Q127P5|MUTS_POLSJ DNA mismatch repair protein MutS OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=mutS PE=3 SV=1 599 965 3.0E-50
sp|Q045Q5|MUTS_LACGA DNA mismatch repair protein MutS OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=mutS PE=3 SV=1 582 972 3.0E-50
sp|Q31X95|MUTS_SHIBS DNA mismatch repair protein MutS OS=Shigella boydii serotype 4 (strain Sb227) GN=mutS PE=3 SV=1 681 961 4.0E-50
sp|B2TZJ7|MUTS_SHIB3 DNA mismatch repair protein MutS OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mutS PE=3 SV=1 681 961 4.0E-50
sp|Q5HBQ7|MUTS_EHRRW DNA mismatch repair protein MutS OS=Ehrlichia ruminantium (strain Welgevonden) GN=mutS PE=3 SV=1 73 483 8.0E-40
sp|Q5FHE8|MUTS_EHRRG DNA mismatch repair protein MutS OS=Ehrlichia ruminantium (strain Gardel) GN=mutS PE=3 SV=1 73 483 1.0E-39
sp|A7HZ64|MUTS_PARL1 DNA mismatch repair protein MutS OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=mutS PE=3 SV=1 66 464 6.0E-39
sp|Q7UP05|MUTS_RHOBA DNA mismatch repair protein MutS OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mutS PE=3 SV=1 87 523 3.0E-38
sp|P61670|MUTS_RHOPA DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mutS PE=3 SV=1 89 483 4.0E-38
sp|Q1QQJ4|MUTS_NITHX DNA mismatch repair protein MutS OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=mutS PE=3 SV=1 89 486 3.0E-37
sp|Q21CE8|MUTS_RHOPB DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain BisB18) GN=mutS PE=3 SV=2 53 481 1.0E-36
sp|Q2WAN4|MUTS_MAGSA DNA mismatch repair protein MutS OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mutS PE=3 SV=2 52 477 2.0E-36
sp|Q8CPF0|MUTS_STAES DNA mismatch repair protein MutS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mutS PE=3 SV=1 73 508 5.0E-36
sp|Q5HPP5|MUTS_STAEQ DNA mismatch repair protein MutS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mutS PE=3 SV=1 73 508 5.0E-36
sp|Q0BV38|MUTS_GRABC DNA mismatch repair protein MutS OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=mutS PE=3 SV=1 69 467 6.0E-36
sp|A4YKQ0|MUTS_BRASO DNA mismatch repair protein MutS OS=Bradyrhizobium sp. (strain ORS278) GN=mutS PE=3 SV=1 54 482 1.0E-35
sp|A5ETJ3|MUTS_BRASB DNA mismatch repair protein MutS OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mutS PE=3 SV=1 54 482 1.0E-35
sp|Q895H2|MUTS_CLOTE DNA mismatch repair protein MutS OS=Clostridium tetani (strain Massachusetts / E88) GN=mutS PE=3 SV=1 73 481 1.0E-34
sp|Q2RNG0|MUTS_RHORT DNA mismatch repair protein MutS OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mutS PE=3 SV=1 87 472 4.0E-34
sp|A5VN83|MUTS_BRUO2 DNA mismatch repair protein MutS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=mutS PE=3 SV=1 61 481 6.0E-34
sp|Q11B27|MUTS_CHESB DNA mismatch repair protein MutS OS=Chelativorans sp. (strain BNC1) GN=mutS PE=3 SV=1 87 464 9.0E-34
sp|Q89VX1|MUTS_BRADU DNA mismatch repair protein MutS OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mutS PE=3 SV=1 55 490 1.0E-33
sp|Q8YES6|MUTS_BRUME DNA mismatch repair protein MutS OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mutS PE=3 SV=2 66 481 1.0E-33
sp|Q8G310|MUTS_BRUSU DNA mismatch repair protein MutS OS=Brucella suis biovar 1 (strain 1330) GN=mutS PE=3 SV=1 66 481 1.0E-33
sp|A9M792|MUTS_BRUC2 DNA mismatch repair protein MutS OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mutS PE=3 SV=1 66 481 1.0E-33
sp|Q4UM86|MUTS_RICFE DNA mismatch repair protein MutS OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mutS PE=3 SV=1 87 473 2.0E-33
sp|B0CIQ5|MUTS_BRUSI DNA mismatch repair protein MutS OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=mutS PE=3 SV=1 66 481 2.0E-33
sp|A5VA00|MUTS_SPHWW DNA mismatch repair protein MutS OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=mutS PE=3 SV=1 35 464 2.0E-33
sp|A6WV86|MUTS_OCHA4 DNA mismatch repair protein MutS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mutS PE=3 SV=1 87 481 5.0E-33
sp|Q57FM9|MUTS_BRUAB DNA mismatch repair protein MutS OS=Brucella abortus biovar 1 (strain 9-941) GN=mutS PE=3 SV=1 66 481 5.0E-33
sp|Q2YNZ0|MUTS_BRUA2 DNA mismatch repair protein MutS OS=Brucella abortus (strain 2308) GN=mutS PE=3 SV=1 66 481 5.0E-33
sp|Q8DGS4|MUTS_THEEB DNA mismatch repair protein MutS OS=Thermosynechococcus elongatus (strain BP-1) GN=mutS PE=3 SV=1 73 496 5.0E-33
sp|Q3SVD4|MUTS_NITWN DNA mismatch repair protein MutS OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=mutS PE=3 SV=1 89 493 8.0E-33
sp|Q6GHE0|MUTS_STAAR DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MRSA252) GN=mutS PE=3 SV=1 73 508 9.0E-33
sp|B9DPB9|MUTS_STACT DNA mismatch repair protein MutS OS=Staphylococcus carnosus (strain TM300) GN=mutS PE=3 SV=1 73 508 1.0E-32
sp|Q1GCK9|MUTS_RUEST DNA mismatch repair protein MutS OS=Ruegeria sp. (strain TM1040) GN=mutS PE=3 SV=1 84 486 2.0E-32
sp|B3CQY2|MUTS_ORITI DNA mismatch repair protein MutS OS=Orientia tsutsugamushi (strain Ikeda) GN=mutS PE=3 SV=1 73 483 2.0E-32
sp|Q10YG4|MUTS_TRIEI DNA mismatch repair protein MutS OS=Trichodesmium erythraeum (strain IMS101) GN=mutS PE=3 SV=1 83 522 2.0E-32
sp|Q4L5Z9|MUTS_STAHJ DNA mismatch repair protein MutS OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mutS PE=3 SV=1 73 500 2.0E-32
sp|Q2YXR9|MUTS_STAAB DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=mutS PE=3 SV=1 73 508 2.0E-32
sp|P65494|MUTS_STAAW DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MW2) GN=mutS PE=3 SV=1 73 508 6.0E-32
sp|P0C1S1|MUTS_STAAU DNA mismatch repair protein MutS OS=Staphylococcus aureus GN=mutS PE=3 SV=1 73 508 6.0E-32
sp|A8Z1W6|MUTS_STAAT DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=mutS PE=3 SV=1 73 508 6.0E-32
sp|Q6G9R8|MUTS_STAAS DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MSSA476) GN=mutS PE=3 SV=1 73 508 6.0E-32
sp|P65493|MUTS_STAAN DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain N315) GN=mutS PE=3 SV=1 73 508 6.0E-32
sp|Q931S8|MUTS_STAAM DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mutS PE=3 SV=2 73 508 6.0E-32
sp|A6QGJ4|MUTS_STAAE DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Newman) GN=mutS PE=3 SV=1 73 508 6.0E-32
sp|Q5HGD6|MUTS_STAAC DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain COL) GN=mutS PE=3 SV=1 73 508 6.0E-32
sp|A5ISH9|MUTS_STAA9 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain JH9) GN=mutS PE=3 SV=1 73 508 6.0E-32
sp|A6U1B4|MUTS_STAA2 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain JH1) GN=mutS PE=3 SV=1 73 508 6.0E-32
sp|A7X1T6|MUTS_STAA1 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mutS PE=3 SV=1 73 508 6.0E-32
sp|Q2FYZ9|MUTS_STAA8 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain NCTC 8325) GN=mutS PE=3 SV=2 73 508 6.0E-32
sp|Q16D05|MUTS_ROSDO DNA mismatch repair protein MutS OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=mutS PE=3 SV=1 85 481 1.0E-31
sp|A3PFD3|MUTS_PROM0 DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9301) GN=mutS PE=3 SV=1 89 468 1.0E-31
sp|A8LPD4|MUTS_DINSH DNA mismatch repair protein MutS OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=mutS PE=3 SV=1 87 481 2.0E-31
sp|Q317Z7|MUTS_PROM9 DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9312) GN=mutS PE=3 SV=1 89 468 2.0E-31
sp|Q6G0X1|MUTS_BARQU DNA mismatch repair protein MutS OS=Bartonella quintana (strain Toulouse) GN=mutS PE=3 SV=1 87 467 3.0E-31
sp|Q0AK91|MUTS_MARMM DNA mismatch repair protein MutS OS=Maricaulis maris (strain MCS10) GN=mutS PE=3 SV=1 66 501 4.0E-31
sp|A4J5Q6|MUTS_DESRM DNA mismatch repair protein MutS OS=Desulfotomaculum reducens (strain MI-1) GN=mutS PE=3 SV=1 73 481 7.0E-31
sp|Q8UIF2|MUTS_AGRFC DNA mismatch repair protein MutS OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mutS PE=3 SV=1 61 477 1.0E-30
sp|Q2RJG2|MUTS_MOOTA DNA mismatch repair protein MutS OS=Moorella thermoacetica (strain ATCC 39073) GN=mutS PE=3 SV=1 67 483 1.0E-30
sp|A1UU95|MUTS_BARBK DNA mismatch repair protein MutS OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=mutS PE=3 SV=1 73 464 2.0E-30
sp|Q0C5G6|MUTS_HYPNA DNA mismatch repair protein MutS OS=Hyphomonas neptunium (strain ATCC 15444) GN=mutS PE=3 SV=1 66 471 3.0E-30
sp|A2BTM6|MUTS_PROMS DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain AS9601) GN=mutS PE=3 SV=1 89 468 3.0E-30
sp|Q2KD76|MUTS_RHIEC DNA mismatch repair protein MutS OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=mutS PE=3 SV=1 87 488 4.0E-30
sp|A0Q0M6|MUTS_CLONN DNA mismatch repair protein MutS OS=Clostridium novyi (strain NT) GN=mutS PE=3 SV=1 84 505 5.0E-30
sp|A8FDH3|MUTS_BACP2 DNA mismatch repair protein MutS OS=Bacillus pumilus (strain SAFR-032) GN=mutS PE=3 SV=1 73 484 7.0E-30
sp|A7NPT5|MUTS_ROSCS DNA mismatch repair protein MutS OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=mutS PE=3 SV=1 71 478 1.0E-29
sp|Q3Z767|MUTS_DEHM1 DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=mutS PE=3 SV=1 83 477 1.0E-29
sp|Q28VY6|MUTS_JANSC DNA mismatch repair protein MutS OS=Jannaschia sp. (strain CCS1) GN=mutS PE=3 SV=1 87 481 3.0E-29
sp|A0L7L5|MUTS_MAGMM DNA mismatch repair protein MutS OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=mutS PE=3 SV=1 89 482 3.0E-29
sp|B3E6P2|MUTS_GEOLS DNA mismatch repair protein MutS OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=mutS PE=3 SV=1 89 505 5.0E-29
sp|A6KZM1|MUTS_BACV8 DNA mismatch repair protein MutS OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=mutS PE=3 SV=1 87 477 5.0E-29
sp|A5G447|MUTS_GEOUR DNA mismatch repair protein MutS OS=Geobacter uraniireducens (strain Rf4) GN=mutS PE=3 SV=1 85 471 1.0E-28
sp|A5N8I5|MUTS_CLOK5 DNA mismatch repair protein MutS OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=mutS PE=3 SV=1 85 477 2.0E-28
sp|B9E1Z0|MUTS_CLOK1 DNA mismatch repair protein MutS OS=Clostridium kluyveri (strain NBRC 12016) GN=mutS PE=3 SV=1 85 477 2.0E-28
sp|B2V1M2|MUTS_CLOBA DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=mutS PE=3 SV=1 70 471 2.0E-28
sp|Q49X88|MUTS_STAS1 DNA mismatch repair protein MutS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mutS PE=3 SV=1 73 481 2.0E-28
sp|B2TIC3|MUTS_CLOBB DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=mutS PE=3 SV=1 70 471 5.0E-28
sp|Q2N5V9|MUTS_ERYLH DNA mismatch repair protein MutS OS=Erythrobacter litoralis (strain HTCC2594) GN=mutS PE=3 SV=1 86 487 6.0E-28
sp|A7GR99|MUTS_BACCN DNA mismatch repair protein MutS OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mutS PE=3 SV=1 71 505 9.0E-28
sp|C1FNT9|MUTS_CLOBJ DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Kyoto / Type A2) GN=mutS PE=3 SV=1 87 471 1.0E-27
sp|A5UZK7|MUTS_ROSS1 DNA mismatch repair protein MutS OS=Roseiflexus sp. (strain RS-1) GN=mutS PE=3 SV=1 71 478 1.0E-27
sp|Q3JCL5|MUTS_NITOC DNA mismatch repair protein MutS OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=mutS PE=3 SV=1 63 483 1.0E-27
sp|A7GE45|MUTS_CLOBL DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=mutS PE=3 SV=1 87 471 2.0E-27
sp|Q0A8K3|MUTS_ALKEH DNA mismatch repair protein MutS OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=mutS PE=3 SV=1 87 482 2.0E-27
sp|Q56215|MUTS_THEAQ DNA mismatch repair protein MutS OS=Thermus aquaticus GN=mutS PE=1 SV=1 75 521 2.0E-27
sp|Q65JE2|MUTS_BACLD DNA mismatch repair protein MutS OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mutS PE=3 SV=1 70 508 4.0E-27
sp|Q8XL87|MUTS_CLOPE DNA mismatch repair protein MutS OS=Clostridium perfringens (strain 13 / Type A) GN=mutS PE=3 SV=1 77 471 1.0E-26
sp|Q0TRD6|MUTS_CLOP1 DNA mismatch repair protein MutS OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=mutS PE=3 SV=1 77 471 2.0E-26
sp|Q0STR4|MUTS_CLOPS DNA mismatch repair protein MutS OS=Clostridium perfringens (strain SM101 / Type A) GN=mutS PE=3 SV=1 77 471 3.0E-26
sp|A6LLR1|MUTS_THEM4 DNA mismatch repair protein MutS OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=mutS PE=3 SV=1 84 481 7.0E-26
sp|Q0AEI7|MUTS_NITEC DNA mismatch repair protein MutS OS=Nitrosomonas eutropha (strain C91) GN=mutS PE=3 SV=1 65 485 9.0E-26
sp|C6DAK6|MUTS_PECCP DNA mismatch repair protein MutS OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mutS PE=3 SV=1 70 481 1.0E-25
sp|Q6D8C1|MUTS_PECAS DNA mismatch repair protein MutS OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mutS PE=3 SV=1 77 481 2.0E-25
sp|Q1QZX5|MUTS_CHRSD DNA mismatch repair protein MutS OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mutS PE=3 SV=1 74 473 2.0E-25
sp|Q5ZUJ3|MUTS_LEGPH DNA mismatch repair protein MutS OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=mutS PE=3 SV=2 77 483 2.0E-25
sp|A5ICW2|MUTS_LEGPC DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Corby) GN=mutS PE=3 SV=2 77 483 2.0E-25
sp|P49849|MUTS_BACSU DNA mismatch repair protein MutS OS=Bacillus subtilis (strain 168) GN=mutS PE=3 SV=3 70 472 4.0E-25
sp|Q39VR6|MUTS_GEOMG DNA mismatch repair protein MutS OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mutS PE=3 SV=1 87 472 6.0E-25
sp|A7Z4X5|MUTS_BACMF DNA mismatch repair protein MutS OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mutS PE=3 SV=1 70 484 1.0E-24
sp|Q3IYI5|MUTS_RHOS4 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mutS PE=3 SV=1 87 485 2.0E-24
sp|A3PNR5|MUTS_RHOS1 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mutS PE=3 SV=1 87 485 2.0E-24
sp|A8MFD4|MUTS_ALKOO DNA mismatch repair protein MutS OS=Alkaliphilus oremlandii (strain OhILAs) GN=mutS PE=3 SV=2 73 523 2.0E-24
sp|Q9JX94|MUTS_NEIMB DNA mismatch repair protein MutS OS=Neisseria meningitidis serogroup B (strain MC58) GN=mutS PE=3 SV=1 89 477 3.0E-24
sp|A1T004|MUTS_PSYIN DNA mismatch repair protein MutS OS=Psychromonas ingrahamii (strain 37) GN=mutS PE=3 SV=1 87 467 3.0E-24
sp|A9M4L8|MUTS_NEIM0 DNA mismatch repair protein MutS OS=Neisseria meningitidis serogroup C (strain 053442) GN=mutS PE=3 SV=1 89 477 4.0E-24
sp|Q7NLT8|MUTS_GLOVI DNA mismatch repair protein MutS OS=Gloeobacter violaceus (strain PCC 7421) GN=mutS PE=3 SV=1 87 471 5.0E-24
sp|Q9Z6W5|MUTS_CHLPN DNA mismatch repair protein MutS OS=Chlamydia pneumoniae GN=mutS PE=3 SV=2 72 481 7.0E-24
sp|A0LG76|MUTS_SYNFM DNA mismatch repair protein MutS OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mutS PE=3 SV=1 73 472 9.0E-24
sp|Q821V6|MUTS_CHLCV DNA mismatch repair protein MutS OS=Chlamydophila caviae (strain GPIC) GN=mutS PE=3 SV=1 72 482 9.0E-24
sp|A1U2E8|MUTS_MARHV DNA mismatch repair protein MutS OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=mutS PE=3 SV=1 87 481 1.0E-23
sp|A4TQ04|MUTS_YERPP DNA mismatch repair protein MutS OS=Yersinia pestis (strain Pestoides F) GN=mutS PE=3 SV=1 88 486 1.0E-23
sp|Q1CLQ9|MUTS_YERPN DNA mismatch repair protein MutS OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mutS PE=3 SV=1 88 486 1.0E-23
sp|A9R111|MUTS_YERPG DNA mismatch repair protein MutS OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mutS PE=3 SV=1 88 486 1.0E-23
sp|Q8ZBQ3|MUTS_YERPE DNA mismatch repair protein MutS OS=Yersinia pestis GN=mutS PE=3 SV=1 88 486 1.0E-23
sp|Q66EB5|MUTS_YERPS DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mutS PE=3 SV=1 88 486 1.0E-23
sp|B2K584|MUTS_YERPB DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mutS PE=3 SV=1 88 486 1.0E-23
sp|A7FLX1|MUTS_YERP3 DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mutS PE=3 SV=1 88 486 1.0E-23
sp|B1JJF1|MUTS_YERPY DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mutS PE=3 SV=1 88 503 1.0E-23
sp|Q1MMA5|MUTS_RHIL3 DNA mismatch repair protein MutS OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=mutS PE=3 SV=1 87 477 2.0E-23
sp|A9KL10|MUTS_CLOPH DNA mismatch repair protein MutS OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=mutS PE=3 SV=1 77 505 2.0E-23
sp|Q636Q7|MUTS_BACCZ DNA mismatch repair protein MutS OS=Bacillus cereus (strain ZK / E33L) GN=mutS PE=3 SV=1 71 463 2.0E-23
sp|Q1C471|MUTS_YERPA DNA mismatch repair protein MutS OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mutS PE=3 SV=1 88 486 2.0E-23
sp|A4WVX8|MUTS_RHOS5 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=mutS PE=3 SV=1 87 481 3.0E-23
sp|B7HLA3|MUTS_BACC7 DNA mismatch repair protein MutS OS=Bacillus cereus (strain AH187) GN=mutS PE=3 SV=1 71 463 3.0E-23
sp|B7JJ47|MUTS_BACC0 DNA mismatch repair protein MutS OS=Bacillus cereus (strain AH820) GN=mutS PE=3 SV=1 71 463 3.0E-23
sp|Q81WR3|MUTS_BACAN DNA mismatch repair protein MutS OS=Bacillus anthracis GN=mutS PE=3 SV=1 71 463 3.0E-23
sp|C3L822|MUTS_BACAC DNA mismatch repair protein MutS OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=mutS PE=3 SV=1 71 463 3.0E-23
sp|C3P5H5|MUTS_BACAA DNA mismatch repair protein MutS OS=Bacillus anthracis (strain A0248) GN=mutS PE=3 SV=1 71 463 3.0E-23
sp|Q6HF46|MUTS_BACHK DNA mismatch repair protein MutS OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mutS PE=3 SV=1 71 463 3.0E-23
sp|A0RHE1|MUTS_BACAH DNA mismatch repair protein MutS OS=Bacillus thuringiensis (strain Al Hakam) GN=mutS PE=3 SV=1 71 463 3.0E-23
sp|C1ENZ3|MUTS_BACC3 DNA mismatch repair protein MutS OS=Bacillus cereus (strain 03BB102) GN=mutS PE=3 SV=1 71 463 3.0E-23
sp|B7HDP4|MUTS_BACC4 DNA mismatch repair protein MutS OS=Bacillus cereus (strain B4264) GN=mutS PE=3 SV=1 71 463 3.0E-23
sp|B9IV59|MUTS_BACCQ DNA mismatch repair protein MutS OS=Bacillus cereus (strain Q1) GN=mutS PE=3 SV=1 71 463 3.0E-23
sp|P61665|MUTS_BACC1 DNA mismatch repair protein MutS OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mutS PE=3 SV=1 71 463 3.0E-23
sp|A9KG24|MUTS_COXBN DNA mismatch repair protein MutS OS=Coxiella burnetii (strain Dugway 5J108-111) GN=mutS PE=3 SV=1 77 482 4.0E-23
sp|A5D2K2|MUTS_PELTS DNA mismatch repair protein MutS OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mutS PE=3 SV=1 83 528 4.0E-23
sp|A9NCN3|MUTS_COXBR DNA mismatch repair protein MutS OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=mutS PE=3 SV=1 77 482 4.0E-23
sp|Q83CQ2|MUTS_COXBU DNA mismatch repair protein MutS OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mutS PE=3 SV=1 77 482 4.0E-23
sp|Q81A25|MUTS_BACCR DNA mismatch repair protein MutS OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mutS PE=3 SV=1 85 463 6.0E-23
sp|P57504|MUTS_BUCAI DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mutS PE=3 SV=1 84 472 8.0E-23
sp|A4XL47|MUTS_CALS8 DNA mismatch repair protein MutS OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=mutS PE=3 SV=1 73 473 1.0E-22
sp|A9VS13|MUTS_BACWK DNA mismatch repair protein MutS OS=Bacillus weihenstephanensis (strain KBAB4) GN=mutS PE=3 SV=1 71 463 1.0E-22
sp|Q5WFY3|MUTS_BACSK DNA mismatch repair protein MutS OS=Bacillus clausii (strain KSM-K16) GN=mutS PE=3 SV=1 84 483 1.0E-22
sp|Q6LMU0|MUTS_PHOPR DNA mismatch repair protein MutS OS=Photobacterium profundum GN=mutS PE=3 SV=1 87 481 1.0E-22
sp|Q045Q5|MUTS_LACGA DNA mismatch repair protein MutS OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=mutS PE=3 SV=1 77 507 1.0E-22
sp|B8D7V9|MUTS_BUCAT DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=mutS PE=3 SV=1 84 472 2.0E-22
sp|B8D9K7|MUTS_BUCA5 DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=mutS PE=3 SV=1 84 472 2.0E-22
sp|Q15QR9|MUTS_PSEA6 DNA mismatch repair protein MutS OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=mutS PE=3 SV=1 87 504 2.0E-22
sp|B5YJY3|MUTS_THEYD DNA mismatch repair protein MutS OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mutS PE=3 SV=1 77 486 3.0E-22
sp|B7ITM1|MUTS_BACC2 DNA mismatch repair protein MutS OS=Bacillus cereus (strain G9842) GN=mutS PE=3 SV=1 71 463 3.0E-22
sp|Q5UZG9|MUTS1_HALMA DNA mismatch repair protein MutS 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=mutS1 PE=3 SV=2 86 483 4.0E-22
sp|A9MF43|MUTS_SALAR DNA mismatch repair protein MutS OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mutS PE=3 SV=1 88 472 6.0E-22
sp|B2G6E5|MUTS_LACRJ DNA mismatch repair protein MutS OS=Lactobacillus reuteri (strain JCM 1112) GN=mutS PE=3 SV=1 73 508 7.0E-22
sp|A5VIW9|MUTS_LACRD DNA mismatch repair protein MutS OS=Lactobacillus reuteri (strain DSM 20016) GN=mutS PE=3 SV=1 73 508 7.0E-22
sp|Q255T1|MUTS_CHLFF DNA mismatch repair protein MutS OS=Chlamydophila felis (strain Fe/C-56) GN=mutS PE=3 SV=1 73 482 7.0E-22
sp|A6GWN3|MUTS_FLAPJ DNA mismatch repair protein MutS OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=mutS PE=3 SV=1 83 473 1.0E-21
sp|Q60BA1|MUTS_METCA DNA mismatch repair protein MutS OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=mutS PE=3 SV=1 89 473 1.0E-21
sp|Q5F5J4|MUTS_NEIG1 DNA mismatch repair protein MutS OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=mutS PE=3 SV=1 89 471 1.0E-21
sp|B4RPP9|MUTS_NEIG2 DNA mismatch repair protein MutS OS=Neisseria gonorrhoeae (strain NCCP11945) GN=mutS PE=3 SV=1 89 471 1.0E-21
sp|Q7VKA1|MUTS_HAEDU DNA mismatch repair protein MutS OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=mutS PE=3 SV=1 73 483 1.0E-21
sp|B6I6B9|MUTS_ECOSE DNA mismatch repair protein MutS OS=Escherichia coli (strain SE11) GN=mutS PE=3 SV=1 73 472 1.0E-21
sp|Q31X95|MUTS_SHIBS DNA mismatch repair protein MutS OS=Shigella boydii serotype 4 (strain Sb227) GN=mutS PE=3 SV=1 70 472 1.0E-21
sp|B2TZJ7|MUTS_SHIB3 DNA mismatch repair protein MutS OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mutS PE=3 SV=1 70 472 1.0E-21
sp|B2GB17|MUTS_LACF3 DNA mismatch repair protein MutS OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=mutS PE=3 SV=1 77 505 2.0E-21
sp|Q5L554|MUTS_CHLAB DNA mismatch repair protein MutS OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=mutS PE=3 SV=1 73 482 3.0E-21
sp|C5BGI4|MUTS_EDWI9 DNA mismatch repair protein MutS OS=Edwardsiella ictaluri (strain 93-146) GN=mutS PE=3 SV=1 70 464 3.0E-21
sp|Q7N8K0|MUTS_PHOLL DNA mismatch repair protein MutS OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mutS PE=3 SV=1 87 477 3.0E-21
sp|Q65ZX6|MUTS_BORBP DNA mismatch repair protein MutS OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=mutS PE=3 SV=1 83 467 5.0E-21
sp|Q0VNJ1|MUTS_ALCBS DNA mismatch repair protein MutS OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mutS PE=3 SV=1 89 481 1.0E-20
sp|B7VK59|MUTS_VIBTL DNA mismatch repair protein MutS OS=Vibrio tasmaniensis (strain LGP32) GN=mutS PE=3 SV=1 88 483 1.0E-20
sp|Q127P5|MUTS_POLSJ DNA mismatch repair protein MutS OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=mutS PE=3 SV=1 85 509 1.0E-20
sp|C5BMR5|MUTS_TERTT DNA mismatch repair protein MutS OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=mutS PE=3 SV=1 77 471 2.0E-20
sp|C0ZEZ4|MUTS_BREBN DNA mismatch repair protein MutS OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=mutS PE=3 SV=1 71 483 2.0E-20
sp|Q0SM54|MUTS_BORAP DNA mismatch repair protein MutS OS=Borrelia afzelii (strain PKo) GN=mutS PE=3 SV=1 83 473 2.0E-20
sp|A3NB64|MUTS_BURP6 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 668) GN=mutS PE=3 SV=1 87 483 2.0E-20
sp|B0S1C1|MUTS_FINM2 DNA mismatch repair protein MutS OS=Finegoldia magna (strain ATCC 29328) GN=mutS PE=3 SV=1 70 472 3.0E-20
sp|B7J0P3|MUTS_BORBZ DNA mismatch repair protein MutS OS=Borrelia burgdorferi (strain ZS7) GN=mutS PE=3 SV=1 83 467 3.0E-20
sp|O51737|MUTS_BORBU DNA mismatch repair protein MutS OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=mutS PE=3 SV=1 83 467 3.0E-20
sp|P61666|MUTS_DESVH DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=mutS PE=3 SV=1 85 473 3.0E-20
sp|B4F220|MUTS_PROMH DNA mismatch repair protein MutS OS=Proteus mirabilis (strain HI4320) GN=mutS PE=3 SV=1 89 489 3.0E-20
sp|B1HRG8|MUTS_LYSSC DNA mismatch repair protein MutS OS=Lysinibacillus sphaericus (strain C3-41) GN=mutS PE=3 SV=1 73 481 4.0E-20
sp|A1VDD9|MUTS_DESVV DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=mutS PE=3 SV=1 85 473 4.0E-20
sp|B2SXQ9|MUTS_BURPP DNA mismatch repair protein MutS OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=mutS PE=3 SV=1 89 508 7.0E-20
sp|B2S2S5|MUTS_TREPS DNA mismatch repair protein MutS OS=Treponema pallidum subsp. pallidum (strain SS14) GN=mutS PE=3 SV=1 67 473 1.0E-19
sp|O83348|MUTS_TREPA DNA mismatch repair protein MutS OS=Treponema pallidum (strain Nichols) GN=mutS PE=3 SV=1 67 473 1.0E-19
sp|Q473E4|MUTS_CUPPJ DNA mismatch repair protein MutS OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mutS PE=3 SV=2 57 488 1.0E-19
sp|A5FJ63|MUTS_FLAJ1 DNA mismatch repair protein MutS OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=mutS PE=3 SV=2 83 473 1.0E-19
sp|Q5H2C5|MUTS_XANOR DNA mismatch repair protein MutS OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mutS PE=3 SV=1 62 523 2.0E-19
sp|Q8PMX2|MUTS_XANAC DNA mismatch repair protein MutS OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mutS PE=3 SV=1 85 513 3.0E-19
sp|Q0BDU3|MUTS_BURCM DNA mismatch repair protein MutS OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=mutS PE=3 SV=1 87 507 4.0E-19
sp|B1YSP3|MUTS_BURA4 DNA mismatch repair protein MutS OS=Burkholderia ambifaria (strain MC40-6) GN=mutS PE=3 SV=1 87 507 4.0E-19
sp|B4ED83|MUTS_BURCJ DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=mutS PE=3 SV=1 87 507 4.0E-19
sp|Q01X96|MUTS_SOLUE DNA mismatch repair protein MutS OS=Solibacter usitatus (strain Ellin6076) GN=mutS PE=3 SV=1 87 472 5.0E-19
sp|A4JFW7|MUTS_BURVG DNA mismatch repair protein MutS OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mutS PE=3 SV=1 87 507 5.0E-19
sp|Q39EX8|MUTS_BURL3 DNA mismatch repair protein MutS OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=mutS PE=3 SV=1 87 507 5.0E-19
sp|B1JUW8|MUTS_BURCC DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain MC0-3) GN=mutS PE=3 SV=1 87 507 7.0E-19
sp|Q1BHQ1|MUTS_BURCA DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain AU 1054) GN=mutS PE=3 SV=1 87 507 1.0E-18
sp|Q1MRT4|MUTS_LAWIP DNA mismatch repair protein MutS OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=mutS PE=3 SV=1 85 490 2.0E-18
sp|A0K8L2|MUTS_BURCH DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain HI2424) GN=mutS PE=3 SV=1 87 507 2.0E-18
sp|Q1IN52|MUTS_KORVE DNA mismatch repair protein MutS OS=Koribacter versatilis (strain Ellin345) GN=mutS PE=3 SV=1 73 471 6.0E-18
sp|Q47DJ8|MUTS_DECAR DNA mismatch repair protein MutS OS=Dechloromonas aromatica (strain RCB) GN=mutS PE=3 SV=1 87 471 1.0E-17
sp|B2S1E1|MUTS_BORHD DNA mismatch repair protein MutS OS=Borrelia hermsii (strain HS1 / DAH) GN=mutS PE=3 SV=1 89 484 1.0E-17
sp|Q7VY01|MUTS_BORPE DNA mismatch repair protein MutS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=mutS PE=3 SV=1 89 464 2.0E-17
sp|Q7W880|MUTS_BORPA DNA mismatch repair protein MutS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mutS PE=3 SV=2 89 473 3.0E-17
sp|Q7WLT5|MUTS_BORBR DNA mismatch repair protein MutS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mutS PE=3 SV=2 89 473 4.0E-17
sp|B2JIT0|MUTS_BURP8 DNA mismatch repair protein MutS OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=mutS PE=3 SV=1 89 507 1.0E-16
sp|Q21LB1|MUTS_SACD2 DNA mismatch repair protein MutS OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=mutS PE=3 SV=1 87 471 3.0E-16
sp|A1WRJ3|MUTS_VEREI DNA mismatch repair protein MutS OS=Verminephrobacter eiseniae (strain EF01-2) GN=mutS PE=3 SV=1 85 472 7.0E-16
sp|A6SXI2|MUTS_JANMA DNA mismatch repair protein MutS OS=Janthinobacterium sp. (strain Marseille) GN=mutS PE=3 SV=1 77 508 1.0E-15
sp|A4G717|MUTS_HERAR DNA mismatch repair protein MutS OS=Herminiimonas arsenicoxydans GN=mutS PE=3 SV=3 89 508 2.0E-15
sp|A1R0M2|MUTS_BORT9 DNA mismatch repair protein MutS OS=Borrelia turicatae (strain 91E135) GN=mutS PE=3 SV=1 73 473 2.0E-15
sp|P70755|MUTS_AQUPY DNA mismatch repair protein MutS OS=Aquifex pyrophilus GN=mutS PE=3 SV=1 85 477 2.0E-14
sp|O66652|MUTS_AQUAE DNA mismatch repair protein MutS OS=Aquifex aeolicus (strain VF5) GN=mutS PE=3 SV=1 84 472 6.0E-14
sp|Q8PBB5|MUTS_XANCP DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mutS PE=3 SV=1 85 271 2.0E-13
sp|Q4US90|MUTS_XANC8 DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mutS PE=3 SV=2 85 271 2.0E-13
sp|Q3BVY0|MUTS_XANC5 DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mutS PE=3 SV=1 85 271 2.0E-13
sp|Q9PCR2|MUTS_XYLFA DNA mismatch repair protein MutS OS=Xylella fastidiosa (strain 9a5c) GN=mutS PE=3 SV=2 85 271 2.0E-11
sp|Q1QE46|MUTS_PSYCK DNA mismatch repair protein MutS OS=Psychrobacter cryohalolentis (strain K5) GN=mutS PE=3 SV=1 73 482 3.0E-11
sp|A7HMG4|MUTS_FERNB DNA mismatch repair protein MutS OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=mutS PE=3 SV=1 84 203 5.0E-11
sp|Q87CI8|MUTS_XYLFT DNA mismatch repair protein MutS OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mutS PE=3 SV=1 85 271 8.0E-11
sp|A7HC64|MUTS_ANADF DNA mismatch repair protein MutS OS=Anaeromyxobacter sp. (strain Fw109-5) GN=mutS PE=3 SV=1 68 271 8.0E-10
sp|B8JA66|MUTS_ANAD2 DNA mismatch repair protein MutS OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=mutS PE=3 SV=1 70 206 4.0E-09
sp|B4UCY7|MUTS_ANASK DNA mismatch repair protein MutS OS=Anaeromyxobacter sp. (strain K) GN=mutS PE=3 SV=1 70 271 4.0E-09
sp|Q2IIJ3|MUTS_ANADE DNA mismatch repair protein MutS OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=mutS PE=3 SV=1 70 202 5.0E-09
sp|B8JA66|MUTS_ANAD2 DNA mismatch repair protein MutS OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=mutS PE=3 SV=1 360 463 2.0E-07
sp|B4UCY7|MUTS_ANASK DNA mismatch repair protein MutS OS=Anaeromyxobacter sp. (strain K) GN=mutS PE=3 SV=1 360 463 2.0E-07
sp|A7HC64|MUTS_ANADF DNA mismatch repair protein MutS OS=Anaeromyxobacter sp. (strain Fw109-5) GN=mutS PE=3 SV=1 360 463 3.0E-07
sp|Q2IIJ3|MUTS_ANADE DNA mismatch repair protein MutS OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=mutS PE=3 SV=1 360 463 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006298 mismatch repair Yes
GO:0030983 mismatched DNA binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006950 response to stress No
GO:0006259 DNA metabolic process No
GO:0003676 nucleic acid binding No
GO:0006281 DNA repair No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:0044237 cellular metabolic process No
GO:0050896 response to stimulus No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0003677 DNA binding No
GO:0032555 purine ribonucleotide binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003690 double-stranded DNA binding No
GO:0051716 cellular response to stimulus No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006974 cellular response to DNA damage stimulus No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7384
MFRPRPLDGLCRLVARRGRLVATALRLPRPGPAPAWARGKKTTTTVVLPQGPIRPDAKPLLEAEEPREPAYPTVV
LQAWRNMRRFDNCVLLTRVGGFYELYFEHAQEYAPLLDIKLASKKTNAGAVPMAGFPFFQLDRYLKMLVQDHNRY
VAIAEEFPNDAADRVKSGDLMHDRRVTRIVTAGTLIDENFIDPYDNNYVLAIHVHERDPATPARPAQPPGILDLP
VSPVADSTPLGLAWLDLSTGHFFTQASDLASLPSALSRISPREVVLDRSLKEQKQHPVSAILADDRLVVTYSPGG
ELVDLGAWTPFLEAEMPQRTRKSFSEQEVLAGGLVLNYVKDRLQGMSMKLQPPRRYEGMDIMSIDKNSMRALEIK
QTIRDGFFRGSLLHAIRRTVTKSGARLLNDWLGAPSTSLDVINERQNLVAHFVAAEDLRDSIRLQLGRSDDSQRL
VQKFAMGRGSPDDLLALANTIQATKDIVDRLTQESDQADQTSAEDPLEPLTSRIDLVEPLKLAGRIRAAIDEEGI
DHQHQVEESEAGQMMALAQDIVAAEGSPEDAGALPKERKRRPPSIRDSYREDNDAWIMKPAASPSLKKLHDKLGF
LLEEKTELERTLRESLGATSLTLKWTPGLGHIAHIKGKDARQLADIKTLTSTRSTRSFQNADWTALGQRLDQARF
QIRREEQRVFQQLRERVVKNLVRLRRNAAVLDELDIALSFAKLAVEQAWVRPRLDDSAGHVVMAGRHPTVECGLA
ELGKTFVRNDCLVGGPSAGRLWLITGPNMAGKSTFLRQNALITILAQIGCYVPAAYAELGLVDAVFSRVGSADNL
YRDQSTFMVEMTETAHILRHATPKSFVIMDEIGRGTTPDDGTAVSYACLHHLVTVNKCRTLFATHFHDVADLAVR
DGLCRPDGGPVQMYSTDVEEDGEGHFVYVHKLRKGINRRSHALKVAKMAGLPDRAIDMAEKIMAGGNYAGGGLSG
EGEVEAAAVER*
Coding >Hirsu2|7384
ATGTTCCGGCCACGTCCTCTGGATGGATTGTGCCGCCTCGTCGCCCGCCGCGGGCGCCTCGTCGCGACCGCGCTC
CGCCTCCCGCGCCCCGGGCCGGCGCCGGCCTGGGCCCGGGGCAAGAAGACGACGACGACCGTCGTCCTGCCGCAG
GGCCCCATCCGGCCGGACGCGAAGCCGCTGCTCGAGGCCGAGGAGCCGCGCGAGCCGGCCTACCCGACCGTCGTG
CTCCAGGCGTGGCGCAACATGCGCCGGTTCGACAACTGCGTCTTGCTGACCCGCGTCGGCGGCTTCTACGAGCTG
TACTTTGAGCACGCCCAGGAGTACGCGCCCCTGCTCGACATCAAGCTCGCCAGCAAGAAGACCAATGCCGGTGCT
GTCCCCATGGCCGGCTTCCCCTTCTTCCAGCTGGATCGCTACCTCAAGATGCTTGTCCAGGACCACAACCGCTAT
GTCGCCATCGCCGAGGAGTTTCCCAACGACGCCGCCGACAGGGTCAAGTCGGGTGACTTGATGCATGATCGGCGA
GTCACGCGCATCGTCACCGCCGGCACGCTCATCGACGAGAACTTCATCGACCCCTACGACAACAATTACGTCCTG
GCGATCCATGTCCATGAACGTGACCCGGCGACGCCCGCTCGGCCGGCTCAGCCGCCCGGCATCCTTGACCTCCCC
GTCTCGCCCGTGGCCGACTCGACGCCGCTCGGCCTTGCCTGGCTCGACCTGTCTACCGGCCACTTCTTCACCCAG
GCCTCGGATCTGGCATCCCTGCCCTCTGCCTTGTCCCGCATCAGCCCCCGTGAAGTCGTCCTCGACCGGTCTCTC
AAGGAGCAGAAGCAGCACCCCGTCTCTGCCATCTTGGCCGACGATCGACTCGTCGTCACCTACTCACCGGGAGGC
GAGCTCGTCGATCTTGGCGCATGGACTCCCTTTCTCGAGGCAGAGATGCCCCAGCGCACGCGCAAGAGCTTCAGC
GAGCAGGAAGTCCTTGCCGGCGGCCTCGTGCTGAACTACGTCAAGGACCGCTTGCAGGGCATGTCGATGAAACTC
CAGCCCCCCCGGCGGTACGAGGGCATGGACATCATGAGCATTGACAAGAACAGCATGCGCGCGCTCGAGATCAAG
CAGACCATCCGCGACGGCTTCTTCCGCGGCAGCTTGCTGCACGCCATCCGACGCACCGTCACCAAGAGCGGCGCA
CGCCTGCTCAACGACTGGCTCGGCGCCCCCTCCACCTCTCTCGACGTCATCAACGAGCGGCAGAACCTGGTGGCC
CACTTCGTCGCCGCAGAGGACCTCCGCGATTCCATCCGCCTCCAGCTCGGCCGGAGCGACGACTCCCAGCGCCTT
GTCCAAAAGTTCGCCATGGGCCGCGGCAGCCCCGACGACTTGTTGGCCCTGGCCAACACCATCCAGGCCACCAAG
GACATCGTTGACCGCCTCACGCAGGAGTCGGACCAGGCCGACCAGACGTCGGCAGAGGACCCGCTGGAACCGCTC
ACGTCTCGCATCGACCTCGTCGAGCCCCTCAAGCTGGCCGGCCGGATCAGGGCCGCCATCGACGAGGAAGGCATA
GACCACCAGCACCAGGTGGAGGAGTCCGAGGCGGGCCAGATGATGGCCCTGGCGCAGGACATCGTCGCCGCCGAG
GGCTCGCCCGAGGACGCCGGCGCGCTGCCCAAGGAGAGGAAGAGGCGCCCGCCGTCCATCAGGGACAGCTACCGG
GAGGACAACGATGCGTGGATCATGAAGCCGGCCGCCAGCCCCAGCCTCAAGAAGCTCCACGACAAGCTCGGCTTC
CTGCTCGAGGAGAAGACGGAGCTGGAGCGGACGCTGCGCGAGAGCCTCGGCGCGACCAGCCTCACCCTCAAGTGG
ACGCCCGGCCTCGGCCACATCGCCCACATCAAGGGCAAGGACGCCAGGCAGCTGGCCGACATCAAGACGCTGACC
TCGACGCGCTCGACGCGCTCCTTCCAGAACGCCGACTGGACCGCGCTGGGCCAGCGCCTCGACCAGGCGCGCTTC
CAGATCCGGCGCGAGGAGCAGCGCGTCTTCCAGCAGCTGCGCGAGCGCGTCGTCAAGAACCTGGTCCGCCTGCGC
CGCAACGCCGCCGTCCTCGACGAGCTCGACATCGCCCTGTCCTTCGCCAAGCTCGCCGTCGAGCAGGCCTGGGTC
CGGCCCCGGCTCGACGACTCGGCCGGCCACGTCGTCATGGCCGGCCGCCACCCGACCGTCGAGTGCGGCCTGGCC
GAGCTCGGCAAGACCTTCGTCCGCAACGACTGCCTCGTCGGCGGGCCCTCGGCCGGCCGGCTGTGGCTCATCACC
GGGCCCAACATGGCCGGCAAGAGCACGTTCCTGCGGCAGAACGCCCTCATCACCATCCTCGCCCAGATCGGCTGC
TACGTGCCGGCCGCCTACGCCGAGCTCGGCCTCGTCGACGCCGTCTTCAGCCGCGTCGGCTCGGCCGACAACCTC
TACCGCGACCAGAGCACCTTTATGGTCGAGATGACGGAGACGGCCCACATCCTCCGCCACGCCACGCCCAAGTCC
TTCGTCATCATGGACGAGATCGGCCGCGGCACCACGCCCGACGACGGCACCGCCGTCTCCTACGCCTGCCTGCAC
CACCTCGTCACCGTCAACAAGTGCCGCACCCTCTTCGCCACCCACTTCCACGACGTGGCCGACCTGGCCGTCCGC
GACGGTCTCTGCCGCCCCGACGGCGGGCCGGTGCAGATGTACAGCACCGACGTCGAGGAGGACGGCGAGGGACAC
TTCGTCTACGTCCACAAGCTGCGCAAGGGCATCAACCGCCGGAGCCACGCACTCAAGGTCGCCAAGATGGCGGGA
CTGCCCGATCGCGCCATCGACATGGCGGAGAAGATCATGGCCGGCGGCAACTACGCGGGGGGAGGTCTGAGCGGG
GAGGGGGAGGTGGAGGCTGCTGCTGTTGAACGCTAG
Transcript >Hirsu2|7384
ATGTTCCGGCCACGTCCTCTGGATGGATTGTGCCGCCTCGTCGCCCGCCGCGGGCGCCTCGTCGCGACCGCGCTC
CGCCTCCCGCGCCCCGGGCCGGCGCCGGCCTGGGCCCGGGGCAAGAAGACGACGACGACCGTCGTCCTGCCGCAG
GGCCCCATCCGGCCGGACGCGAAGCCGCTGCTCGAGGCCGAGGAGCCGCGCGAGCCGGCCTACCCGACCGTCGTG
CTCCAGGCGTGGCGCAACATGCGCCGGTTCGACAACTGCGTCTTGCTGACCCGCGTCGGCGGCTTCTACGAGCTG
TACTTTGAGCACGCCCAGGAGTACGCGCCCCTGCTCGACATCAAGCTCGCCAGCAAGAAGACCAATGCCGGTGCT
GTCCCCATGGCCGGCTTCCCCTTCTTCCAGCTGGATCGCTACCTCAAGATGCTTGTCCAGGACCACAACCGCTAT
GTCGCCATCGCCGAGGAGTTTCCCAACGACGCCGCCGACAGGGTCAAGTCGGGTGACTTGATGCATGATCGGCGA
GTCACGCGCATCGTCACCGCCGGCACGCTCATCGACGAGAACTTCATCGACCCCTACGACAACAATTACGTCCTG
GCGATCCATGTCCATGAACGTGACCCGGCGACGCCCGCTCGGCCGGCTCAGCCGCCCGGCATCCTTGACCTCCCC
GTCTCGCCCGTGGCCGACTCGACGCCGCTCGGCCTTGCCTGGCTCGACCTGTCTACCGGCCACTTCTTCACCCAG
GCCTCGGATCTGGCATCCCTGCCCTCTGCCTTGTCCCGCATCAGCCCCCGTGAAGTCGTCCTCGACCGGTCTCTC
AAGGAGCAGAAGCAGCACCCCGTCTCTGCCATCTTGGCCGACGATCGACTCGTCGTCACCTACTCACCGGGAGGC
GAGCTCGTCGATCTTGGCGCATGGACTCCCTTTCTCGAGGCAGAGATGCCCCAGCGCACGCGCAAGAGCTTCAGC
GAGCAGGAAGTCCTTGCCGGCGGCCTCGTGCTGAACTACGTCAAGGACCGCTTGCAGGGCATGTCGATGAAACTC
CAGCCCCCCCGGCGGTACGAGGGCATGGACATCATGAGCATTGACAAGAACAGCATGCGCGCGCTCGAGATCAAG
CAGACCATCCGCGACGGCTTCTTCCGCGGCAGCTTGCTGCACGCCATCCGACGCACCGTCACCAAGAGCGGCGCA
CGCCTGCTCAACGACTGGCTCGGCGCCCCCTCCACCTCTCTCGACGTCATCAACGAGCGGCAGAACCTGGTGGCC
CACTTCGTCGCCGCAGAGGACCTCCGCGATTCCATCCGCCTCCAGCTCGGCCGGAGCGACGACTCCCAGCGCCTT
GTCCAAAAGTTCGCCATGGGCCGCGGCAGCCCCGACGACTTGTTGGCCCTGGCCAACACCATCCAGGCCACCAAG
GACATCGTTGACCGCCTCACGCAGGAGTCGGACCAGGCCGACCAGACGTCGGCAGAGGACCCGCTGGAACCGCTC
ACGTCTCGCATCGACCTCGTCGAGCCCCTCAAGCTGGCCGGCCGGATCAGGGCCGCCATCGACGAGGAAGGCATA
GACCACCAGCACCAGGTGGAGGAGTCCGAGGCGGGCCAGATGATGGCCCTGGCGCAGGACATCGTCGCCGCCGAG
GGCTCGCCCGAGGACGCCGGCGCGCTGCCCAAGGAGAGGAAGAGGCGCCCGCCGTCCATCAGGGACAGCTACCGG
GAGGACAACGATGCGTGGATCATGAAGCCGGCCGCCAGCCCCAGCCTCAAGAAGCTCCACGACAAGCTCGGCTTC
CTGCTCGAGGAGAAGACGGAGCTGGAGCGGACGCTGCGCGAGAGCCTCGGCGCGACCAGCCTCACCCTCAAGTGG
ACGCCCGGCCTCGGCCACATCGCCCACATCAAGGGCAAGGACGCCAGGCAGCTGGCCGACATCAAGACGCTGACC
TCGACGCGCTCGACGCGCTCCTTCCAGAACGCCGACTGGACCGCGCTGGGCCAGCGCCTCGACCAGGCGCGCTTC
CAGATCCGGCGCGAGGAGCAGCGCGTCTTCCAGCAGCTGCGCGAGCGCGTCGTCAAGAACCTGGTCCGCCTGCGC
CGCAACGCCGCCGTCCTCGACGAGCTCGACATCGCCCTGTCCTTCGCCAAGCTCGCCGTCGAGCAGGCCTGGGTC
CGGCCCCGGCTCGACGACTCGGCCGGCCACGTCGTCATGGCCGGCCGCCACCCGACCGTCGAGTGCGGCCTGGCC
GAGCTCGGCAAGACCTTCGTCCGCAACGACTGCCTCGTCGGCGGGCCCTCGGCCGGCCGGCTGTGGCTCATCACC
GGGCCCAACATGGCCGGCAAGAGCACGTTCCTGCGGCAGAACGCCCTCATCACCATCCTCGCCCAGATCGGCTGC
TACGTGCCGGCCGCCTACGCCGAGCTCGGCCTCGTCGACGCCGTCTTCAGCCGCGTCGGCTCGGCCGACAACCTC
TACCGCGACCAGAGCACCTTTATGGTCGAGATGACGGAGACGGCCCACATCCTCCGCCACGCCACGCCCAAGTCC
TTCGTCATCATGGACGAGATCGGCCGCGGCACCACGCCCGACGACGGCACCGCCGTCTCCTACGCCTGCCTGCAC
CACCTCGTCACCGTCAACAAGTGCCGCACCCTCTTCGCCACCCACTTCCACGACGTGGCCGACCTGGCCGTCCGC
GACGGTCTCTGCCGCCCCGACGGCGGGCCGGTGCAGATGTACAGCACCGACGTCGAGGAGGACGGCGAGGGACAC
TTCGTCTACGTCCACAAGCTGCGCAAGGGCATCAACCGCCGGAGCCACGCACTCAAGGTCGCCAAGATGGCGGGA
CTGCCCGATCGCGCCATCGACATGGCGGAGAAGATCATGGCCGGCGGCAACTACGCGGGGGGAGGTCTGAGCGGG
GAGGGGGAGGTGGAGGCTGCTGCTGTTGAACGCTAG
Gene >Hirsu2|7384
ATGTTCCGGCCACGTCCTCTGGATGGATTGTGCCGCCTCGTCGCCCGCCGCGGGCGCCTCGTCGCGACCGCGCTC
CGCCTCCCGCGCCCCGGGCCGGCGCCGGCCTGGGCCCGGGGCAAGAAGACGACGACGACCGTCGTCCTGCCGCAG
GGCCCCATCCGGCCGGACGCGAAGCCGCTGCTCGAGGCCGAGGAGCCGCGCGAGCCGGCCTACCCGACCGTCGTG
CTCCAGGCGTGGCGCAACATGCGCCGGTTCGACAACTGCGTCTTGCTGACCCGCGTCGGCGGCTTCTACGAGCTG
TACTTTGAGCACGCCCAGGAGTACGCGCCCCTGCTCGACATCAAGCTCGCCAGCAAGAAGACCAATGCCGGTGCT
GTCCCCATGGTATGGCCTCCTCTCCCCCCTCTTCGTCCTCTGACTCCTCACTTCCCTGCATAGGCCGGCTTCCCC
TTCTTCCAGCTGGATCGCTACCTCAAGATGCTTGTCCAGGACCACAACCGCTATGTCGCCATCGCCGAGGAGTTT
CCCAACGACGCCGCCGACAGGGTCAAGTCGGGTGACTTGATGCATGATCGGCGAGTCACGCGCATCGTCACCGCC
GGCACGCTCATCGACGAGAACTTCATCGACCCCTACGACAACAATTACGTCCTGGCGATCCATGTCCATGAACGT
GACCCGGCGACGCCCGCTCGGCCGGCTCAGCCGCCCGGCATCCTTGACCTCCCCGTCTCGCCCGTGGCCGACTCG
ACGCCGCTCGGCCTTGCCTGGCTCGACCTGTCTACCGGCCACTTCTTCACCCAGGCCTCGGATCTGGCATCCCTG
CCCTCTGCCTTGTCCCGCATCAGCCCCCGTGAAGTCGTCCTCGACCGGTCTCTCAAGGAGCAGAAGCAGCACCCC
GTCTCTGCCATCTTGGCCGACGATCGACTCGTCGTCACCTACTCACCGGGAGGCGAGCTCGTCGATCTTGGCGCA
TGGACTCCCTTTCTCGAGGCAGAGATGCCCCAGCGCACGCGCAAGAGCTTCAGCGAGCAGGAAGTCCTTGCCGGC
GGCCTCGTGCTGAACTACGTCAAGGACCGCTTGCAGGGCATGTCGATGAAACTCCAGCCCCCCCGGCGGTACGAG
GGCATGGACATCATGAGCATTGACAAGAACAGCATGCGCGCGCTCGAGATCAAGCAGACCATCCGCGACGGCTTC
TTCCGCGGCAGCTTGCTGCACGCCATCCGACGCACCGTCACCAAGAGCGGCGCACGCCTGCTCAACGACTGGCTC
GGCGCCCCCTCCACCTCTCTCGACGTCATCAACGAGCGGCAGAACCTGGTGGCCCACTTCGTCGCCGCAGAGGAC
CTCCGCGATTCCATCCGCCTCCAGCTCGGCCGGAGCGACGACTCCCAGCGCCTTGTCCAAAAGTTCGCCATGGGC
CGCGGCAGCCCCGACGACTTGTTGGCCCTGGCCAACACCATCCAGGCCACCAAGGACATCGTTGACCGCCTCACG
CAGGAGTCGGACCAGGCCGACCAGACGTCGGCAGAGGACCCGCTGGAACCGCTCACGTCTCGCATCGACCTCGTC
GAGCCCCTCAAGCTGGCCGGCCGGATCAGGGCCGCCATCGACGAGGAAGGCATAGACCACCAGCACCAGGTGGAG
GAGTCCGAGGCGGGCCAGATGATGGCCCTGGCGCAGGACATCGTCGCCGCCGAGGGCTCGCCCGAGGACGCCGGC
GCGCTGCCCAAGGAGAGGAAGAGGCGCCCGCCGTCCATCAGGGACAGCTACCGGGAGGACAACGATGCGTGGATC
ATGAAGCCGGCCGCCAGCCCCAGCCTCAAGAAGCTCCACGACAAGCTCGGCTTCCTGCTCGAGGAGAAGACGGAG
CTGGAGCGGACGCTGCGCGAGAGCCTCGGCGCGACCAGCCTCACCCTCAAGTGGACGCCCGGCCTCGGCCACATC
GCCCACATCAAGGGCAAGGACGCCAGGCAGCTGGCCGACATCAAGACGCTGACCTCGACGCGCTCGACGCGCTCC
TTCCAGAACGCCGACTGGACCGCGCTGGGCCAGCGCCTCGACCAGGCGCGCTTCCAGATCCGGCGCGAGGAGCAG
CGCGTCTTCCAGCAGCTGCGCGAGCGCGTCGTCAAGAACCTGGTCCGCCTGCGCCGCAACGCCGCCGTCCTCGAC
GAGCTCGACATCGCCCTGTCCTTCGCCAAGCTCGCCGTCGAGCAGGCCTGGGTCCGGCCCCGGCTCGACGACTCG
GCCGGCCACGTCGTCATGGCCGGCCGCCACCCGACCGTCGAGTGCGGCCTGGCCGAGCTCGGCAAGACCTTCGTC
CGCAACGACTGCCTCGTCGGCGGGCCCTCGGCCGGCCGGCTGTGGCTCATCACCGGGCCCAACATGGCCGGCAAG
AGCACGTTCCTGCGGCAGAACGCCCTCATCACCATCCTCGCCCAGATCGGCTGCTACGTGCCGGCCGCCTACGCC
GAGCTCGGCCTCGTCGACGCCGTCTTCAGCCGCGTCGGCTCGGCCGACAACCTCTACCGCGACCAGAGCACCTTT
ATGGTCGAGATGACGGAGACGGCCCACATCCTCCGCCACGCCACGCCCAAGTCCTTCGTCATCATGGACGAGATC
GGCCGCGGCACCACGCCCGACGACGGCACCGCCGTCTCCTACGCCTGCCTGCACCACCTCGTCACCGTCAACAAG
TGCCGCACCCTCTTCGCCACCCACTTCCACGACGTGGCCGACCTGGCCGTCCGCGACGGTCTCTGCCGCCCCGAC
GGCGGGCCGGTGCAGATGTACAGCACCGACGTCGAGGAGGACGGCGAGGGACACTTCGTCTACGTCCACAAGCTG
CGCAAGGGCATCAACCGCCGGAGCCACGCACTCAAGGTCGCCAAGATGGCGGGACTGCCCGATCGCGCCATCGAC
ATGGCGGAGAAGATCATGGCCGGCGGCAACTACGCGGGGGGAGGTCTGAGCGGGGAGGGGGAGGTGGAGGCTGCT
GCTGTTGAACGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail