Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7376
Gene name
LocationContig_426:3220..5852
Strand+
Gene length (bp)2632
Transcript length (bp)2355
Coding sequence length (bp)2355
Protein length (aa) 785

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04253 TFR_dimer Transferrin receptor-like dimerisation domain 1.6E-23 659 780
PF04389 Peptidase_M28 Peptidase family M28 1.2E-17 392 578
PF02225 PA PA domain 7.5E-07 198 270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1R0|GCP1_ARTBC Probable glutamate carboxypeptidase ARB_02390 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02390 PE=1 SV=1 73 775 0.0E+00
sp|P47161|VPS70_YEAST Vacuolar protein sorting-associated protein 70 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS70 PE=1 SV=1 8 772 2.0E-113
sp|Q9CZR2|NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus GN=Naalad2 PE=1 SV=2 80 757 4.0E-103
sp|P70627|FOLH1_RAT Glutamate carboxypeptidase 2 OS=Rattus norvegicus GN=Folh1 PE=1 SV=1 30 780 4.0E-103
sp|Q9Y3Q0|NALD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens GN=NAALAD2 PE=1 SV=1 37 757 2.0E-101
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1R0|GCP1_ARTBC Probable glutamate carboxypeptidase ARB_02390 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02390 PE=1 SV=1 73 775 0.0E+00
sp|P47161|VPS70_YEAST Vacuolar protein sorting-associated protein 70 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS70 PE=1 SV=1 8 772 2.0E-113
sp|Q9CZR2|NALD2_MOUSE N-acetylated-alpha-linked acidic dipeptidase 2 OS=Mus musculus GN=Naalad2 PE=1 SV=2 80 757 4.0E-103
sp|P70627|FOLH1_RAT Glutamate carboxypeptidase 2 OS=Rattus norvegicus GN=Folh1 PE=1 SV=1 30 780 4.0E-103
sp|Q9Y3Q0|NALD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase 2 OS=Homo sapiens GN=NAALAD2 PE=1 SV=1 37 757 2.0E-101
sp|O35409|FOLH1_MOUSE Glutamate carboxypeptidase 2 OS=Mus musculus GN=Folh1 PE=1 SV=2 27 757 2.0E-98
sp|O77564|FOLH1_PIG Glutamate carboxypeptidase 2 OS=Sus scrofa GN=FOLH1 PE=1 SV=1 23 757 6.0E-97
sp|Q04609|FOLH1_HUMAN Glutamate carboxypeptidase 2 OS=Homo sapiens GN=FOLH1 PE=1 SV=1 94 757 6.0E-96
sp|Q9M1S8|GCP2_ARATH Probable glutamate carboxypeptidase 2 OS=Arabidopsis thaliana GN=AMP1 PE=1 SV=3 43 784 6.0E-75
sp|O54697|NALDL_RAT N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Rattus norvegicus GN=Naaladl1 PE=1 SV=1 95 784 7.0E-71
sp|Q7M758|NALDL_MOUSE N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Mus musculus GN=Naaladl1 PE=2 SV=1 95 784 8.0E-70
sp|Q9UQQ1|NALDL_HUMAN N-acetylated-alpha-linked acidic dipeptidase-like protein OS=Homo sapiens GN=NAALADL1 PE=1 SV=2 95 739 2.0E-68
sp|P91406|GCP2_CAEEL Glutamate carboxypeptidase 2 homolog OS=Caenorhabditis elegans GN=R57.1 PE=1 SV=2 49 763 3.0E-66
sp|Q5WN23|GCP2_CAEBR Glutamate carboxypeptidase 2 homolog OS=Caenorhabditis briggsae GN=CBG08178 PE=3 SV=1 92 623 9.0E-65
sp|Q9HBA9|FOH1B_HUMAN Putative N-acetylated-alpha-linked acidic dipeptidase OS=Homo sapiens GN=FOLH1B PE=2 SV=1 363 757 6.0E-58
sp|O43023|YGV9_SCHPO Inactive zinc metalloprotease C354.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.09c PE=3 SV=1 15 779 2.0E-53
sp|B2GUY2|TFR2_RAT Transferrin receptor protein 2 OS=Rattus norvegicus GN=Tfr2 PE=2 SV=1 162 639 6.0E-51
sp|Q9JKX3|TFR2_MOUSE Transferrin receptor protein 2 OS=Mus musculus GN=Tfr2 PE=1 SV=2 167 639 2.0E-50
sp|Q9UP52|TFR2_HUMAN Transferrin receptor protein 2 OS=Homo sapiens GN=TFR2 PE=1 SV=1 191 639 4.0E-44
sp|Q9GLD3|TFR1_CANLF Transferrin receptor protein 1 OS=Canis lupus familiaris GN=TFRC PE=1 SV=1 190 626 1.0E-32
sp|Q9MYZ3|TFR1_FELCA Transferrin receptor protein 1 OS=Felis catus GN=TFRC PE=1 SV=1 190 635 3.0E-31
sp|Q2V905|TFR1_HORSE Transferrin receptor protein 1 OS=Equus caballus GN=TFRC PE=2 SV=1 145 630 8.0E-30
sp|Q99376|TFR1_RAT Transferrin receptor protein 1 (Fragment) OS=Rattus norvegicus GN=Tfrc PE=2 SV=1 190 630 2.0E-29
sp|Q8HZV3|TFR1_PIG Transferrin receptor protein 1 OS=Sus scrofa GN=TFRC PE=2 SV=1 190 632 3.0E-29
sp|P02786|TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens GN=TFRC PE=1 SV=2 190 765 6.0E-29
sp|Q90997|TFR1_CHICK Transferrin receptor protein 1 OS=Gallus gallus GN=TFRC PE=2 SV=2 191 585 7.0E-29
sp|Q5RDH6|TFR1_PONAB Transferrin receptor protein 1 OS=Pongo abelii GN=TFRC PE=2 SV=1 190 626 1.0E-28
sp|Q07891|TFR1_CRIGR Transferrin receptor protein 1 OS=Cricetulus griseus GN=TFRC PE=2 SV=1 190 630 7.0E-28
sp|Q62351|TFR1_MOUSE Transferrin receptor protein 1 OS=Mus musculus GN=Tfrc PE=1 SV=1 190 630 6.0E-27
sp|Q58DX5|NADL2_HUMAN Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 OS=Homo sapiens GN=NAALADL2 PE=1 SV=3 117 619 6.0E-20
sp|Q08919|TRE1_YEAST Uncharacterized protein TRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRE1 PE=1 SV=1 101 781 5.0E-16
sp|Q08693|TRE2_YEAST Putative zinc metalloprotease TRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRE2 PE=1 SV=1 46 779 8.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7376
MAPHAAERTPLIQTVRIGPPVRRYPHQTCRRFCTIACASLLTAGFLFFLIHAFFIWPHHHHHGPQSRYSLSRHGG
RSLSHDRLNAILLATPEPERAREWSRYYASGPHLAGKNYSQAKWTMEKWQDWGLQSTIVPYESYINYPVDHSLAL
LTRSDESESWNVAFQASLEEDVLDEDPTTQLDDRIPTFHGFSASGNATARFVYVNYGTFQDFDDLLRARVDLAGN
IAIARYGNVFRGLKVKRAQELGMLAVVMYSDPGDDGEITEENGFDPYPHGPARNPSSVQRGSVQYISVRPGDPST
PGYPSKPGSPRAPVHDAIPRIPSIPISYADAIPILKALNGHGPDAADMGEAWKRNVGLGYKGVDYSIGPSPAGVV
LNLSSEQSYTTTPLWDVIGIVNGTIANEVLVLGNHRDAWIAGGAGDPNSGSAVLNEVIRSVGRAVEAGWKPLRTI
VFASWDGEEYALIGSTEWVEEYLPWLSEANVAYVNVDIGTSGPDLQVSAAPLLHRVFRNVSHMVPSPNQTVPGQT
VGDVWRGPISTMGSGSDFTAFQDFAGVPSIDLSFQGSPRDAVYHYHSNYDSFHWMDRYGDPGFRYHKAMAQLVGL
LVGELSDSIVIPFGAADYADALLGYLDRVDDRLRSRTATAARPPPRDVTGSASALEESLAALRRSLAELRTRAGE
LDDRAAWANRRLEAGVPWWNVAGKIWLWITIANVNTQYKHLERSFLFEAGLDGRSWFKHVVFAPGLWTGYAGDVY
PGLMESIDAADYNNGLKWAGIIGRCVKRAIRGIE*
Coding >Hirsu2|7376
ATGGCCCCCCACGCCGCCGAGAGGACGCCTCTCATCCAGACGGTCCGCATCGGCCCCCCCGTCAGGCGATACCCG
CACCAGACCTGCCGCCGCTTCTGCACCATCGCCTGCGCCTCGCTGCTCACTGCCGGCTTTCTCTTCTTCCTCATC
CATGCCTTCTTCATCTGGCCCCATCACCACCACCACGGCCCGCAGAGCCGCTACTCGCTCTCCCGCCACGGCGGC
CGTTCCCTCAGCCACGACCGCCTCAACGCCATCCTCCTCGCCACGCCCGAGCCCGAGCGCGCCCGGGAATGGAGC
CGGTACTACGCCTCCGGGCCTCACCTGGCCGGCAAGAACTATTCTCAGGCCAAGTGGACCATGGAAAAGTGGCAG
GACTGGGGCCTGCAGTCGACCATTGTCCCCTACGAATCCTACATCAACTATCCCGTCGACCATAGCCTGGCCCTC
CTGACCCGGTCGGACGAGTCCGAGTCGTGGAACGTCGCCTTCCAGGCCTCGCTGGAGGAGGACGTCCTGGACGAG
GACCCCACCACCCAGCTCGACGACAGGATCCCGACCTTCCACGGCTTCTCCGCCAGCGGCAACGCCACCGCCCGC
TTCGTCTACGTCAACTACGGCACCTTCCAGGACTTTGACGACCTGCTGCGCGCCCGTGTCGACCTCGCCGGCAAC
ATCGCCATCGCCAGGTACGGCAACGTCTTTCGCGGCCTCAAGGTCAAGCGCGCCCAGGAGCTCGGCATGCTGGCC
GTCGTCATGTACAGCGACCCGGGCGACGACGGCGAAATCACAGAGGAGAACGGCTTCGACCCTTATCCCCACGGT
CCCGCGCGGAACCCGAGCAGCGTCCAGCGAGGCAGCGTCCAGTACATCAGCGTCCGGCCCGGCGATCCCTCGACA
CCGGGCTACCCGTCCAAGCCGGGCTCTCCTCGCGCGCCGGTGCATGACGCGATCCCCCGCATCCCCTCCATCCCC
ATCTCCTACGCGGACGCGATTCCGATCCTCAAGGCCCTCAACGGCCATGGCCCCGACGCGGCCGACATGGGCGAA
GCGTGGAAGCGAAACGTGGGCCTCGGCTACAAGGGCGTCGACTACAGCATCGGGCCCTCGCCTGCCGGCGTCGTC
CTCAACCTGTCGAGCGAGCAGAGCTACACGACGACGCCGCTGTGGGACGTCATCGGCATCGTCAACGGCACCATC
GCCAACGAGGTGCTCGTGCTGGGCAACCACCGCGACGCCTGGATCGCCGGCGGGGCGGGCGACCCCAACAGCGGC
TCGGCCGTGCTCAACGAGGTGATCCGCAGCGTCGGCCGGGCCGTCGAGGCCGGCTGGAAGCCGCTGCGGACCATC
GTCTTCGCCAGCTGGGACGGCGAGGAGTACGCGCTGATCGGCAGCACCGAGTGGGTGGAGGAGTACCTGCCGTGG
CTCAGCGAGGCCAACGTGGCCTACGTCAACGTCGACATCGGCACGTCGGGCCCGGACCTGCAGGTGTCGGCCGCG
CCGCTGCTGCACCGCGTCTTCCGCAACGTCAGCCACATGGTGCCGTCGCCGAACCAGACGGTGCCGGGCCAGACG
GTCGGCGACGTCTGGCGCGGCCCGATCAGCACCATGGGCAGCGGCAGCGACTTCACCGCCTTCCAGGACTTCGCC
GGCGTGCCCAGCATCGACCTCAGCTTCCAGGGCTCGCCGCGCGACGCCGTCTACCACTACCACAGCAACTACGAC
AGCTTCCACTGGATGGACCGCTACGGCGACCCGGGCTTCCGCTACCACAAGGCCATGGCCCAGCTGGTCGGCCTG
CTGGTCGGCGAGCTCAGCGACAGCATCGTCATCCCCTTCGGCGCCGCCGACTACGCCGACGCCCTGCTCGGCTAC
CTCGACCGCGTCGACGACCGGCTCCGGTCGCGCACGGCGACGGCCGCCCGCCCCCCGCCCCGCGACGTCACGGGC
AGCGCCTCCGCGCTGGAGGAGAGCCTGGCCGCGCTGCGCCGCTCCCTCGCCGAGCTGCGCACCCGCGCCGGCGAG
CTCGACGACCGCGCCGCCTGGGCCAACCGCCGCCTCGAGGCCGGCGTCCCGTGGTGGAACGTGGCCGGCAAGATC
TGGCTGTGGATCACCATCGCCAACGTCAACACGCAGTACAAGCACCTCGAGCGCAGCTTCCTCTTCGAGGCCGGC
CTCGACGGCCGGAGCTGGTTCAAGCACGTCGTCTTCGCGCCGGGGCTCTGGACGGGCTATGCCGGAGACGTCTAC
CCCGGCCTGATGGAGAGCATCGACGCGGCCGACTACAACAACGGCCTGAAGTGGGCGGGCATCATCGGCCGCTGC
GTCAAGCGCGCCATCCGCGGCATCGAGTGA
Transcript >Hirsu2|7376
ATGGCCCCCCACGCCGCCGAGAGGACGCCTCTCATCCAGACGGTCCGCATCGGCCCCCCCGTCAGGCGATACCCG
CACCAGACCTGCCGCCGCTTCTGCACCATCGCCTGCGCCTCGCTGCTCACTGCCGGCTTTCTCTTCTTCCTCATC
CATGCCTTCTTCATCTGGCCCCATCACCACCACCACGGCCCGCAGAGCCGCTACTCGCTCTCCCGCCACGGCGGC
CGTTCCCTCAGCCACGACCGCCTCAACGCCATCCTCCTCGCCACGCCCGAGCCCGAGCGCGCCCGGGAATGGAGC
CGGTACTACGCCTCCGGGCCTCACCTGGCCGGCAAGAACTATTCTCAGGCCAAGTGGACCATGGAAAAGTGGCAG
GACTGGGGCCTGCAGTCGACCATTGTCCCCTACGAATCCTACATCAACTATCCCGTCGACCATAGCCTGGCCCTC
CTGACCCGGTCGGACGAGTCCGAGTCGTGGAACGTCGCCTTCCAGGCCTCGCTGGAGGAGGACGTCCTGGACGAG
GACCCCACCACCCAGCTCGACGACAGGATCCCGACCTTCCACGGCTTCTCCGCCAGCGGCAACGCCACCGCCCGC
TTCGTCTACGTCAACTACGGCACCTTCCAGGACTTTGACGACCTGCTGCGCGCCCGTGTCGACCTCGCCGGCAAC
ATCGCCATCGCCAGGTACGGCAACGTCTTTCGCGGCCTCAAGGTCAAGCGCGCCCAGGAGCTCGGCATGCTGGCC
GTCGTCATGTACAGCGACCCGGGCGACGACGGCGAAATCACAGAGGAGAACGGCTTCGACCCTTATCCCCACGGT
CCCGCGCGGAACCCGAGCAGCGTCCAGCGAGGCAGCGTCCAGTACATCAGCGTCCGGCCCGGCGATCCCTCGACA
CCGGGCTACCCGTCCAAGCCGGGCTCTCCTCGCGCGCCGGTGCATGACGCGATCCCCCGCATCCCCTCCATCCCC
ATCTCCTACGCGGACGCGATTCCGATCCTCAAGGCCCTCAACGGCCATGGCCCCGACGCGGCCGACATGGGCGAA
GCGTGGAAGCGAAACGTGGGCCTCGGCTACAAGGGCGTCGACTACAGCATCGGGCCCTCGCCTGCCGGCGTCGTC
CTCAACCTGTCGAGCGAGCAGAGCTACACGACGACGCCGCTGTGGGACGTCATCGGCATCGTCAACGGCACCATC
GCCAACGAGGTGCTCGTGCTGGGCAACCACCGCGACGCCTGGATCGCCGGCGGGGCGGGCGACCCCAACAGCGGC
TCGGCCGTGCTCAACGAGGTGATCCGCAGCGTCGGCCGGGCCGTCGAGGCCGGCTGGAAGCCGCTGCGGACCATC
GTCTTCGCCAGCTGGGACGGCGAGGAGTACGCGCTGATCGGCAGCACCGAGTGGGTGGAGGAGTACCTGCCGTGG
CTCAGCGAGGCCAACGTGGCCTACGTCAACGTCGACATCGGCACGTCGGGCCCGGACCTGCAGGTGTCGGCCGCG
CCGCTGCTGCACCGCGTCTTCCGCAACGTCAGCCACATGGTGCCGTCGCCGAACCAGACGGTGCCGGGCCAGACG
GTCGGCGACGTCTGGCGCGGCCCGATCAGCACCATGGGCAGCGGCAGCGACTTCACCGCCTTCCAGGACTTCGCC
GGCGTGCCCAGCATCGACCTCAGCTTCCAGGGCTCGCCGCGCGACGCCGTCTACCACTACCACAGCAACTACGAC
AGCTTCCACTGGATGGACCGCTACGGCGACCCGGGCTTCCGCTACCACAAGGCCATGGCCCAGCTGGTCGGCCTG
CTGGTCGGCGAGCTCAGCGACAGCATCGTCATCCCCTTCGGCGCCGCCGACTACGCCGACGCCCTGCTCGGCTAC
CTCGACCGCGTCGACGACCGGCTCCGGTCGCGCACGGCGACGGCCGCCCGCCCCCCGCCCCGCGACGTCACGGGC
AGCGCCTCCGCGCTGGAGGAGAGCCTGGCCGCGCTGCGCCGCTCCCTCGCCGAGCTGCGCACCCGCGCCGGCGAG
CTCGACGACCGCGCCGCCTGGGCCAACCGCCGCCTCGAGGCCGGCGTCCCGTGGTGGAACGTGGCCGGCAAGATC
TGGCTGTGGATCACCATCGCCAACGTCAACACGCAGTACAAGCACCTCGAGCGCAGCTTCCTCTTCGAGGCCGGC
CTCGACGGCCGGAGCTGGTTCAAGCACGTCGTCTTCGCGCCGGGGCTCTGGACGGGCTATGCCGGAGACGTCTAC
CCCGGCCTGATGGAGAGCATCGACGCGGCCGACTACAACAACGGCCTGAAGTGGGCGGGCATCATCGGCCGCTGC
GTCAAGCGCGCCATCCGCGGCATCGAGTGA
Gene >Hirsu2|7376
ATGGCCCCCCACGCCGCCGAGAGGACGCCTCTCATCCAGACGGTCCGCATCGGCCCCCCCGTCAGGCGATACCCG
CACCAGACCTGCCGCCGCTTCTGCACCATCGCCTGCGCCTCGCTGCTCACTGCCGGCTTTCTCTTCTTCCTCATC
CATGCCTTCTTCATCTGGCCCCATCACCACCACCACGGCCCGCAGAGCCGCTACTCGCTCTCCCGCCACGGCGGC
CGTTCCCTCAGCCACGACCGCCTCAACGCCATCCTCCTCGCCACGCCCGAGCCCGAGCGCGCCCGGGAATGGAGC
CGGTACTACGCCTCCGGGCCTCACCTGGCCGGCAAGAACTATTCTCAGGTACCGCCGCCCGAGACCCTCGAGATG
CCCAGCCTCTTCCGTTGCTGAGCTTTCCCCCCCCCCTCTCTAGGCCAAGTGGACCATGGAAAAGTGGCAGGACTG
GGGCCTGCAGTCGACCATTGTCCCCTACGAATCCTACATCAACTATCCCGTCGACCATAGCCTGGCCCTCCTGAC
CCGGTCGGACGAGTCCGAGTCGTGGAACGTCGCCTTCCAGGCCTCGCTGGAGGAGGACGTCCTGGACGAGGACCC
CACCACCCAGCTCGACGACAGGATCCCGACCTTCCACGGCTTCTCCGCCAGCGGCAACGCCACCGCCCGCTTCGT
CTACGTCAACTACGGCACCTTCCAGGACTTTGACGACCTGCTGCGCGCCCGTGTCGACCTCGCCGGCAACATCGC
CATCGCCAGGTACGGCAACGTCTTTCGCGGCCTCAAGGTCAAGCGCGCCCAGGAGCTCGGCATGCTGGCCGTCGT
CATGTACAGCGACCCGGGCGACGACGGCGAAATCACAGAGGAGAACGGCTTCGACCCTTATCCCCACGGTCCCGC
GCGGAACCCGAGCAGCGTCCAGCGAGGCAGCGTCCAGTACATCAGCGTCCGGCCCGGCGATCCGTAAGAAGCCCT
TTTACCCCCTCCCCCCCTTAATCGACCGTGTCCGCAGCGTTTGTTTCTTCCTCTCGTCGGCTCCCACTCCCGTTA
CTGACGTTTCGTTTGTCGTCTTCTCGGCAGCTCGACACCGGGCTACCCGTCCAAGCCGGGCTCTCCTCGCGCGCC
GGTGCATGACGCGATCCCCCGCATCCCCTCCATCCCCATCTCCTACGCGGACGCGATTCCGATCCTCAAGGCCCT
CAACGGCCATGGCCCCGACGCGGCCGACATGGGCGAAGCGTGGAAGCGAAACGTGGGCCTCGGCTACAAGGGCGT
CGACTACAGCATCGGGCCCTCGCCTGCCGGCGTCGTCCTCAACCTGTCGAGCGAGCAGAGCTACACGACGACGCC
GCTGTGGGACGTCATCGGCATCGTCAACGGCACCATCGCCAACGAGGTGCTCGTGCTGGGCAACCACCGCGACGC
CTGGATCGCCGGCGGGGCGGGCGACCCCAACAGCGGCTCGGCCGTGCTCAACGAGGTGATCCGCAGCGTCGGCCG
GGCCGTCGAGGCCGGCTGGAAGCCGCTGCGGACCATCGTCTTCGCCAGCTGGGACGGCGAGGAGTACGCGCTGAT
CGGCAGCACCGAGTGGGTGGAGGAGTACCTGCCGTGGCTCAGCGAGGCCAACGTGGCCTACGTCAACGTCGACAT
CGGCACGTCGGGCCCGGACCTGCAGGTGTCGGCCGCGCCGCTGCTGCACCGCGTCTTCCGCAACGTCAGCCACAT
GGTGCCGTCGCCGAACCAGACGGTGCCGGGCCAGACGGTCGGCGACGTCTGGCGCGGCCCGATCAGCACCATGGG
CAGCGGCAGCGACTTCACCGCCTTCCAGGACTTCGCCGGCGTGCCCAGCATCGACCTCAGCTTCCAGGGCTCGCC
GCGCGACGCCGTCTACCACTACCACAGCAACTACGACAGCTTCCACTGGATGGACCGCTACGGCGACCCGGGCTT
CCGCTACCACAAGGCCATGGCCCAGCTGGTCGGCCTGCTGGTCGGCGAGCTCAGCGACAGCATCGTCATCCCCTT
CGGCGCCGCCGACTACGCCGACGCCCTGCTCGGCTACCTCGACCGCGTCGACGACCGGCTCCGGTCGCGCACGGC
GACGGCCGCCCGCCCCCCGCCCCGCGACGTCACGGGCAGCGCCTCCGCGCTGGAGGAGAGCCTGGCCGCGCTGCG
CCGCTCCCTCGCCGAGCTGCGCACCCGCGCCGGCGAGCTCGACGACCGCGCCGCCTGGGCCAACCGCCGCCTCGA
GGCCGGCGTCCCGTGGTGGAACGTGGCCGGCAAGATCTGGCTGTGGATCACCATCGCCAACGTCAACACGCAGTA
CAAGCACCTCGAGCGCAGCTTCCTCTTCGAGGCCGGCCTCGACGGCCGGAGCTGGTTCAAGCACGTCGTCTTCGC
GCCGGGGCTCTGGACGGGCTATGCCGGAGGTGAGTTGTCCCCTTTTGGGGGGGGGGGGAGTCGTCCCGTGCGACA
CCTTGTTGTCTATCCGTCCCGGCAGCTGACGCGACGCCCGCCAGACGTCTACCCCGGCCTGATGGAGAGCATCGA
CGCGGCCGACTACAACAACGGCCTGAAGTGGGCGGGCATCATCGGCCGCTGCGTCAAGCGCGCCATCCGCGGCAT
CGAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail