Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|736
Gene name
LocationContig_115:22345..28368
Strand-
Gene length (bp)6023
Transcript length (bp)5895
Coding sequence length (bp)5895
Protein length (aa) 1965

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13513 HEAT_EZ HEAT-like repeat 1.3E-07 782 835
PF13646 HEAT_2 HEAT repeats 2.2E-06 771 863
PF10274 ParcG Parkin co-regulated protein 1.4E-04 1530 1646

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33892|GCN1_YEAST Translational activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN1 PE=1 SV=1 3 1958 0.0E+00
sp|Q10105|GCN1_SCHPO Translational activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn1 PE=3 SV=1 4 1955 0.0E+00
sp|Q92616|GCN1L_HUMAN Translational activator GCN1 OS=Homo sapiens GN=GCN1L1 PE=1 SV=6 1 1735 0.0E+00
sp|Q54WR2|GCN1L_DICDI Translational activator gcn1 OS=Dictyostelium discoideum GN=gcn1l1 PE=3 SV=1 302 1921 0.0E+00
sp|O94489|EF3_SCHPO Elongation factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 699 959 1.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33892|GCN1_YEAST Translational activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN1 PE=1 SV=1 3 1958 0.0E+00
sp|Q10105|GCN1_SCHPO Translational activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn1 PE=3 SV=1 4 1955 0.0E+00
sp|Q92616|GCN1L_HUMAN Translational activator GCN1 OS=Homo sapiens GN=GCN1L1 PE=1 SV=6 1 1735 0.0E+00
sp|Q54WR2|GCN1L_DICDI Translational activator gcn1 OS=Dictyostelium discoideum GN=gcn1l1 PE=3 SV=1 302 1921 0.0E+00
sp|O94489|EF3_SCHPO Elongation factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef3 PE=1 SV=1 699 959 1.0E-26
sp|P29551|EF3_PNECA Elongation factor 3 OS=Pneumocystis carinii GN=TEF3 PE=3 SV=1 701 967 4.0E-20
sp|P25997|EF3_CANAL Elongation factor 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEF3 PE=1 SV=2 642 966 5.0E-20
sp|P16521|EF3A_YEAST Elongation factor 3A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEF3 PE=1 SV=4 725 994 2.0E-17
sp|O14134|ELF1_SCHPO mRNA export factor elf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=elf1 PE=1 SV=1 683 954 2.0E-17
sp|P53978|EF3B_YEAST Elongation factor 3B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEF3 PE=1 SV=2 725 966 1.0E-16
sp|O93796|EF3_CANGA Elongation factor 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEF3 PE=3 SV=2 651 996 1.0E-15
sp|Q75EV6|EF3_ASHGO Elongation factor 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF3 PE=3 SV=2 725 985 3.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|736
MSIDPGSLAHSHLDDLLNEIWTRTSFDQQSDVVRQAAYNAAAELAFVAPDAVIPRLMELVSSDLDAGQLRDIGPV
EAAIFRTPEGTCFVDVLAKKKQNVVPNKNSKDYDILKWEEDLRIQLEQKRGQQRKLTAEETSKVNAQLKMESQLR
NSIRKVEANLIRGVGTIKALATGPPTDATLWLGSAVALLLGISDAGAGLIIGDAASLAYIVCSERVAARLGPIRP
FIGVATLRIRGVTLSEDYDQERLEDLVTRVLYRLRFAGEQRPFDVVSLIYVLPLVLDVLRRGGFGEAADDRDAQL
VLALEFLSFHTDVCEDEATPRAKVLEVLIQAMQNYAQHYKLVKDCFADICRCIAPNIGQGEMVVLAKGATVSQAG
VRTTVLQSISAEVDMSELNYSDEIWLACHDDVEENQELGKEVWEESGFETNASVPMGMIPYLESKDSQLRRAAAR
SLADAAQSHVQCLDEVISKLKKLYLEFAKPKVQQLDEFGMPKKMDLSDPWEARQGIATAFKELSSVMNKKQIDEL
FNFLIEAGPLADKSDSVRGEMLDAAIRATEVHGKGMIEQLMKKFEHTLEQPDKNSEAADRVNEAVIIMYGALARH
LSPGDSKIPVVIERLLATLSTPSETVQYAIAECLPPLVRACADKSAKYFNRVMDELLNSKKYAVQRGAAYGLAGL
VLGRGISSLREYRILSTLKGAAENKKDANQREASLLAFELLSVILGRLFEPYVIQIVPLLLSGFGDTNGDVRDAC
LAAAKACFGKLSSYGVKQIMPTLLEGLDDQQWRSKRGACDLLGAMAYLDPNQLANSLPDIIPPLTGVLNDSHKEV
RAAANRSLKRFGEVISNPEIKGLVDVLLKALSDPTKYTDEALDSLIKVQFIHYLDAPSLALITRILQRGLSDRSN
TKRKAAQVIGSLAHLTEKKDIVAHLPILVAGLKTAAVDPVPTTRATASRALGSLVEKLGEDALPDLIPGLMQTLK
SDTGAGDRLGSAQALSEVLAGLGTTRLEETLPTILQNVESSKAAVREGFMSLFIFLPVCFGNSFSNYLGRIVPPI
LAGLADDVESIRETALRAGRLLVKNFAMRAIDLLLPELERGLADDSYRIRLSSVELVGDLLFNLTGVKANTEDED
EDDEDDGKEAGASLKEVLGEEKRNKILSALYVCRCDTAGAVRSAAIAVWKVLVPSPRTLKELVPTLTHLLIRRLG
SANMEHKVIASNALGELIRKAGDGVLSSLLPTLEQGLQASTDSDAKQGICLALRELISSASAEALEDHEKTLISV
VRTALTDSDEEVREAAAEAFDSLQQILGKRAVDQVLPYLLNLLRSETEADNALSALLTLLTETTRSNIILPNLIP
TLTTPPISAFDAKALASLSRVAGAAMNRRLPNIINSLMDNEISCQEDGLRAELEASFDTVVQSIDEYDGLNTVMN
VLLGLFKHEDHRRRASTARHLGNFFSATSVDYSRYNQDIIRSLLNSFDDGDMDVVKAAWAALSQFTKNLRKEEME
SLVVSTRQTLQRVGVPGANLRGFELPKGINAILPIFLQGLMNGTAEQRVQAALGISDIVDRTSEASLKPFVTQIT
GPLIRVVSERATEVKSAILLTLNNLLEKMPTALKPFLPQLQRTFAKSLADTSSETLRSRAAKALGTLIRYTPRVD
PLIAELVTGSKTTDPGVKTAMLKALFEVISRAGSNMGETSRSAVLSLIDTEADGRDDTMTITNAKLLGALIKNVP
EEAATSLLKHRVVTTNCSVSSAIALNAVLVESPDTLLQSPLADELPDLLCQGMVHKNTYISDNFILATGKVLLSS
PPKSFDSTKRIFETLATIIEPGNPTDSRRLALVIARTLSRINMDMVRPHLPLLAPPVFASVRDLVIPVKLAAEAA
FVELFSVADEESRVFDKFVAGPGADLPANTKRSMSDYFKRVAVRLGTQARERREAEGGQGGLGLSNDEQEDEKEI
WSVGKLEVAGESLS*
Coding >Hirsu2|736
ATGTCTATCGACCCCGGGAGTCTCGCCCACAGTCATTTAGACGACCTCTTGAATGAGATCTGGACGAGGACGTCG
TTCGACCAGCAGTCGGATGTTGTCAGGCAAGCCGCGTACAATGCCGCCGCCGAACTAGCTTTTGTCGCACCCGAC
GCGGTCATTCCACGACTGATGGAGCTCGTAAGCAGCGACTTAGATGCTGGTCAGTTGCGCGACATTGGCCCCGTG
GAAGCCGCCATCTTCAGGACGCCAGAAGGCACTTGCTTTGTCGACGTCCTCGCGAAAAAGAAGCAGAATGTGGTT
CCGAACAAGAACAGCAAAGACTACGACATCCTCAAGTGGGAAGAGGATCTCAGGATACAGCTGGAGCAGAAAAGG
GGGCAGCAGCGAAAGCTCACGGCGGAAGAGACATCGAAAGTGAACGCTCAGCTGAAGATGGAATCGCAACTGAGG
AATTCGATCCGGAAAGTCGAGGCGAATCTGATACGTGGCGTCGGTACCATCAAAGCTCTGGCAACTGGACCCCCA
ACAGATGCGACCCTCTGGCTCGGTTCCGCCGTCGCGTTGCTGCTGGGCATCTCTGACGCCGGTGCTGGCCTCATC
ATAGGAGATGCGGCTTCGTTGGCTTACATTGTCTGTTCCGAAAGAGTGGCGGCCCGGCTAGGGCCTATTCGGCCG
TTCATCGGGGTGGCGACTCTAAGAATCAGGGGAGTCACGCTTTCCGAGGACTATGACCAGGAACGCCTCGAGGAT
CTTGTTACAAGGGTGCTGTACCGTCTCCGTTTTGCCGGAGAGCAGCGACCCTTTGACGTCGTCTCCCTGATATAC
GTCTTGCCACTGGTGTTGGATGTTCTGCGCCGGGGCGGCTTTGGAGAGGCCGCCGACGATCGAGACGCGCAACTT
GTGCTGGCGTTGGAGTTCCTTTCGTTCCACACTGACGTCTGCGAGGACGAAGCTACGCCGCGCGCCAAAGTTCTG
GAAGTTCTCATCCAGGCGATGCAGAACTACGCGCAGCATTATAAACTCGTCAAGGATTGCTTTGCCGACATTTGT
CGGTGCATAGCGCCCAACATAGGCCAAGGCGAGATGGTGGTCTTGGCGAAAGGAGCTACTGTGTCCCAGGCCGGC
GTCAGGACAACGGTACTGCAGTCCATCAGTGCTGAGGTCGATATGAGCGAGCTCAACTACTCTGATGAGATATGG
CTGGCGTGTCACGATGATGTCGAAGAAAACCAGGAACTCGGCAAAGAAGTTTGGGAAGAGAGTGGCTTCGAAACC
AATGCCTCGGTTCCCATGGGGATGATACCGTATTTGGAGAGCAAGGACTCCCAGCTACGCAGGGCAGCGGCGCGC
TCTCTGGCCGATGCGGCCCAGTCACACGTGCAGTGCCTGGACGAGGTCATTTCCAAACTCAAGAAGTTGTACCTG
GAGTTTGCCAAGCCCAAAGTGCAACAACTCGATGAGTTCGGGATGCCCAAGAAGATGGACCTGTCCGACCCATGG
GAGGCCAGGCAAGGCATCGCGACGGCTTTCAAGGAACTTTCCTCGGTCATGAACAAAAAGCAGATTGACGAGCTC
TTCAACTTCCTCATTGAGGCAGGTCCGCTCGCTGACAAGAGCGATTCGGTCCGAGGAGAAATGCTAGATGCTGCC
ATTCGGGCCACCGAGGTCCACGGGAAGGGAATGATCGAGCAGCTGATGAAGAAGTTCGAGCACACTTTGGAACAG
CCTGACAAAAACAGCGAGGCGGCTGATCGGGTGAATGAAGCGGTCATCATCATGTACGGGGCTCTGGCGCGGCAC
TTGTCTCCGGGAGACTCCAAGATCCCCGTGGTCATTGAGCGGCTGCTGGCAACGCTGAGCACACCATCCGAGACT
GTACAGTACGCGATTGCCGAGTGCCTTCCCCCGCTCGTCAGGGCCTGTGCAGACAAGTCGGCCAAGTACTTCAAT
CGGGTGATGGATGAGCTTCTTAACTCCAAGAAGTACGCTGTCCAGAGAGGTGCAGCGTATGGATTGGCAGGGTTG
GTACTGGGGAGAGGAATCTCGTCGCTTCGGGAATACCGCATTCTGTCCACACTCAAAGGAGCCGCGGAGAACAAG
AAGGATGCGAATCAAAGAGAGGCGTCCTTGCTGGCATTTGAGCTTCTGTCGGTGATACTGGGCCGACTTTTCGAG
CCGTACGTCATTCAGATCGTGCCCTTGCTTCTGAGCGGCTTCGGCGACACAAACGGTGACGTGCGAGACGCCTGT
CTCGCCGCTGCCAAGGCGTGCTTCGGAAAGCTTAGCTCCTACGGCGTCAAGCAGATAATGCCCACCCTTTTGGAA
GGGCTCGACGATCAGCAATGGCGCAGCAAACGAGGAGCGTGCGACCTTTTGGGTGCCATGGCATATCTTGACCCG
AACCAGCTAGCCAACAGCCTGCCGGACATCATCCCTCCCTTGACTGGCGTCCTGAACGACAGCCACAAGGAGGTG
CGGGCCGCCGCCAACCGCAGTCTGAAGCGCTTCGGTGAAGTTATCAGCAACCCAGAAATCAAGGGGCTGGTGGAC
GTGCTCCTGAAAGCGCTCAGCGACCCTACAAAGTATACGGACGAGGCTCTGGACTCCCTGATCAAGGTGCAGTTC
ATACACTATCTCGATGCCCCCTCGCTCGCCTTGATCACCCGTATCCTGCAGCGTGGCCTGAGCGACCGCTCCAAC
ACCAAACGCAAGGCTGCCCAGGTCATTGGTAGCTTGGCCCACTTGACGGAGAAAAAGGACATAGTTGCTCATCTC
CCGATCCTCGTCGCCGGGCTCAAGACTGCCGCCGTTGATCCGGTGCCGACGACCCGCGCCACTGCGTCGAGGGCG
CTCGGCTCCCTGGTCGAGAAGCTTGGCGAAGATGCTCTGCCCGACCTCATCCCCGGCTTGATGCAGACCCTCAAG
TCGGACACCGGCGCAGGCGACCGCCTCGGATCCGCCCAGGCCCTCAGCGAGGTGTTGGCCGGCCTGGGGACGACG
AGGCTGGAGGAGACGCTGCCAACGATCCTCCAGAACGTCGAGTCGTCCAAGGCGGCAGTCCGGGAGGGTTTCATG
TCACTCTTCATCTTCCTGCCTGTCTGCTTCGGAAACAGCTTTTCCAACTACCTGGGTCGCATCGTCCCGCCCATC
CTGGCCGGGTTGGCTGACGACGTTGAATCGATCCGTGAAACTGCCCTTCGAGCTGGCAGGCTCCTCGTCAAGAAC
TTTGCCATGCGGGCTATCGATCTGCTTCTACCAGAGCTTGAGAGGGGTCTAGCGGACGACAGCTACCGGATCCGT
CTCAGCTCCGTCGAGCTTGTCGGCGACCTCCTCTTCAACCTCACCGGCGTCAAGGCAAACACCGAGGACGAGGAC
GAGGACGATGAGGACGATGGGAAAGAGGCGGGCGCATCCCTCAAGGAGGTCCTCGGGGAAGAGAAGCGCAACAAG
ATCCTTTCCGCACTCTATGTGTGTCGTTGCGATACCGCCGGAGCCGTTCGCTCGGCGGCCATTGCCGTGTGGAAA
GTTCTCGTGCCCAGCCCCAGAACGCTTAAGGAGCTCGTCCCGACCCTCACGCACCTCCTCATCAGGCGCTTGGGT
AGCGCCAACATGGAGCACAAAGTCATCGCAAGCAACGCACTTGGGGAGCTCATCCGGAAGGCCGGCGATGGAGTT
CTGTCCAGCTTGCTGCCGACCTTGGAGCAAGGCCTGCAGGCGTCCACGGACTCGGACGCGAAGCAGGGCATTTGT
CTCGCCCTTCGAGAGCTCATCTCGTCGGCGTCGGCCGAGGCATTGGAAGACCACGAGAAGACGCTCATCTCCGTC
GTGCGCACCGCGCTCACGGACTCGGACGAGGAAGTCAGAGAAGCCGCTGCGGAGGCGTTCGACTCGTTACAGCAG
ATTCTCGGCAAACGAGCCGTCGACCAGGTTCTCCCCTACCTTCTCAACCTTCTCCGGTCCGAAACCGAGGCAGAC
AATGCGCTGTCGGCTCTCCTCACGCTTCTCACTGAGACCACGCGCTCCAATATCATTCTTCCCAACCTCATCCCG
ACTCTGACCACGCCGCCAATCTCCGCATTCGATGCCAAGGCTCTGGCCTCCTTATCTCGGGTTGCCGGAGCTGCC
ATGAACAGACGACTGCCCAACATCATCAACTCCTTGATGGACAATGAGATCAGCTGCCAGGAAGACGGCCTGCGG
GCAGAGCTGGAGGCGTCGTTCGACACGGTCGTCCAGTCTATCGACGAGTACGACGGCCTCAATACGGTAATGAAC
GTTCTTCTCGGACTCTTCAAGCACGAGGACCACAGACGAAGGGCTTCGACGGCACGCCACCTTGGGAACTTCTTC
TCTGCGACATCGGTTGACTACTCCCGTTACAACCAAGACATCATCCGCTCGTTGCTCAACTCGTTTGACGATGGC
GACATGGACGTTGTCAAGGCAGCCTGGGCAGCCCTCAGCCAGTTCACAAAGAACCTGAGAAAGGAGGAGATGGAA
TCGCTCGTCGTGTCGACTCGGCAGACGCTGCAACGGGTTGGCGTCCCGGGGGCGAACCTTCGCGGATTCGAGCTT
CCCAAGGGCATCAACGCCATTCTACCCATCTTCCTGCAGGGCCTGATGAACGGGACAGCTGAGCAGAGAGTCCAG
GCAGCGCTCGGCATCTCGGACATTGTTGACCGAACAAGCGAGGCGTCGCTCAAGCCGTTCGTCACCCAGATCACA
GGACCACTCATCCGCGTCGTGTCAGAGCGCGCCACCGAGGTCAAGTCGGCCATCCTCCTCACTCTCAACAACCTC
TTGGAGAAGATGCCCACGGCTCTCAAGCCTTTCCTGCCGCAATTGCAACGAACCTTTGCCAAGTCCCTGGCGGAC
ACATCCAGCGAAACACTAAGGTCGAGGGCGGCGAAGGCGTTGGGGACACTTATCAGGTACACTCCACGCGTCGAT
CCGCTGATCGCCGAGTTGGTCACCGGCTCGAAGACGACGGATCCTGGAGTGAAGACGGCGATGCTCAAGGCACTC
TTCGAGGTCATCAGCAGGGCAGGATCCAACATGGGCGAGACGTCGCGATCGGCTGTGCTCTCTCTAATCGACACG
GAAGCCGACGGGCGAGACGATACGATGACCATCACCAACGCAAAGCTCCTGGGGGCCCTCATCAAAAACGTGCCT
GAAGAGGCCGCGACATCGCTCCTGAAACACAGGGTCGTCACCACCAACTGCAGCGTTTCGTCCGCCATTGCCCTC
AACGCGGTGCTTGTGGAGTCACCGGACACTCTCCTGCAGAGCCCCTTGGCAGACGAACTGCCCGACCTGCTCTGC
CAGGGCATGGTCCACAAGAACACGTACATCTCCGACAATTTCATCCTTGCGACGGGCAAGGTGTTACTTTCGTCT
CCTCCGAAGAGCTTCGACAGCACAAAGAGGATCTTCGAGACCTTGGCGACGATCATCGAGCCGGGGAACCCGACC
GACTCTCGCCGGCTAGCTCTGGTAATCGCGCGAACGCTCAGCAGGATTAACATGGACATGGTCCGGCCCCATCTG
CCGCTCTTGGCGCCTCCCGTCTTCGCCAGCGTCAGAGACCTCGTCATCCCCGTGAAGCTCGCGGCCGAGGCCGCC
TTTGTGGAACTGTTCAGTGTGGCAGACGAAGAGAGCCGCGTGTTCGACAAGTTCGTGGCTGGTCCGGGGGCAGAC
CTGCCGGCGAACACGAAGCGAAGCATGAGCGACTACTTCAAAAGGGTGGCCGTAAGGCTCGGAACACAGGCTCGG
GAGAGGAGGGAGGCGGAAGGGGGCCAAGGCGGTTTGGGGCTCTCCAATGACGAGCAGGAGGACGAGAAGGAGATT
TGGAGCGTCGGGAAGCTGGAGGTCGCCGGAGAGAGCCTTTCCTGA
Transcript >Hirsu2|736
ATGTCTATCGACCCCGGGAGTCTCGCCCACAGTCATTTAGACGACCTCTTGAATGAGATCTGGACGAGGACGTCG
TTCGACCAGCAGTCGGATGTTGTCAGGCAAGCCGCGTACAATGCCGCCGCCGAACTAGCTTTTGTCGCACCCGAC
GCGGTCATTCCACGACTGATGGAGCTCGTAAGCAGCGACTTAGATGCTGGTCAGTTGCGCGACATTGGCCCCGTG
GAAGCCGCCATCTTCAGGACGCCAGAAGGCACTTGCTTTGTCGACGTCCTCGCGAAAAAGAAGCAGAATGTGGTT
CCGAACAAGAACAGCAAAGACTACGACATCCTCAAGTGGGAAGAGGATCTCAGGATACAGCTGGAGCAGAAAAGG
GGGCAGCAGCGAAAGCTCACGGCGGAAGAGACATCGAAAGTGAACGCTCAGCTGAAGATGGAATCGCAACTGAGG
AATTCGATCCGGAAAGTCGAGGCGAATCTGATACGTGGCGTCGGTACCATCAAAGCTCTGGCAACTGGACCCCCA
ACAGATGCGACCCTCTGGCTCGGTTCCGCCGTCGCGTTGCTGCTGGGCATCTCTGACGCCGGTGCTGGCCTCATC
ATAGGAGATGCGGCTTCGTTGGCTTACATTGTCTGTTCCGAAAGAGTGGCGGCCCGGCTAGGGCCTATTCGGCCG
TTCATCGGGGTGGCGACTCTAAGAATCAGGGGAGTCACGCTTTCCGAGGACTATGACCAGGAACGCCTCGAGGAT
CTTGTTACAAGGGTGCTGTACCGTCTCCGTTTTGCCGGAGAGCAGCGACCCTTTGACGTCGTCTCCCTGATATAC
GTCTTGCCACTGGTGTTGGATGTTCTGCGCCGGGGCGGCTTTGGAGAGGCCGCCGACGATCGAGACGCGCAACTT
GTGCTGGCGTTGGAGTTCCTTTCGTTCCACACTGACGTCTGCGAGGACGAAGCTACGCCGCGCGCCAAAGTTCTG
GAAGTTCTCATCCAGGCGATGCAGAACTACGCGCAGCATTATAAACTCGTCAAGGATTGCTTTGCCGACATTTGT
CGGTGCATAGCGCCCAACATAGGCCAAGGCGAGATGGTGGTCTTGGCGAAAGGAGCTACTGTGTCCCAGGCCGGC
GTCAGGACAACGGTACTGCAGTCCATCAGTGCTGAGGTCGATATGAGCGAGCTCAACTACTCTGATGAGATATGG
CTGGCGTGTCACGATGATGTCGAAGAAAACCAGGAACTCGGCAAAGAAGTTTGGGAAGAGAGTGGCTTCGAAACC
AATGCCTCGGTTCCCATGGGGATGATACCGTATTTGGAGAGCAAGGACTCCCAGCTACGCAGGGCAGCGGCGCGC
TCTCTGGCCGATGCGGCCCAGTCACACGTGCAGTGCCTGGACGAGGTCATTTCCAAACTCAAGAAGTTGTACCTG
GAGTTTGCCAAGCCCAAAGTGCAACAACTCGATGAGTTCGGGATGCCCAAGAAGATGGACCTGTCCGACCCATGG
GAGGCCAGGCAAGGCATCGCGACGGCTTTCAAGGAACTTTCCTCGGTCATGAACAAAAAGCAGATTGACGAGCTC
TTCAACTTCCTCATTGAGGCAGGTCCGCTCGCTGACAAGAGCGATTCGGTCCGAGGAGAAATGCTAGATGCTGCC
ATTCGGGCCACCGAGGTCCACGGGAAGGGAATGATCGAGCAGCTGATGAAGAAGTTCGAGCACACTTTGGAACAG
CCTGACAAAAACAGCGAGGCGGCTGATCGGGTGAATGAAGCGGTCATCATCATGTACGGGGCTCTGGCGCGGCAC
TTGTCTCCGGGAGACTCCAAGATCCCCGTGGTCATTGAGCGGCTGCTGGCAACGCTGAGCACACCATCCGAGACT
GTACAGTACGCGATTGCCGAGTGCCTTCCCCCGCTCGTCAGGGCCTGTGCAGACAAGTCGGCCAAGTACTTCAAT
CGGGTGATGGATGAGCTTCTTAACTCCAAGAAGTACGCTGTCCAGAGAGGTGCAGCGTATGGATTGGCAGGGTTG
GTACTGGGGAGAGGAATCTCGTCGCTTCGGGAATACCGCATTCTGTCCACACTCAAAGGAGCCGCGGAGAACAAG
AAGGATGCGAATCAAAGAGAGGCGTCCTTGCTGGCATTTGAGCTTCTGTCGGTGATACTGGGCCGACTTTTCGAG
CCGTACGTCATTCAGATCGTGCCCTTGCTTCTGAGCGGCTTCGGCGACACAAACGGTGACGTGCGAGACGCCTGT
CTCGCCGCTGCCAAGGCGTGCTTCGGAAAGCTTAGCTCCTACGGCGTCAAGCAGATAATGCCCACCCTTTTGGAA
GGGCTCGACGATCAGCAATGGCGCAGCAAACGAGGAGCGTGCGACCTTTTGGGTGCCATGGCATATCTTGACCCG
AACCAGCTAGCCAACAGCCTGCCGGACATCATCCCTCCCTTGACTGGCGTCCTGAACGACAGCCACAAGGAGGTG
CGGGCCGCCGCCAACCGCAGTCTGAAGCGCTTCGGTGAAGTTATCAGCAACCCAGAAATCAAGGGGCTGGTGGAC
GTGCTCCTGAAAGCGCTCAGCGACCCTACAAAGTATACGGACGAGGCTCTGGACTCCCTGATCAAGGTGCAGTTC
ATACACTATCTCGATGCCCCCTCGCTCGCCTTGATCACCCGTATCCTGCAGCGTGGCCTGAGCGACCGCTCCAAC
ACCAAACGCAAGGCTGCCCAGGTCATTGGTAGCTTGGCCCACTTGACGGAGAAAAAGGACATAGTTGCTCATCTC
CCGATCCTCGTCGCCGGGCTCAAGACTGCCGCCGTTGATCCGGTGCCGACGACCCGCGCCACTGCGTCGAGGGCG
CTCGGCTCCCTGGTCGAGAAGCTTGGCGAAGATGCTCTGCCCGACCTCATCCCCGGCTTGATGCAGACCCTCAAG
TCGGACACCGGCGCAGGCGACCGCCTCGGATCCGCCCAGGCCCTCAGCGAGGTGTTGGCCGGCCTGGGGACGACG
AGGCTGGAGGAGACGCTGCCAACGATCCTCCAGAACGTCGAGTCGTCCAAGGCGGCAGTCCGGGAGGGTTTCATG
TCACTCTTCATCTTCCTGCCTGTCTGCTTCGGAAACAGCTTTTCCAACTACCTGGGTCGCATCGTCCCGCCCATC
CTGGCCGGGTTGGCTGACGACGTTGAATCGATCCGTGAAACTGCCCTTCGAGCTGGCAGGCTCCTCGTCAAGAAC
TTTGCCATGCGGGCTATCGATCTGCTTCTACCAGAGCTTGAGAGGGGTCTAGCGGACGACAGCTACCGGATCCGT
CTCAGCTCCGTCGAGCTTGTCGGCGACCTCCTCTTCAACCTCACCGGCGTCAAGGCAAACACCGAGGACGAGGAC
GAGGACGATGAGGACGATGGGAAAGAGGCGGGCGCATCCCTCAAGGAGGTCCTCGGGGAAGAGAAGCGCAACAAG
ATCCTTTCCGCACTCTATGTGTGTCGTTGCGATACCGCCGGAGCCGTTCGCTCGGCGGCCATTGCCGTGTGGAAA
GTTCTCGTGCCCAGCCCCAGAACGCTTAAGGAGCTCGTCCCGACCCTCACGCACCTCCTCATCAGGCGCTTGGGT
AGCGCCAACATGGAGCACAAAGTCATCGCAAGCAACGCACTTGGGGAGCTCATCCGGAAGGCCGGCGATGGAGTT
CTGTCCAGCTTGCTGCCGACCTTGGAGCAAGGCCTGCAGGCGTCCACGGACTCGGACGCGAAGCAGGGCATTTGT
CTCGCCCTTCGAGAGCTCATCTCGTCGGCGTCGGCCGAGGCATTGGAAGACCACGAGAAGACGCTCATCTCCGTC
GTGCGCACCGCGCTCACGGACTCGGACGAGGAAGTCAGAGAAGCCGCTGCGGAGGCGTTCGACTCGTTACAGCAG
ATTCTCGGCAAACGAGCCGTCGACCAGGTTCTCCCCTACCTTCTCAACCTTCTCCGGTCCGAAACCGAGGCAGAC
AATGCGCTGTCGGCTCTCCTCACGCTTCTCACTGAGACCACGCGCTCCAATATCATTCTTCCCAACCTCATCCCG
ACTCTGACCACGCCGCCAATCTCCGCATTCGATGCCAAGGCTCTGGCCTCCTTATCTCGGGTTGCCGGAGCTGCC
ATGAACAGACGACTGCCCAACATCATCAACTCCTTGATGGACAATGAGATCAGCTGCCAGGAAGACGGCCTGCGG
GCAGAGCTGGAGGCGTCGTTCGACACGGTCGTCCAGTCTATCGACGAGTACGACGGCCTCAATACGGTAATGAAC
GTTCTTCTCGGACTCTTCAAGCACGAGGACCACAGACGAAGGGCTTCGACGGCACGCCACCTTGGGAACTTCTTC
TCTGCGACATCGGTTGACTACTCCCGTTACAACCAAGACATCATCCGCTCGTTGCTCAACTCGTTTGACGATGGC
GACATGGACGTTGTCAAGGCAGCCTGGGCAGCCCTCAGCCAGTTCACAAAGAACCTGAGAAAGGAGGAGATGGAA
TCGCTCGTCGTGTCGACTCGGCAGACGCTGCAACGGGTTGGCGTCCCGGGGGCGAACCTTCGCGGATTCGAGCTT
CCCAAGGGCATCAACGCCATTCTACCCATCTTCCTGCAGGGCCTGATGAACGGGACAGCTGAGCAGAGAGTCCAG
GCAGCGCTCGGCATCTCGGACATTGTTGACCGAACAAGCGAGGCGTCGCTCAAGCCGTTCGTCACCCAGATCACA
GGACCACTCATCCGCGTCGTGTCAGAGCGCGCCACCGAGGTCAAGTCGGCCATCCTCCTCACTCTCAACAACCTC
TTGGAGAAGATGCCCACGGCTCTCAAGCCTTTCCTGCCGCAATTGCAACGAACCTTTGCCAAGTCCCTGGCGGAC
ACATCCAGCGAAACACTAAGGTCGAGGGCGGCGAAGGCGTTGGGGACACTTATCAGGTACACTCCACGCGTCGAT
CCGCTGATCGCCGAGTTGGTCACCGGCTCGAAGACGACGGATCCTGGAGTGAAGACGGCGATGCTCAAGGCACTC
TTCGAGGTCATCAGCAGGGCAGGATCCAACATGGGCGAGACGTCGCGATCGGCTGTGCTCTCTCTAATCGACACG
GAAGCCGACGGGCGAGACGATACGATGACCATCACCAACGCAAAGCTCCTGGGGGCCCTCATCAAAAACGTGCCT
GAAGAGGCCGCGACATCGCTCCTGAAACACAGGGTCGTCACCACCAACTGCAGCGTTTCGTCCGCCATTGCCCTC
AACGCGGTGCTTGTGGAGTCACCGGACACTCTCCTGCAGAGCCCCTTGGCAGACGAACTGCCCGACCTGCTCTGC
CAGGGCATGGTCCACAAGAACACGTACATCTCCGACAATTTCATCCTTGCGACGGGCAAGGTGTTACTTTCGTCT
CCTCCGAAGAGCTTCGACAGCACAAAGAGGATCTTCGAGACCTTGGCGACGATCATCGAGCCGGGGAACCCGACC
GACTCTCGCCGGCTAGCTCTGGTAATCGCGCGAACGCTCAGCAGGATTAACATGGACATGGTCCGGCCCCATCTG
CCGCTCTTGGCGCCTCCCGTCTTCGCCAGCGTCAGAGACCTCGTCATCCCCGTGAAGCTCGCGGCCGAGGCCGCC
TTTGTGGAACTGTTCAGTGTGGCAGACGAAGAGAGCCGCGTGTTCGACAAGTTCGTGGCTGGTCCGGGGGCAGAC
CTGCCGGCGAACACGAAGCGAAGCATGAGCGACTACTTCAAAAGGGTGGCCGTAAGGCTCGGAACACAGGCTCGG
GAGAGGAGGGAGGCGGAAGGGGGCCAAGGCGGTTTGGGGCTCTCCAATGACGAGCAGGAGGACGAGAAGGAGATT
TGGAGCGTCGGGAAGCTGGAGGTCGCCGGAGAGAGCCTTTCCTGA
Gene >Hirsu2|736
ATGTCTATCGACCCCGGGAGTCTCGCCCACAGTCATTTAGACGACCTCTTGAATGAGATCTGGACGAGGACGTCG
TTCGACCAGCAGGTATGCTCATCTGGTGCACTCGTTCCGCTCTCATCCATAATCCTCTGACCTGATTCATTCGCA
GTCGGATGTTGTCAGGCAAGCCGCGTACAATGCCGCCGCCGAACTAGCTTTTGTCGCACCCGACGCGGTCATTCC
ACGACTGATGGAGCTCGTAAGCAGCGACTTAGATGCTGGTCAGTTGCGCGACATTGGCCCCGTGGAAGCCGCCAT
CTTCAGGACGCCAGAAGGCACTTGCTTTGTCGACGTCCTCGCGAAAAAGAAGCAGAATGTGGTTCCGAACAAGAA
CAGCAAAGACTACGACATCCTCAAGTGGGAAGAGGATCTCAGGATACAGCTGGAGCAGAAAAGGGGGCAGCAGCG
AAAGCTCACGGCGGAAGAGACATCGAAAGTGAACGCTCAGCTGAAGATGGAATCGCAACTGAGGAATTCGATCCG
GAAAGTCGAGGCGAATCTGATACGTGGCGTCGGTACCATCAAAGCTCTGGCAACTGGACCCCCAACAGATGCGAC
CCTCTGGCTCGGTTCCGCCGTCGCGTTGCTGCTGGGCATCTCTGACGCCGGTGCTGGCCTCATCATAGGAGATGC
GGCTTCGTTGGCTTACATTGTCTGTTCCGAAAGAGTGGCGGCCCGGCTAGGGCCTATTCGGCCGTTCATCGGGGT
GGCGACTCTAAGAATCAGGGGAGTCACGCTTTCCGAGGACTATGACCAGGAACGCCTCGAGGATCTTGTTACAAG
GGTGCTGTACCGTCTCCGTTTTGCCGGAGAGCAGCGACCCTTTGACGTCGTCTCCCTGATATACGTCTTGCCACT
GGTGTTGGATGTTCTGCGCCGGGGCGGCTTTGGAGAGGCCGCCGACGATCGAGACGCGCAACTTGTGCTGGCGTT
GGAGTTCCTTTCGTTCCACACTGACGTCTGCGAGGACGAAGCTACGCCGCGCGCCAAAGTTCTGGAAGTTCTCAT
CCAGGCGATGCAGAACTACGCGCAGCATTATAAACTCGTCAAGGATTGCTTTGCCGACATTTGTCGGTGCATAGC
GCCCAACATAGGCCAAGGCGAGATGGTGGTCTTGGCGAAAGGAGCTACTGTGTCCCAGGCCGGCGTCAGGACAAC
GGTACTGCAGTCCATCAGTGCTGAGGTCGATATGAGCGAGCTCAACTACTCTGATGAGATATGGCTGGCGTGTCA
CGATGATGTCGAAGAAAACCAGGAACTCGGCAAAGAAGTTTGGGAAGAGAGTGGCTTCGAAACCAATGCCTCGGT
TCCCATGGGGATGATACCGTATTTGGAGAGCAAGGACTCCCAGCTACGCAGGGCAGCGGCGCGCTCTCTGGCCGA
TGCGGCCCAGTCACACGTGCAGTGCCTGGACGAGGTCATTTCCAAACTCAAGAAGTTGTACCTGGAGTTTGCCAA
GCCCAAAGTGCAACAACTCGATGAGTTCGGGATGCCCAAGAAGATGGACCTGTCCGACCCATGGGAGGCCAGGCA
AGGCATCGCGACGGCTTTCAAGGAACTTTCCTCGGTCATGAACAAAAAGCAGATTGACGAGCTCTTCAACTTCCT
CATTGAGGCAGGTCCGCTCGCTGACAAGAGCGATTCGGTCCGAGGAGAAATGCTAGATGCTGCCATTCGGGCCAC
CGAGGTCCACGGGAAGGGAATGATCGAGCAGCTGATGAAGAAGTTCGAGCACACTTTGGAACAGCCTGACAAAAA
CAGCGAGGCGGCTGATCGGGTGAATGAAGCGGTCATCATCATGTACGGGGCTCTGGCGCGGCACTTGTCTCCGGG
AGACTCCAAGATCCCCGTGGTCATTGAGCGGCTGCTGGCAACGCTGAGCACACCATCCGAGACTGTACAGTACGC
GATTGCCGAGTGCCTTCCCCCGCTCGTCAGGGCCTGTGCAGACAAGTCGGCCAAGTACTTCAATCGGGTGATGGA
TGAGCTTCTTAACTCCAAGAAGTACGCTGTCCAGAGAGGTGCAGCGTATGGATTGGCAGGGTTGGTACTGGGGAG
AGGAATCTCGTCGCTTCGGGAATACCGCATTCTGTCCACACTCAAAGGAGCCGCGGAGAACAAGAAGGATGCGAA
TCAAAGAGAGGCGTCCTTGCTGGCATTTGAGCTTCTGTCGGTGATACTGGGCCGACTTTTCGAGCCGTACGTCAT
TCAGATCGTGCCCTTGCTTCTGAGCGGCTTCGGCGACACAAACGGTGACGTGCGAGACGCCTGTCTCGCCGCTGC
CAAGGCGTGCTTCGGAAAGCTTAGCTCCTACGGCGTCAAGCAGATAATGCCCACCCTTTTGGAAGGGCTCGACGA
TCAGCAATGGCGCAGCAAACGAGGAGCGTGCGACCTTTTGGGTGCCATGGCATATCTTGACCCGAACCAGCTAGC
CAACAGCCTGCCGGACATCATCCCTCCCTTGACTGGCGTCCTGAACGACAGCCACAAGGAGGTGCGGGCCGCCGC
CAACCGCAGTCTGAAGCGCTTCGGTGAAGTTATCAGCAACCCAGAAATCAAGGGGCTGGTGGACGTGCTCCTGAA
AGCGCTCAGCGACCCTACAAAGTATACGGACGAGGCTCTGGACTCCCTGATCAAGGTGCAGTTCATACACTATCT
CGATGCCCCCTCGCTCGCCTTGATCACCCGTATCCTGCAGCGTGGCCTGAGCGACCGCTCCAACACCAAACGCAA
GGCTGCCCAGGTCATTGGTAGCTTGGCCCACTTGACGGAGAAAAAGGACATAGTTGCTCATCTCCCGATCCTCGT
CGCCGGGCTCAAGACTGCCGCCGTTGATCCGGTGCCGACGACCCGCGCCACTGCGTCGAGGGCGCTCGGCTCCCT
GGTCGAGAAGCTTGGCGAAGATGCTCTGCCCGACCTCATCCCCGGCTTGATGCAGACCCTCAAGTCGGACACCGG
CGCAGGCGACCGCCTCGGATCCGCCCAGGCCCTCAGCGAGGTGTTGGCCGGCCTGGGGACGACGAGGCTGGAGGA
GACGCTGCCAACGATCCTCCAGAACGTCGAGTCGTCCAAGGCGGCAGTCCGGGAGGGTTTCATGTCACTCTTCAT
CTTCCTGCCTGTCTGCTTCGGAAACAGCTTTTCCAACTACCTGGGTCGCATCGTCCCGCCCATCCTGGCCGGGTT
GGCTGACGACGTTGAATCGATCCGTGAAACTGCCCTTCGAGCTGGCAGGCTCCTCGTCAAGAACTTTGCCATGCG
GGCTATCGATCTGCTTCTACCAGAGCTTGAGAGGGGTCTAGCGGACGACAGCTACCGGATCCGTCTCAGCTCCGT
CGAGCTTGTCGGCGACCTCCTCTTCAACCTCACCGGCGTCAAGGCAAACACCGAGGACGAGGACGAGGACGATGA
GGACGATGGGAAAGAGGCGGGCGCATCCCTCAAGGAGGTCCTCGGGGAAGAGAAGCGCAACAAGATCCTTTCCGC
ACTCTATGTGTGTCGTTGCGATACCGCCGGAGCCGTTCGCTCGGCGGCCATTGCCGTGTGGAAAGTTCTCGTGCC
CAGCCCCAGAACGCTTAAGGAGCTCGTCCCGACCCTCACGCACCTCCTCATCAGGCGCTTGGGTAGCGCCAACAT
GGAGCACAAAGTCATCGCAAGCAACGCACTTGGGGAGCTCATCCGGAAGGCCGGCGATGGAGTTCTGTCCAGCTT
GCTGCCGACCTTGGAGCAAGGCCTGCAGGCGTCCACGGACTCGGACGCGAAGCAGGGCATTTGTCTCGCCCTTCG
AGAGCTCATCTCGTCGGCGTCGGCCGAGGCATTGGAAGACCACGAGAAGACGCTCATCTCCGTCGTGCGCACCGC
GCTCACGGACTCGGACGAGGAAGTCAGAGAAGCCGCTGCGGAGGCGTTCGACTCGTTACAGCAGATTCTCGGCAA
ACGAGCCGTCGACCAGGTTCTCCCCTACCTTCTCAACCTTCTCCGGTCCGAAACCGAGGCAGACAATGCGCTGTC
GGCTCTCCTCACGCTTCTCACTGAGACCACGCGCTCCAATATCATTCTTCCCAACCTCATCCCGACTCTGACCAC
GCCGCCAATCTCCGCATTCGATGCCAAGGCTCTGGCCTCCTTATCTCGGGTTGCCGGAGCTGCCATGAACAGACG
ACTGCCCAACATCATCAACTCCTTGATGGACAATGAGATCAGCTGCCAGGAAGACGGCCTGCGGGCAGAGCTGGA
GGCGTCGTTCGACACGGTCGTCCAGTCTATCGACGAGTACGACGGCCTCAATACGGTAATGAACGTTCTTCTCGG
ACTCTTCAAGCACGAGGACCACAGACGAAGGGCTTCGACGGCACGCCACCTTGGGAACTTCTTCTCTGCGACATC
GGTTGACTACTCCCGTTACAACCAAGACATCATCCGCTCGTTGCTCAACTCGTTTGACGATGGCGACATGGACGT
TGTCAAGGCAGCCTGGGCAGCCCTCAGCCAGTTCACAAAGAACCTGAGAAAGGAGGAGATGGAATCGCTCGTCGT
GTCGACTCGGCAGACGCTGCAACGGGTTGGCGTCCCGGGGGCGAACCTTCGCGGATTCGAGCTTCCCAAGGGCAT
CAACGCCATTCTACCCATCTTCCTGCAGGGCCTGATGAACGGGACAGCTGAGCAGAGAGTCCAGGCAGCGCTCGG
CATCTCGGACATTGTTGACCGAACAAGCGAGGCGTCGCTCAAGCCGTTCGTCACCCAGATCACAGGACCACTCAT
CCGCGTCGTGTCAGAGCGCGCCACCGAGGTCAAGTCGGCCATCCTCCTCACTCTCAACAACCTCTTGGAGAAGAT
GCCCACGGCTCTCAAGCCTTTCCTGCCGCAATTGCAACGAACCTTTGCCAAGTCCCTGGCGGACACATCCAGCGA
AACACTAAGGTCGAGGGCGGCGAAGGCGTTGGGGACACTTATCAGGTACACTCCACGCGTCGATCCGCTGATCGC
CGAGTTGGTCACCGGCTCGAAGACGACGGATCCTGGAGTGAAGACGGCGATGCTCAAGGCACTCTTCGAGGTCAT
CAGCAGGGCAGGATCCAACATGGGCGAGACGTCGCGATCGGCTGTGCTCTCTCTAATCGACACGGAAGCCGACGG
GCGAGACGATACGATGACCATCACCAACGCAAAGCTCCTGGGGGCCCTCATCAAAAACGTGCCTGAAGAGGCCGC
GACATCGCTCCTGAAACACAGGGTCGTCACCACCAACTGCAGCGTTTCGTCCGCCATTGCCCTCAACGCGGTGCT
TGTGGAGTCACCGGACACTCTCCTGCAGAGCCCCTTGGCAGACGAACTGCCCGACCTGCTCTGCCAGGGCATGGT
CCACAAGAACGTGAGTGGGGTCCGACCACGGCTGGCTTCGGAGGAAAACATTGGCTGACAGTCTACGGATACAGA
CGTACATCTCCGACAATTTCATCCTTGCGACGGGCAAGGTGTTACTTTCGTCTCCTCCGAAGAGCTTCGACAGCA
CAAAGAGGATCTTCGAGACCTTGGCGACGATCATCGAGCCGGGGAACCCGACCGACTCTCGCCGGCTAGCTCTGG
TAATCGCGCGAACGCTCAGCAGGATTAACATGGACATGGTCCGGCCCCATCTGCCGCTCTTGGCGCCTCCCGTCT
TCGCCAGCGTCAGAGACCTCGTCATCCCCGTGAAGCTCGCGGCCGAGGCCGCCTTTGTGGAACTGTTCAGTGTGG
CAGACGAAGAGAGCCGCGTGTTCGACAAGTTCGTGGCTGGTCCGGGGGCAGACCTGCCGGCGAACACGAAGCGAA
GCATGAGCGACTACTTCAAAAGGGTGGCCGTAAGGCTCGGAACACAGGCTCGGGAGAGGAGGGAGGCGGAAGGGG
GCCAAGGCGGTTTGGGGCTCTCCAATGACGAGCAGGAGGACGAGAAGGAGATTTGGAGCGTCGGGAAGCTGGAGG
TCGCCGGAGAGAGCCTTTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail