Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7358
Gene name
LocationContig_423:6819..8881
Strand-
Gene length (bp)2062
Transcript length (bp)1950
Coding sequence length (bp)1950
Protein length (aa) 650

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.7E-37 164 547

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 125 592 1.0E-164
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 91 594 2.0E-159
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 125 594 4.0E-159
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 125 592 3.0E-158
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 120 592 3.0E-144
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 125 592 1.0E-164
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 91 594 2.0E-159
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 125 594 4.0E-159
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 125 592 3.0E-158
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 120 592 3.0E-144
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 43 594 2.0E-141
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 98 593 2.0E-104
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 130 594 2.0E-97
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 131 594 2.0E-90
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 127 594 2.0E-89
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 125 594 6.0E-89
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 71 592 2.0E-79
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 71 592 3.0E-79
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 127 593 6.0E-74
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 134 594 3.0E-72
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 135 645 5.0E-70
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 130 594 6.0E-70
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 134 594 5.0E-67
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 75 594 6.0E-67
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 134 594 8.0E-63
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 134 594 1.0E-62
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 129 570 5.0E-62
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 135 596 6.0E-59
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 142 596 9.0E-59
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 142 596 1.0E-57
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 141 593 2.0E-45
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 121 596 8.0E-42
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 127 594 2.0E-36
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 99 369 3.0E-21
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 161 439 6.0E-16
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 446 596 2.0E-15
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 66 572 3.0E-15
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 182 337 3.0E-10
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 140 336 5.0E-10
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 52 335 8.0E-10
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 160 338 5.0E-09
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 452 590 6.0E-09
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 138 369 3.0E-08
sp|Q328Z8|MDTL_SHIDS Multidrug resistance protein MdtL OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtL PE=3 SV=1 218 337 2.0E-06
sp|Q8FBV0|MDTL_ECOL6 Multidrug resistance protein MdtL OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtL PE=3 SV=1 218 337 2.0E-06
sp|B7N2F5|MDTL_ECO81 Multidrug resistance protein MdtL OS=Escherichia coli O81 (strain ED1a) GN=mdtL PE=3 SV=1 218 337 2.0E-06
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 218 337 4.0E-06
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 218 337 4.0E-06
sp|B7M562|MDTL_ECO8A Multidrug resistance protein MdtL OS=Escherichia coli O8 (strain IAI1) GN=mdtL PE=3 SV=1 218 337 6.0E-06
sp|A7ZTR5|MDTL_ECO24 Multidrug resistance protein MdtL OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtL PE=3 SV=1 218 337 6.0E-06
sp|Q0SYP9|MDTL_SHIF8 Multidrug resistance protein MdtL OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtL PE=3 SV=1 198 337 6.0E-06
sp|B6I3U3|MDTL_ECOSE Multidrug resistance protein MdtL OS=Escherichia coli (strain SE11) GN=mdtL PE=3 SV=1 218 337 7.0E-06
sp|P31462|MDTL_ECOLI Multidrug resistance protein MdtL OS=Escherichia coli (strain K12) GN=mdtL PE=1 SV=2 218 337 7.0E-06
sp|B1X9T9|MDTL_ECODH Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / DH10B) GN=mdtL PE=3 SV=1 218 337 7.0E-06
sp|C4ZYY8|MDTL_ECOBW Multidrug resistance protein MdtL OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtL PE=3 SV=1 218 337 7.0E-06
sp|B7L855|MDTL_ECO55 Multidrug resistance protein MdtL OS=Escherichia coli (strain 55989 / EAEC) GN=mdtL PE=3 SV=1 218 337 7.0E-06
sp|Q3YWK3|MDTL_SHISS Multidrug resistance protein MdtL OS=Shigella sonnei (strain Ss046) GN=mdtL PE=3 SV=1 218 337 7.0E-06
sp|Q31UW4|MDTL_SHIBS Multidrug resistance protein MdtL OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtL PE=3 SV=1 218 337 7.0E-06
sp|B2TUR5|MDTL_SHIB3 Multidrug resistance protein MdtL OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtL PE=3 SV=1 218 337 7.0E-06
sp|B1IX28|MDTL_ECOLC Multidrug resistance protein MdtL OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtL PE=3 SV=1 218 337 7.0E-06
sp|A8A6H2|MDTL_ECOHS Multidrug resistance protein MdtL OS=Escherichia coli O9:H4 (strain HS) GN=mdtL PE=3 SV=1 218 337 7.0E-06
sp|Q83PL6|MDTL_SHIFL Multidrug resistance protein MdtL OS=Shigella flexneri GN=mdtL PE=3 SV=1 218 337 7.0E-06
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 198 337 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 161 183 22
2 193 215 22
3 222 241 19
4 247 269 22
5 282 304 22
6 319 341 22
7 388 410 22
8 425 444 19
9 465 487 22
10 497 519 22
11 524 546 22
12 561 583 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7358
MPMDIVDRELAAAELDASPDLYRRRASSEIERVVSASSVTTASSHGTNAPPAAGTGGGSGGLVRRNMSRASTQDD
LERHPTELSRIVTQRTQHNATVGSHLGSRSSSRASRRPLPAFGAGKPYPPPLPEREEYVVEFDGPNDPLHAQNWP
LRKKVLTAAMLGYTTMTSAFTSSIFSSATAVVAREYGVGSEVGLLGTTFYVLGFAFGPTLWAPLSELRGRRMPIV
IAMFGFSLFSIACATGKDIQTILICRFFSGFFGACPLAVVAAVFSDMFDNATRGIAVTLFSATVFSGPLLAPFIG
GFIVQSYLGWRWTEYLPSIMGFAAFALDLFFLEETYPPVILVSKAAELRRRTKNWGIHAKQEEIEVDFSELLRKN
FSRPMRLLFTEPIILLLSIYMSFIYGLLYLFLTAYPIVFVGVHGFNLGQSGLTFFGMIIGQLLAGASVIAQQPWY
RRKLAANNGVPVPEWRLPNVMAGGISFTIGIFWFGWTGYKADIHWAVPAASGIFTGFGLMSIFLQALNYIVDAYL
MFAASAIAGNTFLRSLAGAGFPLFARQMFNGMGIQWAATLLGCVAAVLAPIPFIFYLYGAKIRERSSFAPTPPKG
PPEVADEDGADSGGGAAAKEGGGVNAAAAAAMGSVPKRESERAGPIQSV*
Coding >Hirsu2|7358
ATGCCCATGGACATCGTGGACCGTGAGCTCGCCGCGGCCGAGCTCGACGCCTCACCCGACCTCTACCGGCGGCGG
GCCAGCAGCGAGATCGAGCGCGTGGTGTCGGCCTCGTCGGTGACGACGGCCTCGTCGCACGGCACCAATGCGCCG
CCCGCGGCGGGCACGGGCGGCGGCAGCGGCGGCCTCGTGCGGCGCAACATGAGCCGGGCCTCGACGCAGGACGAC
CTCGAGCGGCACCCGACGGAGCTGAGCCGGATCGTGACGCAGCGCACGCAGCACAACGCCACCGTCGGCTCGCAC
CTCGGCAGCCGCTCCAGCAGCCGGGCCTCGCGGCGGCCGCTGCCGGCCTTTGGCGCCGGCAAGCCGTACCCGCCA
CCGCTGCCGGAGCGCGAGGAGTACGTGGTCGAGTTCGACGGGCCCAACGACCCACTGCACGCGCAGAACTGGCCG
CTGCGCAAGAAGGTGCTGACGGCCGCCATGCTCGGCTACACCACCATGACCTCGGCCTTCACCTCGTCCATCTTC
TCGAGCGCGACGGCTGTGGTCGCGCGCGAGTACGGCGTCGGCTCCGAGGTCGGCCTACTAGGCACCACCTTCTAC
GTCCTTGGTTTCGCCTTCGGGCCGACACTGTGGGCGCCGCTGTCGGAGCTCCGCGGCCGGCGGATGCCCATCGTC
ATCGCCATGTTCGGCTTCTCCCTCTTCTCCATCGCCTGCGCCACCGGCAAGGACATCCAGACCATCCTAATCTGC
CGCTTTTTCAGCGGCTTCTTCGGCGCCTGCCCGCTCGCCGTCGTCGCCGCCGTTTTCTCCGACATGTTCGACAAC
GCCACGCGCGGCATCGCCGTCACCCTCTTCTCCGCCACCGTCTTCTCCGGCCCGCTGCTGGCCCCCTTCATCGGC
GGCTTCATCGTTCAGTCGTACCTCGGCTGGCGCTGGACCGAGTACCTGCCCTCCATCATGGGCTTCGCCGCCTTC
GCCCTCGACCTGTTCTTCCTCGAAGAGACGTACCCGCCCGTCATCCTCGTCAGCAAGGCGGCCGAGCTGCGCCGC
CGCACCAAGAACTGGGGCATCCACGCCAAGCAAGAGGAGATCGAGGTCGACTTCTCTGAACTGCTACGCAAGAAC
TTTTCGCGCCCCATGCGCCTGCTCTTCACCGAGCCCATCATCCTGCTGCTCTCCATCTACATGAGCTTCATCTAC
GGCCTGCTCTACCTTTTCCTCACCGCCTACCCCATCGTCTTCGTCGGCGTCCACGGCTTCAACCTCGGTCAGTCC
GGCCTGACCTTCTTCGGCATGATCATCGGCCAGCTCCTTGCCGGCGCCAGCGTCATCGCCCAGCAGCCGTGGTAC
CGCCGCAAGCTGGCCGCCAACAACGGCGTCCCGGTTCCCGAGTGGCGGCTGCCCAACGTCATGGCCGGCGGCATT
TCCTTTACCATTGGCATCTTTTGGTTTGGATGGACTGGATACAAGGCCGACATCCACTGGGCCGTGCCTGCCGCC
AGCGGCATCTTCACCGGCTTCGGCCTCATGTCCATCTTCCTACAGGCGCTCAACTACATCGTGGACGCGTACCTC
ATGTTCGCGGCGTCGGCCATCGCGGGCAACACGTTCCTGCGGTCGCTGGCCGGCGCCGGCTTCCCGCTCTTCGCC
CGGCAGATGTTCAACGGTATGGGCATCCAGTGGGCGGCGACGTTGCTGGGGTGCGTGGCGGCGGTGCTGGCCCCG
ATCCCCTTCATCTTCTACCTGTACGGGGCCAAGATCCGCGAGAGGAGCTCGTTCGCCCCGACGCCGCCCAAAGGC
CCGCCTGAGGTGGCCGACGAAGACGGTGCGGACAGCGGCGGGGGCGCGGCGGCAAAGGAGGGCGGCGGCGTCAAC
GCGGCGGCGGCGGCCGCTATGGGCAGTGTGCCCAAGAGAGAGAGCGAGAGGGCAGGGCCGATCCAGAGCGTCTAG
Transcript >Hirsu2|7358
ATGCCCATGGACATCGTGGACCGTGAGCTCGCCGCGGCCGAGCTCGACGCCTCACCCGACCTCTACCGGCGGCGG
GCCAGCAGCGAGATCGAGCGCGTGGTGTCGGCCTCGTCGGTGACGACGGCCTCGTCGCACGGCACCAATGCGCCG
CCCGCGGCGGGCACGGGCGGCGGCAGCGGCGGCCTCGTGCGGCGCAACATGAGCCGGGCCTCGACGCAGGACGAC
CTCGAGCGGCACCCGACGGAGCTGAGCCGGATCGTGACGCAGCGCACGCAGCACAACGCCACCGTCGGCTCGCAC
CTCGGCAGCCGCTCCAGCAGCCGGGCCTCGCGGCGGCCGCTGCCGGCCTTTGGCGCCGGCAAGCCGTACCCGCCA
CCGCTGCCGGAGCGCGAGGAGTACGTGGTCGAGTTCGACGGGCCCAACGACCCACTGCACGCGCAGAACTGGCCG
CTGCGCAAGAAGGTGCTGACGGCCGCCATGCTCGGCTACACCACCATGACCTCGGCCTTCACCTCGTCCATCTTC
TCGAGCGCGACGGCTGTGGTCGCGCGCGAGTACGGCGTCGGCTCCGAGGTCGGCCTACTAGGCACCACCTTCTAC
GTCCTTGGTTTCGCCTTCGGGCCGACACTGTGGGCGCCGCTGTCGGAGCTCCGCGGCCGGCGGATGCCCATCGTC
ATCGCCATGTTCGGCTTCTCCCTCTTCTCCATCGCCTGCGCCACCGGCAAGGACATCCAGACCATCCTAATCTGC
CGCTTTTTCAGCGGCTTCTTCGGCGCCTGCCCGCTCGCCGTCGTCGCCGCCGTTTTCTCCGACATGTTCGACAAC
GCCACGCGCGGCATCGCCGTCACCCTCTTCTCCGCCACCGTCTTCTCCGGCCCGCTGCTGGCCCCCTTCATCGGC
GGCTTCATCGTTCAGTCGTACCTCGGCTGGCGCTGGACCGAGTACCTGCCCTCCATCATGGGCTTCGCCGCCTTC
GCCCTCGACCTGTTCTTCCTCGAAGAGACGTACCCGCCCGTCATCCTCGTCAGCAAGGCGGCCGAGCTGCGCCGC
CGCACCAAGAACTGGGGCATCCACGCCAAGCAAGAGGAGATCGAGGTCGACTTCTCTGAACTGCTACGCAAGAAC
TTTTCGCGCCCCATGCGCCTGCTCTTCACCGAGCCCATCATCCTGCTGCTCTCCATCTACATGAGCTTCATCTAC
GGCCTGCTCTACCTTTTCCTCACCGCCTACCCCATCGTCTTCGTCGGCGTCCACGGCTTCAACCTCGGTCAGTCC
GGCCTGACCTTCTTCGGCATGATCATCGGCCAGCTCCTTGCCGGCGCCAGCGTCATCGCCCAGCAGCCGTGGTAC
CGCCGCAAGCTGGCCGCCAACAACGGCGTCCCGGTTCCCGAGTGGCGGCTGCCCAACGTCATGGCCGGCGGCATT
TCCTTTACCATTGGCATCTTTTGGTTTGGATGGACTGGATACAAGGCCGACATCCACTGGGCCGTGCCTGCCGCC
AGCGGCATCTTCACCGGCTTCGGCCTCATGTCCATCTTCCTACAGGCGCTCAACTACATCGTGGACGCGTACCTC
ATGTTCGCGGCGTCGGCCATCGCGGGCAACACGTTCCTGCGGTCGCTGGCCGGCGCCGGCTTCCCGCTCTTCGCC
CGGCAGATGTTCAACGGTATGGGCATCCAGTGGGCGGCGACGTTGCTGGGGTGCGTGGCGGCGGTGCTGGCCCCG
ATCCCCTTCATCTTCTACCTGTACGGGGCCAAGATCCGCGAGAGGAGCTCGTTCGCCCCGACGCCGCCCAAAGGC
CCGCCTGAGGTGGCCGACGAAGACGGTGCGGACAGCGGCGGGGGCGCGGCGGCAAAGGAGGGCGGCGGCGTCAAC
GCGGCGGCGGCGGCCGCTATGGGCAGTGTGCCCAAGAGAGAGAGCGAGAGGGCAGGGCCGATCCAGAGCGTCTAG
Gene >Hirsu2|7358
ATGCCCATGGACATCGTGGACCGTGAGCTCGCCGCGGCCGAGCTCGACGCCTCACCCGACCTCTACCGGCGGCGG
GCCAGCAGCGAGATCGAGCGCGTGGTGTCGGCCTCGTCGGTGACGACGGCCTCGTCGCACGGCACCAATGCGCCG
CCCGCGGCGGGCACGGGCGGCGGCAGCGGCGGCCTCGTGCGGCGCAACATGAGCCGGGCCTCGACGCAGGACGAC
CTCGAGCGGCACCCGACGGAGCTGAGCCGGATCGTGACGCAGCGCACGCAGCACAACGCCACCGTCGGCTCGCAC
CTCGGCAGCCGCTCCAGCAGCCGGGCCTCGCGGCGGCCGCTGCCGGCCTTTGGCGCCGGCAAGCCGTACCCGCCA
CCGCTGCCGGAGCGCGAGGAGTACGTGGTCGAGTTCGACGGGCCCAACGACCCACTGCACGCGCAGAACTGGCCG
CTGCGCAAGAAGGTGCTGACGGCCGCCATGCTCGGCTACACCACCATGACCTCGGCCTTCACCTCGTCCATCTTC
TCGAGCGCGACGGCTGTGGTCGCGCGCGAGTACGGCGTCGGCTCCGAGGTCGGCCTACTAGGCACCACCTTCTAC
GTCCTTGGTTTCGCCTTCGGGCCGACACTGTGGGCGCCGCTGTCGGAGCTCCGCGGCCGGCGGATGCCCATCGTC
ATCGCCATGTTCGGCTTCTCCCTCTTCTCCATCGCCTGCGCCACCGGCAAGGACATCCAGACCATCCTAATCTGC
CGCTTTTTCAGCGGCTTCTTCGGCGCCTGCCCGCTCGCCGTCGTCGCCGCCGTTTTCTCCGACATGTTCGACAAC
GCCACGCGCGGCATCGCCGTCACCCTCTTCTCCGCCACCGTCTTCTCCGGCCCGCTGCTGGCCCCCTTCATCGGC
GGCTTCATCGTTCAGTCGTACCTCGGCTGGCGCTGGACCGAGTACCTGCCCTCCATCATGGGCTTCGCCGCCTTC
GCCCTCGACCTGTTCTTCCTCGAAGAGACGTACCCGCCCGTCATCCTCGTCAGCAAGGCGGCCGAGCTGCGCCGC
CGCACCAAGAACTGGGGCATCCACGCCAAGCAAGAGGAGATCGAGGTCGACTTCTCTGAACTGCTACGCAAGAAC
TTTTCGCGCCCCATGCGCCTGCTCTTCACCGAGCCCATCATCCTGCTGCTCTCCATCTACATGAGCTTCATCTAC
GGCCTGCTCTACCTTTTCCTCACCGCCTACCCCATCGTCTTCGTCGGCGTCCACGGCTTCAACCTCGGTCAGTCC
GGCCTGACCTTCTTCGGCATGATCATCGGCCAGCTCCTTGCCGGCGCCAGCGTCATCGCCCAGCAGCCGTGGTAC
CGCCGCAAGCTGGCCGCCAACAACGGCGTCCCGGTTCCCGAGTGGCGGCTGCCCAACGTCATGGCCGGCGGCATT
TCCTTTACCATTGGCATCTTTTGGTTTGGATGGTAAGCCCGTCTCCTTCTTTCGTTGTTCCTTCTTTCTGCTTTC
CCCCAATATACATGTATGTATGCACATGGAGGAGGCATCCTACTTACCTATGTTCGGGGTGTGACACAGGACTGG
ATACAAGGCCGACATCCACTGGGCCGTGCCTGCCGCCAGCGGCATCTTCACCGGCTTCGGCCTCATGTCCATCTT
CCTACAGGCGCTCAACTACATCGTGGACGCGTACCTCATGTTCGCGGCGTCGGCCATCGCGGGCAACACGTTCCT
GCGGTCGCTGGCCGGCGCCGGCTTCCCGCTCTTCGCCCGGCAGATGTTCAACGGTATGGGCATCCAGTGGGCGGC
GACGTTGCTGGGGTGCGTGGCGGCGGTGCTGGCCCCGATCCCCTTCATCTTCTACCTGTACGGGGCCAAGATCCG
CGAGAGGAGCTCGTTCGCCCCGACGCCGCCCAAAGGCCCGCCTGAGGTGGCCGACGAAGACGGTGCGGACAGCGG
CGGGGGCGCGGCGGCAAAGGAGGGCGGCGGCGTCAACGCGGCGGCGGCGGCCGCTATGGGCAGTGTGCCCAAGAG
AGAGAGCGAGAGGGCAGGGCCGATCCAGAGCGTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail