Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7357
Gene name
LocationContig_423:1145..4945
Strand-
Gene length (bp)3800
Transcript length (bp)3639
Coding sequence length (bp)3639
Protein length (aa) 1213

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00168 C2 C2 domain 5.1E-15 491 590
PF00168 C2 C2 domain 2.9E-09 677 806

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USG8|MU190_SCHPO Meiotically up-regulated gene 190 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug190 PE=1 SV=1 78 1212 0.0E+00
sp|Q9UT00|YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPYUK71.03c PE=1 SV=1 247 867 3.0E-17
sp|Q12466|TCB1_YEAST Tricalbin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB1 PE=1 SV=1 247 828 6.0E-17
sp|P48231|TCB2_YEAST Tricalbin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB2 PE=1 SV=1 247 835 2.0E-12
sp|O14065|YC31_SCHPO Uncharacterized protein C962.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC962.01 PE=2 SV=3 247 568 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USG8|MU190_SCHPO Meiotically up-regulated gene 190 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug190 PE=1 SV=1 78 1212 0.0E+00
sp|Q9UT00|YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPYUK71.03c PE=1 SV=1 247 867 3.0E-17
sp|Q12466|TCB1_YEAST Tricalbin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB1 PE=1 SV=1 247 828 6.0E-17
sp|P48231|TCB2_YEAST Tricalbin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB2 PE=1 SV=1 247 835 2.0E-12
sp|O14065|YC31_SCHPO Uncharacterized protein C962.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC962.01 PE=2 SV=3 247 568 4.0E-10
sp|Q9SKR2|SYT1_ARATH Synaptotagmin-1 OS=Arabidopsis thaliana GN=SYT1 PE=1 SV=2 196 595 1.0E-09
sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sapiens GN=ESYT1 PE=1 SV=1 247 550 7.0E-08
sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus musculus GN=Esyt3 PE=2 SV=2 394 590 1.0E-07
sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 247 593 1.0E-07
sp|Q03640|TCB3_YEAST Tricalbin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB3 PE=1 SV=1 247 616 3.0E-07
sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=1 SV=2 247 550 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 196 218 22
2 373 395 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7357
MNVDNHVAPSGQHYSGANRVPNIQQFVEQLDAEKKERDAAIDADLKKKNGSDGKANAEVQDHHNADKPKPKHLRT
VRDPVTGKDVEIRDAQMDFKEAVDNPQLSIPNENLGKPSTVAVSSKQSGEEYRYAQDVTAPPDPIQEGATSDVPI
RSEKTSVLFYPTPSVSYESMFASLEHKANGLCLGIFVAIVFVGKFFGGSLLGLVPLGACVSSGVFLWVKDLVRQG
RDVEWSSEQKRGETATVNLIPESVEWMNTAIGIFWKLINPEMFASVADTLEDVMAASVPGIIENVRVADISQGNN
PIRILNMRALPDSHVQDIKKEIHKENEKKMDPNELAAMEQAGSFYNMEVSMAYHAKPSGEDIASKARNMGMRLVF
YLGIKGLFGVPLPIWVELVGLVATARVRLQLTPDPPFLKTLTVTLMGIPKVQAGCTPMVERGVNILNLPLISNFV
NWAISAAASMYVAPKSLTMDMSKLLLGDDIKKETLALGVMFIRIHKATGLSKQDQRGSRGGGSDPYITVSWSKFS
KPQFCTRVIQDDLNPVFEETCGLLVTSDLIKADEQLSMELWDSDRSSADDVVGKVELSIQKLIQHPGKMFPQISK
LRGVKADSSMPGELHWEVGFFGKTQFRRALRTDGHDAKLPKELADKPELQDEKGTVENREEDGAVHTPPDPLWPS
GVLSVVVHQIVGLELANIKGSNGKRKGREYEPARPEAGEVKEEQSRKLPSSYCTILINDDLVYKTRTKVVSSQPI
FNAGTEKFVRDWRSCIVTVAVRDSRNRQHDPIIGVVPLKLSDILQTSSESTRWYPLDGGIGFGRVRISLLFRSVE
LRLPPPQLGWDIGTFEFLSKSITTTGYAPAKHVKLRLRTGGSSANVKKHLSVRQETGMRIEITGEDGKDAMRLPV
RHRYRSPIFIEFCPAGHRKPDAYAALWLLELTDGEEKDFDIPIFKCDNSVRLSQNYITQENYREIPDLDIEEVGR
VGFRGRFSAGTDMDHIKFVSDNDSRETIEAWETCYAEGVRQQEVHAELPPTVQKLHDESLTQGRDVLAQADEKEK
AKWLAKDGTDWSGAFGKDPRELMASGTETSRSEGSHESDEYDDFAEDDDGGGGGDGEGADLGVKEAPAGSGETDE
VGRRSMDTQETGMTESSQGGSSSKNPIKALKDYKSRSRDLHRKHRGLMQWRPMRNMQFAKDEAKFAIRKVKKLGS
LDGRQPDVETEV*
Coding >Hirsu2|7357
ATGAACGTCGACAACCACGTCGCGCCCTCGGGCCAGCACTACAGCGGTGCCAACCGCGTGCCCAACATCCAACAG
TTCGTCGAGCAGCTCGACGCCGAGAAGAAGGAGCGCGACGCCGCCATCGACGCCGACCTCAAGAAGAAGAACGGC
AGCGACGGCAAGGCCAACGCCGAGGTCCAGGACCACCACAATGCCGACAAGCCCAAGCCCAAGCACCTGCGCACC
GTCCGCGACCCTGTCACCGGCAAGGATGTCGAGATCCGCGATGCCCAAATGGACTTCAAGGAGGCTGTCGACAAC
CCCCAGCTCTCCATCCCCAACGAGAATCTCGGCAAACCCAGCACCGTGGCTGTCTCGTCGAAGCAGTCGGGCGAG
GAGTATCGCTACGCCCAGGACGTGACGGCGCCGCCCGACCCCATCCAGGAGGGCGCCACGTCGGACGTGCCGATC
CGGAGTGAGAAGACGTCGGTCCTGTTCTACCCGACGCCCTCCGTCAGCTACGAGTCCATGTTCGCCTCGCTGGAG
CACAAGGCCAACGGCCTGTGCCTCGGCATCTTCGTCGCCATCGTCTTCGTCGGCAAGTTCTTCGGCGGCAGCCTG
CTCGGCCTCGTCCCCCTCGGCGCCTGCGTCTCCTCCGGCGTCTTCCTCTGGGTCAAGGATCTCGTTCGCCAGGGC
CGAGACGTCGAGTGGTCCAGCGAGCAGAAGCGCGGCGAGACGGCCACCGTCAACCTCATTCCCGAATCCGTCGAG
TGGATGAACACGGCCATCGGCATCTTCTGGAAGCTCATCAACCCCGAGATGTTCGCCTCCGTGGCCGACACCCTG
GAGGATGTCATGGCAGCGTCCGTGCCGGGAATCATTGAGAATGTGCGCGTCGCCGACATATCTCAGGGCAACAAT
CCCATCCGCATCCTCAACATGAGAGCCCTGCCCGACTCCCACGTACAGGACATCAAGAAGGAGATCCACAAGGAG
AACGAGAAGAAGATGGACCCCAACGAGCTGGCTGCCATGGAACAGGCCGGTTCCTTTTACAATATGGAGGTCTCC
ATGGCGTACCACGCCAAGCCGTCCGGCGAGGACATTGCCTCCAAGGCCCGCAACATGGGAATGCGGCTCGTCTTC
TACCTCGGCATCAAGGGCCTCTTCGGCGTCCCCCTGCCTATATGGGTCGAGCTCGTCGGCCTGGTTGCCACGGCC
CGCGTTCGGCTGCAGCTGACGCCCGACCCGCCCTTCCTCAAGACTCTCACCGTCACCCTCATGGGCATCCCCAAG
GTCCAGGCTGGCTGCACGCCCATGGTGGAGAGGGGCGTCAACATCCTCAACCTGCCCCTCATCTCCAACTTCGTC
AACTGGGCCATCAGCGCGGCCGCCTCCATGTACGTGGCGCCCAAGAGCCTGACCATGGACATGAGCAAGTTGCTC
CTGGGAGACGACATCAAGAAGGAGACGCTGGCGCTCGGCGTCATGTTCATCCGCATCCACAAGGCCACCGGCCTC
AGCAAGCAGGACCAGAGGGGCAGCCGCGGCGGTGGCTCCGACCCGTACATCACCGTCAGCTGGAGTAAGTTCTCC
AAGCCGCAGTTCTGCACTCGCGTCATTCAGGACGACCTGAACCCCGTCTTCGAGGAGACGTGCGGCCTGCTCGTC
ACGAGCGACCTCATCAAGGCCGACGAGCAGCTCTCGATGGAGCTCTGGGACAGCGACCGCTCCTCGGCTGACGAC
GTGGTCGGCAAGGTCGAGCTCAGCATCCAGAAGCTCATCCAGCACCCCGGCAAGATGTTCCCGCAAATCTCCAAG
CTCCGCGGCGTCAAGGCCGACAGCAGCATGCCCGGCGAGCTCCACTGGGAGGTTGGCTTCTTCGGCAAGACGCAG
TTCCGGAGGGCGCTCCGGACCGACGGCCACGACGCCAAGCTGCCCAAGGAGCTCGCCGACAAGCCCGAGCTCCAG
GACGAAAAGGGCACCGTCGAGAACCGGGAGGAGGACGGGGCCGTCCACACGCCGCCGGATCCGCTGTGGCCCTCG
GGCGTCCTCAGCGTTGTCGTCCATCAGATCGTCGGGCTCGAGCTCGCCAACATCAAGGGCTCCAACGGGAAGCGC
AAAGGCAGGGAGTACGAGCCGGCGCGGCCCGAGGCCGGCGAGGTCAAGGAGGAGCAGAGCAGGAAGCTGCCGAGC
TCGTACTGCACCATCCTGATCAACGACGATCTGGTGTACAAGACCAGGACCAAGGTGGTCTCGTCCCAGCCCATC
TTCAACGCGGGCACGGAGAAGTTCGTGCGCGACTGGCGCTCCTGCATCGTGACTGTCGCCGTCCGCGATTCGCGC
AACAGGCAACACGATCCCATCATCGGCGTCGTGCCCCTCAAGCTCTCCGACATCCTGCAGACCAGCAGCGAGTCG
ACCCGCTGGTACCCCCTCGACGGCGGCATCGGCTTCGGCCGGGTCCGCATCTCCCTCCTCTTCCGCTCCGTCGAG
CTGCGGCTCCCCCCCCCGCAGCTCGGCTGGGACATCGGCACCTTCGAGTTCCTGTCCAAGTCCATCACCACGACG
GGCTACGCGCCAGCCAAGCACGTCAAGCTGAGGCTGCGGACCGGCGGGTCTTCGGCCAACGTCAAGAAGCACCTC
TCGGTCAGGCAGGAGACGGGCATGAGGATCGAAATCACCGGCGAGGACGGCAAGGACGCGATGCGGCTGCCAGTC
CGCCACCGGTACCGGTCTCCCATCTTCATCGAGTTCTGCCCGGCGGGCCACCGCAAGCCCGACGCCTATGCGGCG
CTCTGGCTCCTCGAACTCACCGACGGCGAGGAGAAGGACTTCGACATCCCCATCTTCAAGTGCGACAACAGCGTG
CGCCTGTCGCAGAACTACATCACGCAGGAGAACTACAGAGAGATACCCGACCTGGACATCGAGGAGGTCGGGCGC
GTCGGCTTCCGGGGCCGGTTCTCCGCCGGGACCGACATGGACCACATCAAGTTCGTGAGCGACAACGACTCCCGC
GAGACGATCGAGGCATGGGAGACCTGCTATGCCGAGGGCGTGCGTCAGCAGGAAGTCCACGCCGAGTTGCCACCC
ACGGTGCAGAAGCTGCACGACGAGTCCCTGACGCAGGGGCGAGACGTGCTCGCGCAGGCCGACGAAAAAGAGAAG
GCGAAGTGGCTGGCCAAGGACGGCACCGACTGGAGCGGCGCCTTTGGCAAGGATCCGAGGGAGCTGATGGCGAGC
GGGACGGAGACGAGTAGGTCGGAAGGAAGCCACGAGAGCGACGAATACGACGACTTTGCCGAGGATGACGACGGC
GGCGGCGGCGGCGACGGCGAAGGCGCCGACCTTGGGGTCAAGGAGGCCCCGGCGGGGTCCGGCGAGACGGACGAG
GTTGGCCGGCGGTCGATGGACACGCAAGAAACCGGCATGACGGAATCGTCGCAGGGTGGCAGCAGCAGCAAGAAC
CCAATCAAGGCGTTGAAGGACTACAAGTCACGCAGCCGCGACCTGCACCGCAAGCACAGGGGCCTGATGCAGTGG
CGGCCGATGCGGAACATGCAGTTTGCCAAGGACGAGGCCAAATTCGCCATCAGGAAGGTGAAGAAGTTGGGGTCT
CTGGACGGGCGACAGCCCGACGTGGAGACGGAGGTCTAG
Transcript >Hirsu2|7357
ATGAACGTCGACAACCACGTCGCGCCCTCGGGCCAGCACTACAGCGGTGCCAACCGCGTGCCCAACATCCAACAG
TTCGTCGAGCAGCTCGACGCCGAGAAGAAGGAGCGCGACGCCGCCATCGACGCCGACCTCAAGAAGAAGAACGGC
AGCGACGGCAAGGCCAACGCCGAGGTCCAGGACCACCACAATGCCGACAAGCCCAAGCCCAAGCACCTGCGCACC
GTCCGCGACCCTGTCACCGGCAAGGATGTCGAGATCCGCGATGCCCAAATGGACTTCAAGGAGGCTGTCGACAAC
CCCCAGCTCTCCATCCCCAACGAGAATCTCGGCAAACCCAGCACCGTGGCTGTCTCGTCGAAGCAGTCGGGCGAG
GAGTATCGCTACGCCCAGGACGTGACGGCGCCGCCCGACCCCATCCAGGAGGGCGCCACGTCGGACGTGCCGATC
CGGAGTGAGAAGACGTCGGTCCTGTTCTACCCGACGCCCTCCGTCAGCTACGAGTCCATGTTCGCCTCGCTGGAG
CACAAGGCCAACGGCCTGTGCCTCGGCATCTTCGTCGCCATCGTCTTCGTCGGCAAGTTCTTCGGCGGCAGCCTG
CTCGGCCTCGTCCCCCTCGGCGCCTGCGTCTCCTCCGGCGTCTTCCTCTGGGTCAAGGATCTCGTTCGCCAGGGC
CGAGACGTCGAGTGGTCCAGCGAGCAGAAGCGCGGCGAGACGGCCACCGTCAACCTCATTCCCGAATCCGTCGAG
TGGATGAACACGGCCATCGGCATCTTCTGGAAGCTCATCAACCCCGAGATGTTCGCCTCCGTGGCCGACACCCTG
GAGGATGTCATGGCAGCGTCCGTGCCGGGAATCATTGAGAATGTGCGCGTCGCCGACATATCTCAGGGCAACAAT
CCCATCCGCATCCTCAACATGAGAGCCCTGCCCGACTCCCACGTACAGGACATCAAGAAGGAGATCCACAAGGAG
AACGAGAAGAAGATGGACCCCAACGAGCTGGCTGCCATGGAACAGGCCGGTTCCTTTTACAATATGGAGGTCTCC
ATGGCGTACCACGCCAAGCCGTCCGGCGAGGACATTGCCTCCAAGGCCCGCAACATGGGAATGCGGCTCGTCTTC
TACCTCGGCATCAAGGGCCTCTTCGGCGTCCCCCTGCCTATATGGGTCGAGCTCGTCGGCCTGGTTGCCACGGCC
CGCGTTCGGCTGCAGCTGACGCCCGACCCGCCCTTCCTCAAGACTCTCACCGTCACCCTCATGGGCATCCCCAAG
GTCCAGGCTGGCTGCACGCCCATGGTGGAGAGGGGCGTCAACATCCTCAACCTGCCCCTCATCTCCAACTTCGTC
AACTGGGCCATCAGCGCGGCCGCCTCCATGTACGTGGCGCCCAAGAGCCTGACCATGGACATGAGCAAGTTGCTC
CTGGGAGACGACATCAAGAAGGAGACGCTGGCGCTCGGCGTCATGTTCATCCGCATCCACAAGGCCACCGGCCTC
AGCAAGCAGGACCAGAGGGGCAGCCGCGGCGGTGGCTCCGACCCGTACATCACCGTCAGCTGGAGTAAGTTCTCC
AAGCCGCAGTTCTGCACTCGCGTCATTCAGGACGACCTGAACCCCGTCTTCGAGGAGACGTGCGGCCTGCTCGTC
ACGAGCGACCTCATCAAGGCCGACGAGCAGCTCTCGATGGAGCTCTGGGACAGCGACCGCTCCTCGGCTGACGAC
GTGGTCGGCAAGGTCGAGCTCAGCATCCAGAAGCTCATCCAGCACCCCGGCAAGATGTTCCCGCAAATCTCCAAG
CTCCGCGGCGTCAAGGCCGACAGCAGCATGCCCGGCGAGCTCCACTGGGAGGTTGGCTTCTTCGGCAAGACGCAG
TTCCGGAGGGCGCTCCGGACCGACGGCCACGACGCCAAGCTGCCCAAGGAGCTCGCCGACAAGCCCGAGCTCCAG
GACGAAAAGGGCACCGTCGAGAACCGGGAGGAGGACGGGGCCGTCCACACGCCGCCGGATCCGCTGTGGCCCTCG
GGCGTCCTCAGCGTTGTCGTCCATCAGATCGTCGGGCTCGAGCTCGCCAACATCAAGGGCTCCAACGGGAAGCGC
AAAGGCAGGGAGTACGAGCCGGCGCGGCCCGAGGCCGGCGAGGTCAAGGAGGAGCAGAGCAGGAAGCTGCCGAGC
TCGTACTGCACCATCCTGATCAACGACGATCTGGTGTACAAGACCAGGACCAAGGTGGTCTCGTCCCAGCCCATC
TTCAACGCGGGCACGGAGAAGTTCGTGCGCGACTGGCGCTCCTGCATCGTGACTGTCGCCGTCCGCGATTCGCGC
AACAGGCAACACGATCCCATCATCGGCGTCGTGCCCCTCAAGCTCTCCGACATCCTGCAGACCAGCAGCGAGTCG
ACCCGCTGGTACCCCCTCGACGGCGGCATCGGCTTCGGCCGGGTCCGCATCTCCCTCCTCTTCCGCTCCGTCGAG
CTGCGGCTCCCCCCCCCGCAGCTCGGCTGGGACATCGGCACCTTCGAGTTCCTGTCCAAGTCCATCACCACGACG
GGCTACGCGCCAGCCAAGCACGTCAAGCTGAGGCTGCGGACCGGCGGGTCTTCGGCCAACGTCAAGAAGCACCTC
TCGGTCAGGCAGGAGACGGGCATGAGGATCGAAATCACCGGCGAGGACGGCAAGGACGCGATGCGGCTGCCAGTC
CGCCACCGGTACCGGTCTCCCATCTTCATCGAGTTCTGCCCGGCGGGCCACCGCAAGCCCGACGCCTATGCGGCG
CTCTGGCTCCTCGAACTCACCGACGGCGAGGAGAAGGACTTCGACATCCCCATCTTCAAGTGCGACAACAGCGTG
CGCCTGTCGCAGAACTACATCACGCAGGAGAACTACAGAGAGATACCCGACCTGGACATCGAGGAGGTCGGGCGC
GTCGGCTTCCGGGGCCGGTTCTCCGCCGGGACCGACATGGACCACATCAAGTTCGTGAGCGACAACGACTCCCGC
GAGACGATCGAGGCATGGGAGACCTGCTATGCCGAGGGCGTGCGTCAGCAGGAAGTCCACGCCGAGTTGCCACCC
ACGGTGCAGAAGCTGCACGACGAGTCCCTGACGCAGGGGCGAGACGTGCTCGCGCAGGCCGACGAAAAAGAGAAG
GCGAAGTGGCTGGCCAAGGACGGCACCGACTGGAGCGGCGCCTTTGGCAAGGATCCGAGGGAGCTGATGGCGAGC
GGGACGGAGACGAGTAGGTCGGAAGGAAGCCACGAGAGCGACGAATACGACGACTTTGCCGAGGATGACGACGGC
GGCGGCGGCGGCGACGGCGAAGGCGCCGACCTTGGGGTCAAGGAGGCCCCGGCGGGGTCCGGCGAGACGGACGAG
GTTGGCCGGCGGTCGATGGACACGCAAGAAACCGGCATGACGGAATCGTCGCAGGGTGGCAGCAGCAGCAAGAAC
CCAATCAAGGCGTTGAAGGACTACAAGTCACGCAGCCGCGACCTGCACCGCAAGCACAGGGGCCTGATGCAGTGG
CGGCCGATGCGGAACATGCAGTTTGCCAAGGACGAGGCCAAATTCGCCATCAGGAAGGTGAAGAAGTTGGGGTCT
CTGGACGGGCGACAGCCCGACGTGGAGACGGAGGTCTAG
Gene >Hirsu2|7357
ATGAACGTCGACAACCACGTCGCGCCCTCGGGCCAGCACTACAGCGGTGCCAACCGCGTGCCCAACATCCAACAG
TTCGTCGAGCAGCTCGACGCCGAGAAGAAGGAGCGCGACGCCGCCATCGACGCCGACCTCAAGAAGAAGAACGGC
AGCGACGGCAAGGCCAACGCCGAGGTCCAGGACCACCACAATGCCGACAAGCCCAAGCCCAAGCACCTGCGCACC
GTCCGCGACCCTGTCACCGGCAAGGATGTCGAGATCCGCGATGCCCAAATGGACTTCAAGGAGGCTGTCGACAAC
CCCCAGGCAAGCGGAACCNNNNNNNCCCCCCCCCCCCCCCCCGTCTATTCTTTTCTGGATGCTCCGGTCCGCTAA
CCAGACATCGCTGCCGTCCCAGCTCTCCATCCCCAACGAGAATCTCGGCAAACCCAGCACCGTGGCTGTCTCGTC
GAAGCAGTCGGGCGAGGAGTATCGCTACGCCCAGGACGTGACGGCGCCGCCCGACCCCATCCAGGAGGGCGCCAC
GTCGGACGTGCCGATCCGGAGTGAGAAGACGTCGGTCCTGTTCTACCCGACGCCCTCCGTCAGCTACGAGTCCAT
GTTCGCCTCGCTGGAGCACAAGGCCAACGGCCTGTGCCTCGGCATCTTCGTCGCCATCGTCTTCGTCGGCAAGTT
CTTCGGCGGCAGCCTGCTCGGCCTCGTCCCCCTCGGCGCCTGCGTCTCCTCCGGCGTCTTCCTCTGGGTCAAGGA
TCTCGTTCGCCAGGGCCGAGACGTCGAGTGGTCCAGCGAGCAGAAGCGCGGCGAGACGGCCACCGTCAACCTCAT
TCCCGAATCCGTCGAGTGGATGAACACGGCCATCGGCATCTTCTGGAAGCTCATCAACCCCGAGATGTTCGCCTC
CGTGGCCGACACGTGAGTCTCGTTCACTTCCCCTTCTCTCTCGCACTCGCTGCTTCCGTAGCTTACGGGACCCGT
CGCACAGCCTGGAGGATGTCATGGCAGCGTCCGTGCCGGGAATCATTGAGAATGTGCGCGTCGCCGACATATCTC
AGGGCAACAATCCCATCCGCATCCTCAACATGAGAGCCCTGCCCGACTCCCACGTACAGGACATCAAGAAGGAGA
TCCACAAGGAGAACGAGAAGAAGATGGACCCCAACGAGCTGGCTGCCATGGAACAGGCCGGTTCCTTTTACAATA
TGGAGGTCTCCATGGCGTACCACGCCAAGCCGTCCGGCGAGGACATTGCCTCCAAGGCCCGCAACATGGGAATGC
GGCTCGTCTTCTACCTCGGCATCAAGGGCCTCTTCGGCGTCCCCCTGCCTATATGGGTCGAGCTCGTCGGCCTGG
TTGCCACGGCCCGCGTTCGGCTGCAGCTGACGCCCGACCCGCCCTTCCTCAAGACTCTCACCGTCACCCTCATGG
GCATCCCCAAGGTCCAGGCTGGCTGCACGCCCATGGTGGAGAGGGGCGTCAACATCCTCAACCTGCCCCTCATCT
CCAACTTCGTCAACTGGGCCATCAGCGCGGCCGCCTCCATGTACGTGGCGCCCAAGAGCCTGACCATGGACATGA
GCAAGTTGCTCCTGGGAGACGACATCAAGAAGGAGACGCTGGCGCTCGGCGTCATGTTCATCCGCATCCACAAGG
CCACCGGCCTCAGCAAGCAGGACCAGAGGGGCAGCCGCGGCGGTGGCTCCGACCCGTACATCACCGTCAGCTGGA
GTAAGTTCTCCAAGCCGCAGTTCTGCACTCGCGTCATTCAGGACGACCTGAACCCCGTCTTCGAGGAGACGTGCG
GCCTGCTCGTCACGAGCGACCTCATCAAGGCCGACGAGCAGCTCTCGATGGAGCTCTGGGACAGCGACCGCTCCT
CGGCTGACGACGTGGTCGGCAAGGTCGAGCTCAGCATCCAGAAGCTCATCCAGCACCCCGGCAAGATGTTCCCGC
AAATCTCCAAGCTCCGCGGCGTCAAGGCCGACAGCAGCATGCCCGGCGAGCTCCACTGGGAGGTTGGCTTCTTCG
GCAAGACGCAGTTCCGGAGGGCGCTCCGGACCGACGGCCACGACGCCAAGCTGCCCAAGGAGCTCGCCGACAAGC
CCGAGCTCCAGGACGAAAAGGGCACCGTCGAGAACCGGGAGGAGGACGGGGCCGTCCACACGCCGCCGGATCCGC
TGTGGCCCTCGGGCGTCCTCAGCGTTGTCGTCCATCAGATCGTCGGGCTCGAGCTCGCCAACATCAAGGGCTCCA
ACGGGAAGCGCAAAGGCAGGGAGTACGAGCCGGCGCGGCCCGAGGCCGGCGAGGTCAAGGAGGAGCAGAGCAGGA
AGCTGCCGAGCTCGTACTGCACCATCCTGATCAACGACGATCTGGTGTACAAGACCAGGACCAAGGTGGTCTCGT
CCCAGCCCATCTTCAACGCGGGCACGGAGAAGTTCGTGCGCGACTGGCGCTCCTGCATCGTGACTGTCGCCGTCC
GCGATTCGCGCAACAGGCAACACGATCCCATCATCGGCGTCGTGCCCCTCAAGCTCTCCGACATCCTGCAGACCA
GCAGCGAGTCGACCCGCTGGTACCCCCTCGACGGCGGCATCGGCTTCGGCCGGGTCCGCATCTCCCTCCTCTTCC
GCTCCGTCGAGCTGCGGCTCCCCCCCCCGCAGCTCGGCTGGGACATCGGCACCTTCGAGTTCCTGTCCAAGTCCA
TCACCACGACGGGCTACGCGCCAGCCAAGCACGTCAAGCTGAGGCTGCGGACCGGCGGGTCTTCGGCCAACGTCA
AGAAGCACCTCTCGGTCAGGCAGGAGACGGGCATGAGGATCGAAATCACCGGCGAGGACGGCAAGGACGCGATGC
GGCTGCCAGTCCGCCACCGGTACCGGTCTCCCATCTTCATCGAGTTCTGCCCGGCGGGCCACCGCAAGCCCGACG
CCTATGCGGCGCTCTGGCTCCTCGAACTCACCGACGGCGAGGAGAAGGACTTCGACATCCCCATCTTCAAGTGCG
ACAACAGCGTGCGCCTGTCGCAGAACTACATCACGCAGGAGAACTACAGAGAGATACCCGACCTGGACATCGAGG
AGGTCGGGCGCGTCGGCTTCCGGGGCCGGTTCTCCGCCGGGACCGACATGGACCACATCAAGTTCGTGAGCGACA
ACGACTCCCGCGAGACGATCGAGGCATGGGAGACCTGCTATGCCGAGGGCGTGCGTCAGCAGGAAGTCCACGCCG
AGTTGCCACCCACGGTGCAGAAGCTGCACGACGAGTCCCTGACGCAGGGGCGAGACGTGCTCGCGCAGGCCGACG
AAAAAGAGAAGGCGAAGTGGCTGGCCAAGGACGGCACCGACTGGAGCGGCGCCTTTGGCAAGGATCCGAGGGAGC
TGATGGCGAGCGGGACGGAGACGAGTAGGTCGGAAGGAAGCCACGAGAGCGACGAATACGACGACTTTGCCGAGG
ATGACGACGGCGGCGGCGGCGGCGACGGCGAAGGCGCCGACCTTGGGGTCAAGGAGGCCCCGGCGGGGTCCGGCG
AGACGGACGAGGTTGGCCGGCGGTCGATGGACACGCAAGAAACCGGCATGACGGAATCGTCGCAGGGTGGCAGCA
GCAGCAAGAACCCAATCAAGGCGTTGAAGGACTACAAGTCACGCAGCCGCGACCTGCACCGCAAGCACAGGGGCC
TGATGCAGTGGCGGCCGATGCGGAACATGCAGTTTGCCAAGGACGAGGCCAAATTCGCCATCAGGAAGGTGAAGA
AGTTGGGGTCTCTGGACGGGCGACAGCCCGACGTGGAGACGGAGGTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail