Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7349
Gene name
LocationContig_422:527..2008
Strand+
Gene length (bp)1481
Transcript length (bp)1263
Coding sequence length (bp)1263
Protein length (aa) 421

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.4E-05 16 40
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.8E-06 46 70
PF00096 zf-C2H2 Zinc finger, C2H2 type 2.9E-04 76 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 14 126 1.0E-30
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 14 126 2.0E-30
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 14 126 2.0E-30
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 14 126 4.0E-30
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 14 126 9.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 14 126 1.0E-30
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 14 126 2.0E-30
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 14 126 2.0E-30
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 14 126 4.0E-30
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 14 126 9.0E-30
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 14 126 1.0E-29
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 15 128 8.0E-29
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 15 128 1.0E-28
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 15 128 1.0E-28
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 3 128 1.0E-28
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 15 128 2.0E-28
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 15 128 2.0E-28
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 15 128 2.0E-28
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 14 128 4.0E-28
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 14 128 5.0E-28
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 14 131 6.0E-28
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 14 128 8.0E-28
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 14 131 1.0E-27
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 14 128 1.0E-27
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 14 128 1.0E-27
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 14 128 2.0E-27
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 3 128 2.0E-27
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 14 128 3.0E-27
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 14 126 3.0E-27
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 14 128 3.0E-27
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 14 131 4.0E-27
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 14 131 4.0E-27
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 23 128 4.0E-27
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 3 128 4.0E-27
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 14 128 4.0E-27
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 14 131 5.0E-27
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 14 131 5.0E-27
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 14 134 5.0E-27
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 14 134 5.0E-27
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 14 126 6.0E-27
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 14 126 6.0E-27
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 14 126 7.0E-27
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 18 128 8.0E-27
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 14 126 8.0E-27
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 14 128 1.0E-26
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 14 128 1.0E-26
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 21 128 1.0E-26
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 14 131 2.0E-26
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 14 171 2.0E-26
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 14 128 2.0E-26
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 2 128 2.0E-26
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 14 132 2.0E-26
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 14 128 2.0E-26
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 14 126 2.0E-26
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 3 128 2.0E-26
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 14 128 3.0E-26
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 2 175 3.0E-26
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 14 128 3.0E-26
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 3 128 3.0E-26
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 14 128 3.0E-26
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 14 128 4.0E-26
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 11 128 4.0E-26
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 14 128 5.0E-26
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 14 128 5.0E-26
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 3 179 5.0E-26
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 14 131 6.0E-26
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 13 128 6.0E-26
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 14 128 6.0E-26
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 14 128 6.0E-26
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 14 128 6.0E-26
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 14 128 6.0E-26
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 21 173 7.0E-26
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 3 179 7.0E-26
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 3 179 7.0E-26
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 14 128 7.0E-26
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 23 128 7.0E-26
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 14 128 7.0E-26
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 11 179 8.0E-26
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 2 128 8.0E-26
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 14 129 9.0E-26
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 14 128 1.0E-25
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 7 179 1.0E-25
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 14 179 1.0E-25
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 14 128 1.0E-25
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 2 128 1.0E-25
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 14 128 1.0E-25
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 14 128 1.0E-25
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 14 128 1.0E-25
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 14 128 1.0E-25
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 14 128 1.0E-25
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 14 179 1.0E-25
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 14 128 1.0E-25
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 14 128 2.0E-25
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 14 128 2.0E-25
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 14 128 2.0E-25
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 14 128 2.0E-25
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 6 128 2.0E-25
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 6 128 2.0E-25
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 14 128 2.0E-25
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 14 136 2.0E-25
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 14 179 2.0E-25
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 15 179 2.0E-25
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 14 128 2.0E-25
sp|Q9H4T2|ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens GN=ZSCAN16 PE=1 SV=2 14 128 2.0E-25
sp|Q6XP49|GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus GN=Glis3 PE=1 SV=2 16 146 2.0E-25
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 14 128 2.0E-25
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 14 128 2.0E-25
sp|Q9IB89|ZIC5_XENLA Zinc finger protein ZIC 5 OS=Xenopus laevis GN=zic5 PE=2 SV=1 2 128 2.0E-25
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 14 128 2.0E-25
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 14 179 2.0E-25
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 14 128 2.0E-25
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 14 186 2.0E-25
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 14 179 2.0E-25
sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 21 137 2.0E-25
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 14 127 3.0E-25
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 14 128 3.0E-25
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 14 128 3.0E-25
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 14 141 3.0E-25
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 14 128 3.0E-25
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 4 179 3.0E-25
sp|Q7TNK3|ZNF24_RAT Zinc finger protein 24 OS=Rattus norvegicus GN=Znf24 PE=2 SV=1 21 137 3.0E-25
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 13 128 3.0E-25
sp|P17028|ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens GN=ZNF24 PE=1 SV=4 21 137 3.0E-25
sp|Q5RAE6|ZNF24_PONAB Zinc finger protein 24 OS=Pongo abelii GN=ZNF24 PE=2 SV=1 21 137 3.0E-25
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 14 128 3.0E-25
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 14 173 3.0E-25
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 14 128 4.0E-25
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 14 128 4.0E-25
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 14 219 4.0E-25
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 2 128 4.0E-25
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 13 128 4.0E-25
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 14 128 4.0E-25
sp|Q8N9L1|ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens GN=ZIC4 PE=2 SV=3 2 128 4.0E-25
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 14 128 4.0E-25
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 14 186 4.0E-25
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 2 134 4.0E-25
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 14 128 4.0E-25
sp|Q61467|ZIC4_MOUSE Zinc finger protein ZIC 4 OS=Mus musculus GN=Zic4 PE=1 SV=2 2 128 4.0E-25
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 2 134 4.0E-25
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 23 128 4.0E-25
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 21 128 4.0E-25
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 14 128 5.0E-25
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 14 136 5.0E-25
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 6 127 5.0E-25
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 14 127 5.0E-25
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 14 179 5.0E-25
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 14 127 5.0E-25
sp|Q8NEA6|GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens GN=GLIS3 PE=2 SV=5 16 146 5.0E-25
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 14 128 6.0E-25
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 14 179 6.0E-25
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 21 128 6.0E-25
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 14 128 6.0E-25
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 14 128 6.0E-25
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 14 128 6.0E-25
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 14 128 6.0E-25
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 14 131 7.0E-25
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 13 128 7.0E-25
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 11 207 7.0E-25
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 6 128 8.0E-25
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 14 179 8.0E-25
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 14 133 8.0E-25
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 14 173 8.0E-25
sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 18 180 8.0E-25
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 13 127 8.0E-25
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 14 173 9.0E-25
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 14 186 9.0E-25
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 14 128 9.0E-25
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 14 128 9.0E-25
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 6 186 9.0E-25
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 14 128 1.0E-24
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 14 173 1.0E-24
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 14 128 1.0E-24
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 14 179 1.0E-24
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 14 126 1.0E-24
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 14 179 1.0E-24
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 14 179 1.0E-24
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 14 128 1.0E-24
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 14 173 1.0E-24
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 14 207 1.0E-24
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 14 128 1.0E-24
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 23 133 1.0E-24
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 18 128 1.0E-24
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 14 131 1.0E-24
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 23 133 1.0E-24
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 23 128 1.0E-24
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 13 128 2.0E-24
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 14 128 2.0E-24
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 14 128 2.0E-24
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 14 218 2.0E-24
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 14 128 2.0E-24
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 13 128 2.0E-24
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 14 133 2.0E-24
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 13 128 2.0E-24
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 14 127 2.0E-24
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 13 128 2.0E-24
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 14 133 2.0E-24
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 14 128 2.0E-24
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 14 127 2.0E-24
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 14 128 2.0E-24
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 14 128 2.0E-24
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 14 131 2.0E-24
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 15 179 2.0E-24
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 21 129 2.0E-24
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 5 134 2.0E-24
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 14 128 2.0E-24
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 14 117 2.0E-24
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 14 128 2.0E-24
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 14 128 2.0E-24
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 14 179 2.0E-24
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 14 133 2.0E-24
sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 2 128 2.0E-24
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 14 185 2.0E-24
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 2 128 2.0E-24
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 14 117 2.0E-24
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 2 128 2.0E-24
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 14 128 2.0E-24
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 14 173 2.0E-24
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 14 128 3.0E-24
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 14 126 3.0E-24
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 14 179 3.0E-24
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 14 128 3.0E-24
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 14 128 3.0E-24
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 14 128 3.0E-24
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 14 133 3.0E-24
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 14 128 3.0E-24
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 19 128 3.0E-24
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 14 179 3.0E-24
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 14 127 3.0E-24
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 6 128 3.0E-24
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 14 126 3.0E-24
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 14 173 3.0E-24
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 14 126 3.0E-24
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 3 128 3.0E-24
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 5 179 3.0E-24
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 14 128 4.0E-24
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 14 128 4.0E-24
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 11 128 4.0E-24
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 14 131 4.0E-24
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 14 131 4.0E-24
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 14 128 4.0E-24
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 14 179 4.0E-24
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 15 127 4.0E-24
sp|A1YG48|ZN394_PANPA Zinc finger protein 394 OS=Pan paniscus GN=ZNF394 PE=3 SV=1 14 128 4.0E-24
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 2 128 4.0E-24
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 18 128 4.0E-24
sp|Q53GI3|ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens GN=ZNF394 PE=1 SV=2 14 128 4.0E-24
sp|Q5R741|ZN394_PONAB Zinc finger protein 394 OS=Pongo abelii GN=ZNF394 PE=2 SV=1 14 128 4.0E-24
sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 18 134 4.0E-24
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 13 128 4.0E-24
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 14 128 4.0E-24
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 23 173 5.0E-24
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 14 133 5.0E-24
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 19 179 5.0E-24
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 14 128 5.0E-24
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 14 128 5.0E-24
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 14 128 5.0E-24
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 14 128 5.0E-24
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 23 128 5.0E-24
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 14 128 5.0E-24
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 2 128 5.0E-24
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 14 127 5.0E-24
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 185 5.0E-24
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 14 128 6.0E-24
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 14 128 6.0E-24
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 14 133 6.0E-24
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 23 207 6.0E-24
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 3 179 6.0E-24
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 14 128 6.0E-24
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 14 127 6.0E-24
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 14 128 6.0E-24
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 19 131 6.0E-24
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 23 128 6.0E-24
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 14 128 6.0E-24
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 14 128 6.0E-24
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 14 126 6.0E-24
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 14 179 6.0E-24
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 14 128 6.0E-24
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 6 128 7.0E-24
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 14 128 7.0E-24
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 14 185 7.0E-24
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 14 128 7.0E-24
sp|Q6U7Q0|ZN322_HUMAN Zinc finger protein 322 OS=Homo sapiens GN=ZNF322 PE=1 SV=2 14 147 7.0E-24
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 14 186 7.0E-24
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 14 128 7.0E-24
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 14 179 7.0E-24
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 14 179 8.0E-24
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 14 126 8.0E-24
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 14 179 8.0E-24
sp|Q9H963|ZN702_HUMAN Putative zinc finger protein 702 OS=Homo sapiens GN=ZNF702P PE=5 SV=2 14 119 8.0E-24
sp|Q8K1M4|GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus GN=Glis1 PE=2 SV=2 16 146 8.0E-24
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 14 179 8.0E-24
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 14 128 8.0E-24
sp|Q4R7X8|ZN322_MACFA Zinc finger protein 322 OS=Macaca fascicularis GN=ZNF322 PE=2 SV=1 14 147 8.0E-24
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 17 127 8.0E-24
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 14 128 8.0E-24
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 23 128 8.0E-24
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 23 173 9.0E-24
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 3 128 9.0E-24
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 14 128 9.0E-24
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 14 127 9.0E-24
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 14 128 9.0E-24
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 17 127 9.0E-24
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 23 131 9.0E-24
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 14 128 9.0E-24
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 14 179 9.0E-24
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 14 128 1.0E-23
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 3 128 1.0E-23
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 14 128 1.0E-23
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 14 128 1.0E-23
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 14 128 1.0E-23
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 14 212 1.0E-23
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 18 128 1.0E-23
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 14 128 1.0E-23
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 5 128 1.0E-23
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 14 128 1.0E-23
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 14 173 1.0E-23
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 2 128 1.0E-23
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 14 179 1.0E-23
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 14 179 1.0E-23
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 14 128 1.0E-23
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 14 183 1.0E-23
sp|Q7Z398|ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens GN=ZNF550 PE=1 SV=2 13 179 1.0E-23
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 2 128 1.0E-23
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 14 179 1.0E-23
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 2 128 1.0E-23
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 6 128 1.0E-23
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 14 128 1.0E-23
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 14 128 1.0E-23
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 2 179 1.0E-23
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 16 179 1.0E-23
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 14 127 1.0E-23
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 14 128 1.0E-23
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 14 127 1.0E-23
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 14 182 1.0E-23
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 2 128 1.0E-23
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 14 128 1.0E-23
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 14 179 1.0E-23
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 14 179 1.0E-23
sp|Q8NEK5|ZN548_HUMAN Zinc finger protein 548 OS=Homo sapiens GN=ZNF548 PE=2 SV=2 12 128 1.0E-23
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 14 128 1.0E-23
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 14 207 1.0E-23
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 14 179 1.0E-23
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 14 128 2.0E-23
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 14 128 2.0E-23
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 14 128 2.0E-23
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 14 128 2.0E-23
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 14 128 2.0E-23
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 14 136 2.0E-23
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 13 179 2.0E-23
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 14 128 2.0E-23
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 14 126 2.0E-23
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 23 128 2.0E-23
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 14 128 2.0E-23
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 14 128 2.0E-23
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 14 128 2.0E-23
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 14 128 2.0E-23
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 14 128 2.0E-23
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 14 128 2.0E-23
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 14 128 2.0E-23
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 3 128 2.0E-23
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 14 128 2.0E-23
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 14 128 2.0E-23
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 14 179 2.0E-23
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 14 128 2.0E-23
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 14 128 2.0E-23
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 14 128 2.0E-23
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 14 131 2.0E-23
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 14 126 2.0E-23
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 14 128 2.0E-23
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 14 127 2.0E-23
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 14 128 2.0E-23
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 5 128 2.0E-23
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 12 179 2.0E-23
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 23 128 2.0E-23
sp|Q8IVP9|ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens GN=ZNF547 PE=2 SV=2 14 127 2.0E-23
sp|A2T7D7|ZNF24_PANTR Zinc finger protein 24 OS=Pan troglodytes GN=ZNF24 PE=3 SV=1 21 137 2.0E-23
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 14 128 2.0E-23
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 14 173 2.0E-23
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 14 128 2.0E-23
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 2 128 2.0E-23
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 14 128 2.0E-23
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 21 207 2.0E-23
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 14 128 2.0E-23
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 14 128 2.0E-23
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 14 131 2.0E-23
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 128 2.0E-23
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 21 131 2.0E-23
sp|Q8NBF1|GLIS1_HUMAN Zinc finger protein GLIS1 OS=Homo sapiens GN=GLIS1 PE=2 SV=2 16 128 2.0E-23
sp|Q8BZ89|ZN322_MOUSE Zinc finger protein 322 OS=Mus musculus GN=Znf322 PE=2 SV=1 14 147 2.0E-23
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 14 175 2.0E-23
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 14 128 2.0E-23
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 14 185 2.0E-23
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 5 128 3.0E-23
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 5 128 3.0E-23
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 14 128 3.0E-23
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 23 173 3.0E-23
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 13 179 3.0E-23
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 14 128 3.0E-23
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 14 128 3.0E-23
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 13 179 3.0E-23
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 14 128 3.0E-23
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 14 128 3.0E-23
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 14 128 3.0E-23
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 14 128 3.0E-23
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 14 128 3.0E-23
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 14 128 3.0E-23
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 14 128 3.0E-23
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 14 179 3.0E-23
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 14 128 3.0E-23
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 14 128 3.0E-23
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 7 179 3.0E-23
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 18 127 3.0E-23
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 14 128 3.0E-23
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 20 179 3.0E-23
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 14 179 3.0E-23
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 14 179 3.0E-23
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 14 179 3.0E-23
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 14 179 3.0E-23
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 14 128 3.0E-23
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 14 128 3.0E-23
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 7 179 3.0E-23
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 14 179 3.0E-23
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 4 128 3.0E-23
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 14 128 3.0E-23
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 14 212 3.0E-23
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 14 128 3.0E-23
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 14 131 3.0E-23
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 5 131 3.0E-23
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 14 128 3.0E-23
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 14 179 3.0E-23
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 14 128 3.0E-23
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 14 128 3.0E-23
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 6 128 3.0E-23
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 14 128 3.0E-23
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 14 127 4.0E-23
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 14 127 4.0E-23
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 14 128 4.0E-23
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 14 128 4.0E-23
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 12 185 4.0E-23
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 12 127 4.0E-23
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 21 128 4.0E-23
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 23 131 4.0E-23
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 21 128 4.0E-23
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 21 128 4.0E-23
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 14 128 4.0E-23
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 14 186 4.0E-23
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 14 186 4.0E-23
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 14 173 4.0E-23
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 14 127 4.0E-23
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 14 127 4.0E-23
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 173 4.0E-23
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 14 179 4.0E-23
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 14 128 4.0E-23
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 14 179 4.0E-23
sp|P52743|ZN137_HUMAN Putative zinc finger protein 137 OS=Homo sapiens GN=ZNF137P PE=5 SV=1 18 128 4.0E-23
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 14 128 4.0E-23
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 14 127 4.0E-23
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 14 128 5.0E-23
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 14 128 5.0E-23
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 14 128 5.0E-23
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 7 179 5.0E-23
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 14 179 5.0E-23
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 14 128 5.0E-23
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 14 131 5.0E-23
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 14 179 5.0E-23
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 14 127 5.0E-23
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 14 128 5.0E-23
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 14 128 5.0E-23
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 127 5.0E-23
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 14 128 5.0E-23
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 14 128 5.0E-23
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 14 179 5.0E-23
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 14 183 5.0E-23
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 14 179 5.0E-23
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 14 179 5.0E-23
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 14 126 5.0E-23
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 14 128 5.0E-23
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 14 148 5.0E-23
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 14 127 6.0E-23
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 15 131 6.0E-23
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 15 131 6.0E-23
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 14 128 6.0E-23
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 14 128 6.0E-23
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 14 128 6.0E-23
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 14 128 6.0E-23
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 12 185 6.0E-23
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 14 179 6.0E-23
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 14 173 6.0E-23
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 14 128 6.0E-23
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 14 128 6.0E-23
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 23 128 6.0E-23
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 14 128 6.0E-23
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 14 157 6.0E-23
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 14 179 6.0E-23
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 18 131 6.0E-23
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 14 179 6.0E-23
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 1 128 6.0E-23
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 13 138 6.0E-23
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 14 138 6.0E-23
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 3 128 6.0E-23
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 23 128 6.0E-23
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 14 128 7.0E-23
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 6 128 7.0E-23
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 12 127 7.0E-23
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 14 128 7.0E-23
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 14 128 7.0E-23
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 14 128 7.0E-23
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 14 136 7.0E-23
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 127 7.0E-23
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 14 127 7.0E-23
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 16 131 7.0E-23
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 14 179 7.0E-23
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 2 128 7.0E-23
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 14 179 7.0E-23
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 14 128 7.0E-23
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 3 128 7.0E-23
sp|Q5RCX4|ZN547_PONAB Zinc finger protein 547 OS=Pongo abelii GN=ZNF547 PE=2 SV=1 14 127 7.0E-23
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 14 138 7.0E-23
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 19 209 7.0E-23
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 3 128 8.0E-23
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 6 128 8.0E-23
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 19 127 8.0E-23
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 15 128 8.0E-23
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 14 188 8.0E-23
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 14 128 8.0E-23
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 9 128 8.0E-23
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 6 128 8.0E-23
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 14 133 8.0E-23
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 14 128 8.0E-23
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 14 126 8.0E-23
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 14 207 8.0E-23
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 5 179 8.0E-23
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 14 128 8.0E-23
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 14 179 8.0E-23
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 14 128 8.0E-23
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 14 138 8.0E-23
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 17 131 8.0E-23
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 14 128 9.0E-23
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 14 179 9.0E-23
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 3 128 9.0E-23
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 14 128 9.0E-23
sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 14 138 9.0E-23
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 23 136 9.0E-23
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 14 179 9.0E-23
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 14 128 9.0E-23
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 14 128 9.0E-23
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 14 128 9.0E-23
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 14 128 9.0E-23
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 6 128 9.0E-23
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 14 179 9.0E-23
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 14 137 1.0E-22
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 5 128 1.0E-22
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 6 141 1.0E-22
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 23 128 1.0E-22
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 3 128 1.0E-22
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 14 128 1.0E-22
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 14 128 1.0E-22
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 14 128 1.0E-22
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 14 179 1.0E-22
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 15 135 1.0E-22
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 14 131 1.0E-22
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 14 128 1.0E-22
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 14 128 1.0E-22
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 14 128 1.0E-22
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 14 127 1.0E-22
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 14 154 1.0E-22
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 3 179 1.0E-22
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 14 179 1.0E-22
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 14 128 1.0E-22
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 23 128 1.0E-22
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 185 1.0E-22
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 3 128 1.0E-22
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 23 128 1.0E-22
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 14 134 1.0E-22
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 14 128 1.0E-22
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 14 127 1.0E-22
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 14 127 1.0E-22
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 14 127 1.0E-22
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 14 128 1.0E-22
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 14 127 1.0E-22
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 14 128 1.0E-22
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 14 179 1.0E-22
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 14 128 1.0E-22
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 14 128 1.0E-22
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 5 131 1.0E-22
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 14 128 1.0E-22
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 4 128 1.0E-22
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 14 127 1.0E-22
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 15 176 1.0E-22
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 23 179 1.0E-22
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 14 128 1.0E-22
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 13 173 1.0E-22
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 14 128 1.0E-22
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 14 173 1.0E-22
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 6 128 1.0E-22
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 14 207 1.0E-22
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 3 128 1.0E-22
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 5 173 1.0E-22
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 14 127 1.0E-22
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 14 179 1.0E-22
sp|Q8N8Y5|ZFP41_HUMAN Zinc finger protein 41 homolog OS=Homo sapiens GN=ZFP41 PE=2 SV=1 14 129 1.0E-22
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 112 1.0E-22
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 14 128 1.0E-22
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 8 131 1.0E-22
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 5 128 1.0E-22
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 14 127 1.0E-22
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 14 128 1.0E-22
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 14 128 1.0E-22
sp|A1YGJ4|ZNF24_PANPA Zinc finger protein 24 OS=Pan paniscus GN=ZNF24 PE=3 SV=1 21 137 1.0E-22
sp|Q8TAF7|ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens GN=ZNF461 PE=2 SV=2 14 179 1.0E-22
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 2 173 1.0E-22
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 14 179 1.0E-22
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 14 179 1.0E-22
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 14 128 1.0E-22
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 14 128 1.0E-22
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 14 127 1.0E-22
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 14 179 1.0E-22
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 14 131 1.0E-22
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 21 226 1.0E-22
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 14 179 1.0E-22
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 14 182 2.0E-22
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 23 173 2.0E-22
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 14 127 2.0E-22
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 3 179 2.0E-22
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 14 128 2.0E-22
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 13 128 2.0E-22
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 14 128 2.0E-22
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 14 128 2.0E-22
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 14 128 2.0E-22
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 14 135 2.0E-22
sp|Q5R741|ZN394_PONAB Zinc finger protein 394 OS=Pongo abelii GN=ZNF394 PE=2 SV=1 16 137 2.0E-22
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 14 179 2.0E-22
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 19 178 2.0E-22
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 2 128 2.0E-22
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 14 128 2.0E-22
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 14 128 2.0E-22
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 14 128 2.0E-22
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 14 128 2.0E-22
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 14 127 2.0E-22
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 14 128 2.0E-22
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 14 179 2.0E-22
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 14 128 2.0E-22
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 14 128 2.0E-22
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 14 127 2.0E-22
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 14 128 2.0E-22
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 9 128 2.0E-22
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 14 179 2.0E-22
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 14 128 2.0E-22
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 14 126 2.0E-22
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 14 128 2.0E-22
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 14 133 2.0E-22
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 14 179 2.0E-22
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 6 128 2.0E-22
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 14 128 2.0E-22
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 14 128 2.0E-22
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 6 128 2.0E-22
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 14 127 2.0E-22
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 14 128 2.0E-22
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 14 128 2.0E-22
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 7 112 2.0E-22
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 14 126 2.0E-22
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 14 128 2.0E-22
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 14 138 2.0E-22
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 14 128 2.0E-22
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 19 179 2.0E-22
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 14 136 2.0E-22
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 14 127 2.0E-22
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 14 138 2.0E-22
sp|Q3TTC2|TYY2_MOUSE Transcription factor YY2 OS=Mus musculus GN=Yy2 PE=2 SV=1 14 126 2.0E-22
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 15 128 2.0E-22
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 14 128 2.0E-22
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 14 128 2.0E-22
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 14 127 2.0E-22
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 14 128 2.0E-22
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 18 128 2.0E-22
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 13 141 2.0E-22
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 14 179 2.0E-22
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 14 179 2.0E-22
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 14 176 2.0E-22
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 14 128 2.0E-22
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 14 128 3.0E-22
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 14 128 3.0E-22
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 14 128 3.0E-22
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 14 128 3.0E-22
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 14 127 3.0E-22
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 23 107 3.0E-22
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 6 128 3.0E-22
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 6 128 3.0E-22
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 6 128 3.0E-22
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 14 179 3.0E-22
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 14 179 3.0E-22
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 14 128 3.0E-22
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 14 128 3.0E-22
sp|Q5RCX4|ZN547_PONAB Zinc finger protein 547 OS=Pongo abelii GN=ZNF547 PE=2 SV=1 14 176 3.0E-22
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 14 173 3.0E-22
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 14 131 3.0E-22
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 14 128 3.0E-22
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 14 134 3.0E-22
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 14 129 3.0E-22
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 14 128 3.0E-22
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 21 178 3.0E-22
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 14 127 3.0E-22
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 15 185 3.0E-22
sp|Q91660|GLI3_XENLA Zinc finger protein GLI3 OS=Xenopus laevis GN=gli3 PE=2 SV=1 17 131 3.0E-22
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 14 128 3.0E-22
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 14 128 3.0E-22
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 14 136 3.0E-22
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 14 128 3.0E-22
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 14 173 3.0E-22
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 14 127 3.0E-22
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 6 128 3.0E-22
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 14 182 3.0E-22
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 14 127 3.0E-22
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 21 258 3.0E-22
sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 17 131 3.0E-22
sp|Q5RB33|ZN620_PONAB Zinc finger protein 620 OS=Pongo abelii GN=ZNF620 PE=2 SV=1 14 128 3.0E-22
sp|P0C6P6|TYY2_RAT Transcription factor YY2 OS=Rattus norvegicus GN=Yy2 PE=3 SV=1 14 126 3.0E-22
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 14 179 3.0E-22
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 6 128 3.0E-22
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 14 136 3.0E-22
sp|Q6ZNG0|ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens GN=ZNF620 PE=2 SV=1 14 128 3.0E-22
sp|Q2FAY8|TYY2_RATRT Transcription factor YY2 OS=Rattus rattus GN=Yy2 PE=3 SV=1 14 126 3.0E-22
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 14 128 4.0E-22
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 14 128 4.0E-22
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 14 128 4.0E-22
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 14 127 4.0E-22
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 14 179 4.0E-22
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 14 128 4.0E-22
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 14 128 4.0E-22
sp|Q8NEK5|ZN548_HUMAN Zinc finger protein 548 OS=Homo sapiens GN=ZNF548 PE=2 SV=2 14 140 4.0E-22
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 14 128 4.0E-22
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 16 176 4.0E-22
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 14 186 4.0E-22
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 14 173 4.0E-22
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 21 128 4.0E-22
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 14 179 4.0E-22
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 14 133 4.0E-22
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 14 185 4.0E-22
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 12 126 4.0E-22
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 14 126 4.0E-22
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 14 128 4.0E-22
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 14 128 4.0E-22
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 14 179 4.0E-22
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 17 131 4.0E-22
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 14 127 4.0E-22
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 14 128 4.0E-22
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 14 127 4.0E-22
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 14 133 4.0E-22
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 23 127 4.0E-22
sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens GN=ZNF430 PE=1 SV=3 16 185 4.0E-22
sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 17 131 4.0E-22
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 14 128 5.0E-22
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 14 128 5.0E-22
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 14 128 5.0E-22
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 18 128 5.0E-22
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 14 128 5.0E-22
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 14 128 5.0E-22
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 14 128 5.0E-22
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 14 128 5.0E-22
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 1 128 5.0E-22
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 14 128 5.0E-22
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 14 128 5.0E-22
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 14 182 5.0E-22
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 14 128 5.0E-22
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 14 128 5.0E-22
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 11 179 5.0E-22
sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens GN=ZNF430 PE=1 SV=3 14 179 5.0E-22
sp|Q8NCK3|ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens GN=ZNF485 PE=2 SV=1 14 128 5.0E-22
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 14 128 5.0E-22
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 14 126 5.0E-22
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 7 128 5.0E-22
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 14 131 5.0E-22
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 23 128 5.0E-22
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 14 128 5.0E-22
sp|Q8N9Z0|ZN610_HUMAN Zinc finger protein 610 OS=Homo sapiens GN=ZNF610 PE=2 SV=2 14 176 5.0E-22
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 3 128 5.0E-22
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 18 131 5.0E-22
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 14 127 5.0E-22
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 14 126 5.0E-22
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 16 131 5.0E-22
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 14 127 5.0E-22
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 14 128 6.0E-22
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 14 128 6.0E-22
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 6 206 6.0E-22
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 14 126 6.0E-22
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 14 128 6.0E-22
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 14 128 6.0E-22
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 14 128 6.0E-22
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 14 128 6.0E-22
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 14 128 6.0E-22
sp|Q8NEK5|ZN548_HUMAN Zinc finger protein 548 OS=Homo sapiens GN=ZNF548 PE=2 SV=2 14 211 6.0E-22
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 128 6.0E-22
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 23 173 6.0E-22
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 14 128 6.0E-22
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 3 128 6.0E-22
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 3 128 6.0E-22
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 14 128 6.0E-22
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 14 127 6.0E-22
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 14 131 6.0E-22
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 14 128 6.0E-22
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 14 131 6.0E-22
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 17 131 6.0E-22
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 14 137 6.0E-22
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 17 131 6.0E-22
sp|Q6DCW1|GFI1B_XENLA Zinc finger protein Gfi-1b OS=Xenopus laevis GN=gfi1b PE=2 SV=1 14 135 6.0E-22
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 23 183 6.0E-22
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 14 126 6.0E-22
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 14 126 6.0E-22
sp|P18752|ZO72_XENLA Oocyte zinc finger protein XlCOF7.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 14 131 6.0E-22
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 23 127 6.0E-22
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 2 128 6.0E-22
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 133 6.0E-22
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 22 128 6.0E-22
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 14 108 7.0E-22
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 14 128 7.0E-22
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 14 185 7.0E-22
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 13 173 7.0E-22
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 19 128 7.0E-22
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 14 127 7.0E-22
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 14 128 7.0E-22
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 14 128 7.0E-22
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 23 135 7.0E-22
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 14 179 7.0E-22
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 14 179 7.0E-22
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 13 128 7.0E-22
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 23 173 7.0E-22
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 128 7.0E-22
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 14 128 7.0E-22
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 14 128 7.0E-22
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 14 179 7.0E-22
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 14 128 7.0E-22
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 14 128 7.0E-22
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 14 136 7.0E-22
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 14 128 7.0E-22
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 22 128 7.0E-22
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 14 128 7.0E-22
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 22 128 7.0E-22
sp|A6NP11|ZN716_HUMAN Zinc finger protein 716 OS=Homo sapiens GN=ZNF716 PE=2 SV=4 14 127 7.0E-22
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 22 128 7.0E-22
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 14 128 7.0E-22
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 14 137 7.0E-22
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 3 127 8.0E-22
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 15 135 8.0E-22
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 14 128 8.0E-22
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 14 128 8.0E-22
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 14 128 8.0E-22
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 1 128 8.0E-22
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 14 128 8.0E-22
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 3 128 8.0E-22
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 6 128 8.0E-22
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 14 136 8.0E-22
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 14 128 8.0E-22
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 2 127 8.0E-22
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 14 128 8.0E-22
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 6 179 8.0E-22
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 14 173 8.0E-22
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 14 185 8.0E-22
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 14 173 8.0E-22
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 14 127 8.0E-22
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 16 128 9.0E-22
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 14 218 9.0E-22
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 14 218 9.0E-22
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 6 128 9.0E-22
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 14 128 9.0E-22
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 12 128 9.0E-22
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 14 127 9.0E-22
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 14 179 9.0E-22
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 11 128 9.0E-22
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 14 127 9.0E-22
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 33 176 9.0E-22
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 14 192 9.0E-22
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 14 127 9.0E-22
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 1 128 9.0E-22
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 6 128 9.0E-22
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 14 133 9.0E-22
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 14 128 9.0E-22
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 14 179 9.0E-22
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 14 127 9.0E-22
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 1 128 9.0E-22
sp|Q9VDZ3|SQZ_DROME Zinc finger protein squeeze OS=Drosophila melanogaster GN=sqz PE=1 SV=2 13 126 9.0E-22
sp|Q4R6J4|ZN684_MACFA Zinc finger protein 684 OS=Macaca fascicularis GN=ZNF684 PE=2 SV=1 14 179 9.0E-22
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 14 128 9.0E-22
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 18 128 9.0E-22
sp|Q9BS31|ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens GN=ZNF649 PE=1 SV=1 14 128 9.0E-22
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 14 127 9.0E-22
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 19 212 9.0E-22
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 3 179 1.0E-21
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 14 182 1.0E-21
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 14 128 1.0E-21
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 14 128 1.0E-21
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 14 128 1.0E-21
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 14 128 1.0E-21
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 14 128 1.0E-21
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 14 128 1.0E-21
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 14 128 1.0E-21
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 14 128 1.0E-21
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 15 135 1.0E-21
sp|A1YG48|ZN394_PANPA Zinc finger protein 394 OS=Pan paniscus GN=ZNF394 PE=3 SV=1 31 137 1.0E-21
sp|Q53GI3|ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens GN=ZNF394 PE=1 SV=2 31 137 1.0E-21
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 12 128 1.0E-21
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 19 128 1.0E-21
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 2 128 1.0E-21
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 14 179 1.0E-21
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 14 173 1.0E-21
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 14 176 1.0E-21
sp|Q8NEK5|ZN548_HUMAN Zinc finger protein 548 OS=Homo sapiens GN=ZNF548 PE=2 SV=2 14 128 1.0E-21
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 14 215 1.0E-21
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 14 128 1.0E-21
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 14 127 1.0E-21
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 14 127 1.0E-21
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 14 179 1.0E-21
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 14 179 1.0E-21
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 14 128 1.0E-21
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 14 128 1.0E-21
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 6 127 1.0E-21
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 19 128 1.0E-21
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 14 128 1.0E-21
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 14 133 1.0E-21
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 14 179 1.0E-21
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 14 128 1.0E-21
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 14 126 1.0E-21
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 14 128 1.0E-21
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 14 128 1.0E-21
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 3 128 1.0E-21
sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 3 128 1.0E-21
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 16 179 1.0E-21
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 14 173 1.0E-21
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 14 128 1.0E-21
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 14 128 1.0E-21
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 5 128 1.0E-21
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 14 127 1.0E-21
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 14 179 1.0E-21
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 14 128 1.0E-21
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 14 179 1.0E-21
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 14 207 1.0E-21
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 14 128 1.0E-21
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 23 127 1.0E-21
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 14 133 1.0E-21
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 14 127 1.0E-21
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 14 207 1.0E-21
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 14 128 1.0E-21
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 14 128 1.0E-21
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 14 179 1.0E-21
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 18 179 1.0E-21
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 1 128 1.0E-21
sp|Q9Z2K3|ZN394_RAT Zinc finger protein 394 OS=Rattus norvegicus GN=Znf394 PE=2 SV=1 1 128 1.0E-21
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 4 128 1.0E-21
sp|Q9UK13|ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens GN=ZNF221 PE=2 SV=3 14 126 1.0E-21
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 128 1.0E-21
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 14 127 1.0E-21
sp|Q494X3|ZN404_HUMAN Zinc finger protein 404 OS=Homo sapiens GN=ZNF404 PE=1 SV=2 13 176 1.0E-21
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 21 127 1.0E-21
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 13 144 1.0E-21
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 14 173 1.0E-21
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 14 173 1.0E-21
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 14 128 1.0E-21
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 14 132 1.0E-21
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 14 127 1.0E-21
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 14 127 1.0E-21
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 14 179 1.0E-21
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 14 128 1.0E-21
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 14 128 1.0E-21
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 14 128 1.0E-21
sp|Q293Q2|SQZ_DROPS Zinc finger protein squeeze OS=Drosophila pseudoobscura pseudoobscura GN=sqz PE=3 SV=2 13 126 1.0E-21
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 3 128 2.0E-21
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 23 179 2.0E-21
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 14 128 2.0E-21
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 18 128 2.0E-21
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 19 128 2.0E-21
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 14 128 2.0E-21
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 14 128 2.0E-21
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 14 128 2.0E-21
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 14 128 2.0E-21
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 18 128 2.0E-21
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 3 128 2.0E-21
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 3 127 2.0E-21
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 127 2.0E-21
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 185 2.0E-21
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 127 2.0E-21
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 127 2.0E-21
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 1 128 2.0E-21
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 14 128 2.0E-21
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 14 179 2.0E-21
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 14 128 2.0E-21
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 14 128 2.0E-21
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 14 179 2.0E-21
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 14 128 2.0E-21
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 14 128 2.0E-21
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 14 128 2.0E-21
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 14 128 2.0E-21
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 127 2.0E-21
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 14 179 2.0E-21
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 14 179 2.0E-21
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 14 128 2.0E-21
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 14 128 2.0E-21
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 14 179 2.0E-21
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 14 128 2.0E-21
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 14 128 2.0E-21
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 14 127 2.0E-21
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 14 128 2.0E-21
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 14 179 2.0E-21
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 14 179 2.0E-21
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 14 128 2.0E-21
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 14 133 2.0E-21
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 14 128 2.0E-21
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 3 154 2.0E-21
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 14 129 2.0E-21
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 3 128 2.0E-21
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 14 128 2.0E-21
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 3 128 2.0E-21
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 14 128 2.0E-21
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 14 179 2.0E-21
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 14 179 2.0E-21
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 14 182 2.0E-21
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 3 127 2.0E-21
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 14 128 2.0E-21
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 3 179 2.0E-21
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 1 128 2.0E-21
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 133 2.0E-21
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 14 128 2.0E-21
sp|P25490|TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens GN=YY1 PE=1 SV=2 14 126 2.0E-21
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 14 132 2.0E-21
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 14 135 2.0E-21
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 14 179 2.0E-21
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 14 128 2.0E-21
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 23 128 2.0E-21
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 14 135 2.0E-21
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 14 131 3.0E-21
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 14 128 3.0E-21
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 13 128 3.0E-21
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 14 128 3.0E-21
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 14 128 3.0E-21
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 14 131 3.0E-21
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 14 128 3.0E-21
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 128 3.0E-21
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 14 128 3.0E-21
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 14 128 3.0E-21
sp|Q7Z398|ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens GN=ZNF550 PE=1 SV=2 14 128 3.0E-21
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 14 127 3.0E-21
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 14 179 3.0E-21
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 14 142 3.0E-21
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 14 128 3.0E-21
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 14 128 3.0E-21
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 6 128 3.0E-21
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 14 128 3.0E-21
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 20 128 3.0E-21
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 14 127 3.0E-21
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 14 179 3.0E-21
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 14 128 3.0E-21
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 1 173 3.0E-21
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 14 128 3.0E-21
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 14 128 3.0E-21
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 14 128 3.0E-21
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 14 128 3.0E-21
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 14 128 3.0E-21
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 14 128 3.0E-21
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 14 112 3.0E-21
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 14 128 3.0E-21
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 17 131 3.0E-21
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 14 179 3.0E-21
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 14 127 3.0E-21
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 14 179 3.0E-21
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 14 126 3.0E-21
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 14 179 3.0E-21
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 14 127 3.0E-21
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 173 3.0E-21
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 14 179 4.0E-21
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 14 134 4.0E-21
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 14 128 4.0E-21
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 14 179 4.0E-21
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 14 128 4.0E-21
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 14 179 4.0E-21
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 14 128 4.0E-21
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 2 128 4.0E-21
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 15 128 4.0E-21
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 23 179 4.0E-21
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 15 127 4.0E-21
sp|Q8IVP9|ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens GN=ZNF547 PE=2 SV=2 14 176 4.0E-21
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 6 128 4.0E-21
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 14 126 4.0E-21
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 14 179 4.0E-21
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 14 128 4.0E-21
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 14 127 4.0E-21
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 14 128 4.0E-21
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 11 128 4.0E-21
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 14 128 4.0E-21
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 14 127 4.0E-21
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 2 128 4.0E-21
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 3 179 4.0E-21
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 6 128 4.0E-21
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 16 131 4.0E-21
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 21 128 4.0E-21
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 14 159 4.0E-21
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 14 127 4.0E-21
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 14 179 4.0E-21
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 14 128 5.0E-21
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 14 128 5.0E-21
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 14 128 5.0E-21
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 14 128 5.0E-21
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 13 128 5.0E-21
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 14 128 5.0E-21
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 14 128 5.0E-21
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 14 128 5.0E-21
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 14 179 5.0E-21
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 14 127 5.0E-21
sp|Q6U7Q0|ZN322_HUMAN Zinc finger protein 322 OS=Homo sapiens GN=ZNF322 PE=1 SV=2 2 128 5.0E-21
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 14 128 5.0E-21
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 14 128 5.0E-21
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 14 128 5.0E-21
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 14 127 5.0E-21
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 14 128 5.0E-21
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 128 5.0E-21
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 6 128 5.0E-21
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 12 179 5.0E-21
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 14 128 5.0E-21
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 31 128 5.0E-21
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 14 135 5.0E-21
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 13 128 5.0E-21
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 14 117 5.0E-21
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 14 128 5.0E-21
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 14 128 5.0E-21
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 11 128 5.0E-21
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 14 128 5.0E-21
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 14 127 5.0E-21
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 15 128 5.0E-21
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 14 126 5.0E-21
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 14 127 5.0E-21
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 14 128 5.0E-21
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 14 179 5.0E-21
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 14 128 6.0E-21
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 14 128 6.0E-21
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 14 128 6.0E-21
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 14 179 6.0E-21
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 1 128 6.0E-21
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 14 128 6.0E-21
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 14 128 6.0E-21
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 18 128 6.0E-21
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 6 127 6.0E-21
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 14 128 6.0E-21
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 14 128 6.0E-21
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 14 127 6.0E-21
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 14 179 6.0E-21
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 14 128 6.0E-21
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 14 128 6.0E-21
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 14 137 6.0E-21
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 14 128 6.0E-21
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 14 179 6.0E-21
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 14 128 6.0E-21
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 14 179 6.0E-21
sp|Q9BS31|ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens GN=ZNF649 PE=1 SV=1 2 128 6.0E-21
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 21 128 7.0E-21
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 14 128 7.0E-21
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 17 179 7.0E-21
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 14 183 7.0E-21
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 14 128 7.0E-21
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 14 128 7.0E-21
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 3 179 7.0E-21
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 13 179 7.0E-21
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 12 128 7.0E-21
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 14 179 7.0E-21
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 14 128 7.0E-21
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 23 128 7.0E-21
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 14 128 7.0E-21
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 14 183 7.0E-21
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 128 7.0E-21
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 14 128 7.0E-21
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 5 128 7.0E-21
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 27 179 7.0E-21
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 14 185 7.0E-21
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 14 128 7.0E-21
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 14 131 8.0E-21
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 23 128 8.0E-21
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 14 128 8.0E-21
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 14 112 8.0E-21
sp|Q4R7X8|ZN322_MACFA Zinc finger protein 322 OS=Macaca fascicularis GN=ZNF322 PE=2 SV=1 2 128 8.0E-21
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 14 128 8.0E-21
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 14 128 8.0E-21
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 127 8.0E-21
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 13 128 8.0E-21
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 14 127 8.0E-21
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 14 128 8.0E-21
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 14 128 8.0E-21
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 6 128 8.0E-21
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 14 179 8.0E-21
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 13 179 8.0E-21
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 14 127 8.0E-21
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 14 129 8.0E-21
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 14 128 8.0E-21
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 14 128 8.0E-21
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 6 179 8.0E-21
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 14 128 9.0E-21
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 14 179 9.0E-21
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 14 128 9.0E-21
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 14 128 9.0E-21
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 19 127 9.0E-21
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 14 179 9.0E-21
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 14 127 9.0E-21
sp|Q5RCX4|ZN547_PONAB Zinc finger protein 547 OS=Pongo abelii GN=ZNF547 PE=2 SV=1 14 128 9.0E-21
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 14 128 9.0E-21
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 14 128 9.0E-21
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 14 127 9.0E-21
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 14 173 9.0E-21
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 14 128 9.0E-21
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 14 128 9.0E-21
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 19 126 9.0E-21
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 13 128 1.0E-20
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 15 128 1.0E-20
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 14 128 1.0E-20
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 16 129 1.0E-20
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 14 128 1.0E-20
sp|Q8NEA6|GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens GN=GLIS3 PE=2 SV=5 18 128 1.0E-20
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 14 176 1.0E-20
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 14 128 1.0E-20
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 14 128 1.0E-20
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 14 179 1.0E-20
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 6 127 1.0E-20
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 14 128 1.0E-20
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 127 1.0E-20
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 22 128 1.0E-20
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 14 182 1.0E-20
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 14 128 1.0E-20
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 14 128 1.0E-20
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 19 128 1.0E-20
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 14 128 1.0E-20
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 14 128 1.0E-20
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 14 127 1.0E-20
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 14 179 1.0E-20
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 14 173 1.0E-20
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 127 1.0E-20
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 6 128 1.0E-20
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 3 128 1.0E-20
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 14 128 1.0E-20
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 21 173 1.0E-20
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 14 128 1.0E-20
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 15 128 1.0E-20
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 21 128 1.0E-20
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 19 127 1.0E-20
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 14 128 1.0E-20
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 14 128 1.0E-20
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 14 126 1.0E-20
sp|Q8TAF7|ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens GN=ZNF461 PE=2 SV=2 14 128 1.0E-20
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 14 128 1.0E-20
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 23 128 1.0E-20
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 14 128 1.0E-20
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 6 128 1.0E-20
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 14 117 1.0E-20
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 14 128 1.0E-20
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 23 179 1.0E-20
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 14 128 1.0E-20
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 14 179 1.0E-20
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 14 128 1.0E-20
sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens GN=ZNF430 PE=1 SV=3 14 179 1.0E-20
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 23 179 1.0E-20
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 14 179 1.0E-20
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 14 129 1.0E-20
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 14 127 1.0E-20
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 14 128 1.0E-20
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 14 128 1.0E-20
sp|Q4R6J4|ZN684_MACFA Zinc finger protein 684 OS=Macaca fascicularis GN=ZNF684 PE=2 SV=1 14 128 1.0E-20
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 14 128 1.0E-20
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 14 128 1.0E-20
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 14 179 1.0E-20
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 3 128 1.0E-20
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 14 179 1.0E-20
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 14 127 1.0E-20
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 15 128 1.0E-20
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 11 128 2.0E-20
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 11 128 2.0E-20
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 11 128 2.0E-20
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 11 128 2.0E-20
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 11 128 2.0E-20
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 19 128 2.0E-20
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 14 128 2.0E-20
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 19 192 2.0E-20
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 14 128 2.0E-20
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 14 121 2.0E-20
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 14 128 2.0E-20
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 23 128 2.0E-20
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 14 212 2.0E-20
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 14 128 2.0E-20
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 14 128 2.0E-20
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 14 179 2.0E-20
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 14 128 2.0E-20
sp|Q8NEK5|ZN548_HUMAN Zinc finger protein 548 OS=Homo sapiens GN=ZNF548 PE=2 SV=2 14 128 2.0E-20
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 15 126 2.0E-20
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 127 2.0E-20
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 14 128 2.0E-20
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 14 128 2.0E-20
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 23 179 2.0E-20
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 14 128 2.0E-20
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 14 128 2.0E-20
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 20 127 2.0E-20
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 14 128 2.0E-20
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 14 179 2.0E-20
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 14 128 2.0E-20
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 14 185 2.0E-20
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 14 128 2.0E-20
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 14 179 2.0E-20
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 14 176 2.0E-20
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 14 128 2.0E-20
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 14 179 2.0E-20
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 14 179 2.0E-20
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 14 134 2.0E-20
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 14 179 2.0E-20
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 23 128 2.0E-20
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 14 128 2.0E-20
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 14 128 2.0E-20
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 3 127 2.0E-20
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 14 128 2.0E-20
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 14 128 2.0E-20
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 23 128 3.0E-20
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 15 179 3.0E-20
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 14 128 3.0E-20
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 15 179 3.0E-20
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 14 128 3.0E-20
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 14 128 3.0E-20
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 14 134 3.0E-20
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 14 128 3.0E-20
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 14 128 3.0E-20
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 23 128 3.0E-20
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 14 128 3.0E-20
sp|Q7Z398|ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens GN=ZNF550 PE=1 SV=2 14 173 3.0E-20
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 23 128 3.0E-20
sp|Q8IVP9|ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens GN=ZNF547 PE=2 SV=2 14 128 3.0E-20
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 5 179 3.0E-20
sp|Q8BZ89|ZN322_MOUSE Zinc finger protein 322 OS=Mus musculus GN=Znf322 PE=2 SV=1 14 128 3.0E-20
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 14 117 3.0E-20
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 14 179 3.0E-20
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 14 179 3.0E-20
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 14 185 3.0E-20
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 14 128 3.0E-20
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 14 127 3.0E-20
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 14 128 3.0E-20
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 6 128 3.0E-20
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 14 131 3.0E-20
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 23 173 3.0E-20
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 14 179 3.0E-20
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 14 127 3.0E-20
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 14 128 3.0E-20
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 14 128 3.0E-20
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 14 128 3.0E-20
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 14 173 3.0E-20
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 23 128 3.0E-20
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 14 117 3.0E-20
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 14 128 3.0E-20
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 14 128 3.0E-20
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 23 128 3.0E-20
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 19 207 3.0E-20
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 14 127 3.0E-20
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 14 131 3.0E-20
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 14 128 4.0E-20
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 14 128 4.0E-20
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 14 186 4.0E-20
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 19 179 4.0E-20
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 14 127 4.0E-20
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 25 128 4.0E-20
sp|A1YG48|ZN394_PANPA Zinc finger protein 394 OS=Pan paniscus GN=ZNF394 PE=3 SV=1 14 103 4.0E-20
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 12 104 4.0E-20
sp|Q53GI3|ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens GN=ZNF394 PE=1 SV=2 14 103 4.0E-20
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 14 128 4.0E-20
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 14 136 4.0E-20
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 14 112 4.0E-20
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 14 128 4.0E-20
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 14 128 4.0E-20
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 14 128 4.0E-20
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 14 128 4.0E-20
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 14 179 4.0E-20
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 17 128 4.0E-20
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 14 179 4.0E-20
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 14 128 4.0E-20
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 14 207 4.0E-20
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 14 185 4.0E-20
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 14 127 4.0E-20
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 14 128 4.0E-20
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 14 173 4.0E-20
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 14 128 4.0E-20
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 11 128 5.0E-20
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 14 128 5.0E-20
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 14 128 5.0E-20
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 1 127 5.0E-20
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 15 128 5.0E-20
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 14 179 5.0E-20
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 14 179 5.0E-20
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 14 128 5.0E-20
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 14 128 5.0E-20
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 14 128 5.0E-20
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 14 117 5.0E-20
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 128 5.0E-20
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 14 179 5.0E-20
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 14 109 5.0E-20
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 14 128 5.0E-20
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 15 128 5.0E-20
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 14 185 5.0E-20
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 14 190 5.0E-20
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 14 128 5.0E-20
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 14 128 5.0E-20
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 14 179 5.0E-20
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 14 173 5.0E-20
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 14 128 5.0E-20
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 23 128 5.0E-20
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 14 128 6.0E-20
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 6 128 6.0E-20
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 14 127 6.0E-20
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 21 127 6.0E-20
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 4 128 6.0E-20
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 14 127 6.0E-20
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 14 126 6.0E-20
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 19 128 6.0E-20
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 14 132 6.0E-20
sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 14 132 6.0E-20
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 14 179 6.0E-20
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 14 179 6.0E-20
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 14 179 6.0E-20
sp|Q8NCK3|ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens GN=ZNF485 PE=2 SV=1 3 128 6.0E-20
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 14 128 6.0E-20
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 14 128 6.0E-20
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 14 128 6.0E-20
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 14 127 6.0E-20
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 14 128 7.0E-20
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 23 128 7.0E-20
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 14 128 7.0E-20
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 14 179 7.0E-20
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 3 127 7.0E-20
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 128 7.0E-20
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 12 179 7.0E-20
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 12 179 7.0E-20
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 14 128 7.0E-20
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 14 179 7.0E-20
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 14 112 7.0E-20
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 23 128 7.0E-20
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 14 179 7.0E-20
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 14 126 7.0E-20
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 14 128 7.0E-20
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 14 127 8.0E-20
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 14 127 8.0E-20
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 14 179 8.0E-20
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 14 128 8.0E-20
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 3 128 8.0E-20
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 14 128 8.0E-20
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 6 179 8.0E-20
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 127 8.0E-20
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 14 128 8.0E-20
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 14 128 8.0E-20
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 14 128 8.0E-20
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 14 128 8.0E-20
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 20 179 8.0E-20
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 18 179 8.0E-20
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 14 104 9.0E-20
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 14 127 9.0E-20
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 14 128 9.0E-20
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 6 128 9.0E-20
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 25 127 9.0E-20
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 6 128 9.0E-20
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 14 128 9.0E-20
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 14 179 9.0E-20
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 14 128 1.0E-19
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 3 128 1.0E-19
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 5 128 1.0E-19
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 14 128 1.0E-19
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 14 179 1.0E-19
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 3 173 1.0E-19
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 14 128 1.0E-19
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 127 1.0E-19
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 14 128 1.0E-19
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 14 128 1.0E-19
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 14 179 1.0E-19
sp|Q8K1M4|GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus GN=Glis1 PE=2 SV=2 18 128 1.0E-19
sp|Q7Z398|ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens GN=ZNF550 PE=1 SV=2 14 179 1.0E-19
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 14 128 1.0E-19
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 14 128 1.0E-19
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 14 128 1.0E-19
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 14 179 1.0E-19
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 14 128 1.0E-19
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 127 1.0E-19
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 14 128 1.0E-19
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 14 128 1.0E-19
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 14 179 1.0E-19
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 14 128 1.0E-19
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 14 179 1.0E-19
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 14 128 1.0E-19
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 14 128 1.0E-19
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 18 128 1.0E-19
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 14 128 1.0E-19
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 23 128 1.0E-19
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 14 128 1.0E-19
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 6 128 1.0E-19
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 19 127 1.0E-19
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 14 126 1.0E-19
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 14 128 1.0E-19
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 14 128 1.0E-19
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 14 107 1.0E-19
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 14 126 1.0E-19
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 14 128 1.0E-19
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 14 128 1.0E-19
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 14 128 1.0E-19
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 14 128 1.0E-19
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 14 185 1.0E-19
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 14 128 1.0E-19
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 23 128 1.0E-19
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 14 128 1.0E-19
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 14 142 1.0E-19
sp|Q9Z2K3|ZN394_RAT Zinc finger protein 394 OS=Rattus norvegicus GN=Znf394 PE=2 SV=1 18 131 1.0E-19
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 13 179 1.0E-19
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 5 128 1.0E-19
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 14 134 2.0E-19
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 14 127 2.0E-19
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 15 128 2.0E-19
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 14 127 2.0E-19
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 23 127 2.0E-19
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 14 137 2.0E-19
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 14 128 2.0E-19
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 14 179 2.0E-19
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 6 134 2.0E-19
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 14 128 2.0E-19
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 11 127 2.0E-19
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 23 128 2.0E-19
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 14 128 2.0E-19
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 23 128 2.0E-19
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 10 128 2.0E-19
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 14 128 2.0E-19
sp|Q8NBF1|GLIS1_HUMAN Zinc finger protein GLIS1 OS=Homo sapiens GN=GLIS1 PE=2 SV=2 18 128 2.0E-19
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 25 128 2.0E-19
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 14 179 2.0E-19
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 14 127 2.0E-19
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 18 128 2.0E-19
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 14 179 2.0E-19
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 14 128 2.0E-19
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 14 179 2.0E-19
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 14 128 2.0E-19
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 14 128 2.0E-19
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 25 131 2.0E-19
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 5 127 2.0E-19
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 9 179 2.0E-19
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 23 128 2.0E-19
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 14 179 2.0E-19
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 14 126 2.0E-19
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 14 179 2.0E-19
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 14 128 2.0E-19
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 14 128 2.0E-19
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 14 127 2.0E-19
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 21 127 2.0E-19
sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens GN=ZNF430 PE=1 SV=3 14 127 2.0E-19
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 12 127 2.0E-19
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 14 136 2.0E-19
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 14 128 2.0E-19
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 14 179 2.0E-19
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 18 128 2.0E-19
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 14 127 2.0E-19
sp|Q9UK13|ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens GN=ZNF221 PE=2 SV=3 14 128 2.0E-19
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 23 173 2.0E-19
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 14 128 2.0E-19
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 14 127 2.0E-19
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 23 128 2.0E-19
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 2 128 2.0E-19
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 14 107 2.0E-19
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 14 117 3.0E-19
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 40 128 3.0E-19
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 14 134 3.0E-19
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 14 101 3.0E-19
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 14 105 3.0E-19
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 14 127 3.0E-19
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 16 128 3.0E-19
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 14 128 3.0E-19
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 14 128 3.0E-19
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 14 131 3.0E-19
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 14 128 3.0E-19
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 14 128 3.0E-19
sp|Q9H963|ZN702_HUMAN Putative zinc finger protein 702 OS=Homo sapiens GN=ZNF702P PE=5 SV=2 14 128 3.0E-19
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 23 140 3.0E-19
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 15 108 3.0E-19
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 3 128 3.0E-19
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 128 3.0E-19
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 14 128 3.0E-19
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 14 128 3.0E-19
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 13 112 3.0E-19
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 14 127 3.0E-19
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 14 128 3.0E-19
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 14 128 3.0E-19
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 14 128 3.0E-19
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 14 179 3.0E-19
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 14 128 3.0E-19
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 14 128 3.0E-19
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 23 127 3.0E-19
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 14 128 3.0E-19
sp|A6NP11|ZN716_HUMAN Zinc finger protein 716 OS=Homo sapiens GN=ZNF716 PE=2 SV=4 14 127 3.0E-19
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 3 128 3.0E-19
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 14 128 3.0E-19
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 23 185 3.0E-19
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 6 179 3.0E-19
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 14 128 3.0E-19
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 14 127 3.0E-19
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 14 128 4.0E-19
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 14 179 4.0E-19
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 14 179 4.0E-19
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 14 179 4.0E-19
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 6 134 4.0E-19
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 14 108 4.0E-19
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 14 107 4.0E-19
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 14 128 4.0E-19
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 14 128 4.0E-19
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 14 128 4.0E-19
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 14 112 4.0E-19
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 6 128 4.0E-19
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 128 4.0E-19
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 14 127 4.0E-19
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 14 132 4.0E-19
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 14 128 4.0E-19
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 14 128 4.0E-19
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 14 132 4.0E-19
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 14 128 4.0E-19
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 14 126 4.0E-19
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 14 128 4.0E-19
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 14 128 4.0E-19
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 23 128 4.0E-19
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 14 127 4.0E-19
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 19 179 4.0E-19
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 14 179 4.0E-19
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 14 179 4.0E-19
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 9 128 5.0E-19
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 14 104 5.0E-19
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 14 104 5.0E-19
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 14 104 5.0E-19
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 13 127 5.0E-19
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 14 179 5.0E-19
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 14 128 5.0E-19
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 14 128 5.0E-19
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 3 102 5.0E-19
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 14 136 5.0E-19
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 14 179 5.0E-19
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 14 179 5.0E-19
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 14 218 5.0E-19
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 14 132 5.0E-19
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 14 216 5.0E-19
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 19 179 5.0E-19
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 14 136 5.0E-19
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 41 128 6.0E-19
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 22 131 6.0E-19
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 41 128 6.0E-19
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 23 128 6.0E-19
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 19 127 6.0E-19
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 127 6.0E-19
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 23 191 6.0E-19
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 14 128 6.0E-19
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 14 179 6.0E-19
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 14 128 6.0E-19
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 14 179 6.0E-19
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 14 128 6.0E-19
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 14 179 6.0E-19
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 14 127 6.0E-19
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 14 179 6.0E-19
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 21 128 6.0E-19
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 14 128 7.0E-19
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 14 179 7.0E-19
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 14 101 7.0E-19
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 14 128 7.0E-19
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 23 128 7.0E-19
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 14 128 7.0E-19
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 9 179 7.0E-19
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 3 126 7.0E-19
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 9 127 7.0E-19
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 14 110 7.0E-19
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 23 134 7.0E-19
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 6 128 7.0E-19
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 1 128 7.0E-19
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 41 128 8.0E-19
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 6 128 8.0E-19
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 15 179 8.0E-19
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 21 128 8.0E-19
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 14 128 8.0E-19
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 6 128 8.0E-19
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 14 128 8.0E-19
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 14 127 8.0E-19
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 18 127 9.0E-19
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 14 128 9.0E-19
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 19 127 9.0E-19
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 6 179 9.0E-19
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 41 128 1.0E-18
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 41 128 1.0E-18
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 6 128 1.0E-18
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 15 179 1.0E-18
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 14 128 1.0E-18
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 14 128 1.0E-18
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 14 128 1.0E-18
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 14 179 1.0E-18
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 23 127 1.0E-18
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 21 128 1.0E-18
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 14 128 1.0E-18
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 14 128 1.0E-18
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 14 128 1.0E-18
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 2 128 1.0E-18
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 14 179 1.0E-18
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 12 128 1.0E-18
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 14 105 1.0E-18
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 3 104 1.0E-18
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 8 128 1.0E-18
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 128 1.0E-18
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 14 128 1.0E-18
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 14 128 1.0E-18
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 14 173 1.0E-18
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 14 127 1.0E-18
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 14 100 1.0E-18
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 14 128 1.0E-18
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 23 179 1.0E-18
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 6 179 1.0E-18
sp|Q8TAF7|ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens GN=ZNF461 PE=2 SV=2 14 127 1.0E-18
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 14 179 1.0E-18
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 14 107 1.0E-18
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 12 186 1.0E-18
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 14 128 1.0E-18
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 14 128 1.0E-18
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 14 132 1.0E-18
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 16 117 1.0E-18
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 14 127 1.0E-18
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 23 179 1.0E-18
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 14 128 1.0E-18
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 3 128 1.0E-18
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 23 185 1.0E-18
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 21 128 1.0E-18
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 15 128 1.0E-18
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 12 179 1.0E-18
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 14 100 2.0E-18
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 6 128 2.0E-18
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 21 179 2.0E-18
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 14 105 2.0E-18
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 14 108 2.0E-18
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 19 128 2.0E-18
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 14 128 2.0E-18
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 14 128 2.0E-18
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 20 128 2.0E-18
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 14 128 2.0E-18
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 7 112 2.0E-18
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 14 128 2.0E-18
sp|Q6U7Q0|ZN322_HUMAN Zinc finger protein 322 OS=Homo sapiens GN=ZNF322 PE=1 SV=2 21 128 2.0E-18
sp|Q4R7X8|ZN322_MACFA Zinc finger protein 322 OS=Macaca fascicularis GN=ZNF322 PE=2 SV=1 21 128 2.0E-18
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 14 128 2.0E-18
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 6 128 2.0E-18
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 14 108 2.0E-18
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 15 128 2.0E-18
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 3 128 2.0E-18
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 14 106 2.0E-18
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 14 128 2.0E-18
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 14 105 2.0E-18
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 23 185 2.0E-18
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 14 173 2.0E-18
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 15 127 2.0E-18
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 14 127 2.0E-18
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 6 208 2.0E-18
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 14 128 2.0E-18
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 2 128 2.0E-18
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 23 128 2.0E-18
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 14 132 2.0E-18
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 14 128 2.0E-18
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 14 179 2.0E-18
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 14 127 2.0E-18
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 14 126 2.0E-18
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 14 112 2.0E-18
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 14 128 2.0E-18
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 14 127 2.0E-18
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 14 128 2.0E-18
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 14 128 2.0E-18
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 23 179 2.0E-18
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 14 128 2.0E-18
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 25 128 3.0E-18
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 2 128 3.0E-18
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 6 128 3.0E-18
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 14 128 3.0E-18
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 14 128 3.0E-18
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 14 179 3.0E-18
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 14 128 3.0E-18
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 14 128 3.0E-18
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 14 128 3.0E-18
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 14 173 3.0E-18
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 14 136 3.0E-18
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 14 128 3.0E-18
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 2 128 3.0E-18
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 41 128 4.0E-18
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 12 139 4.0E-18
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 18 173 4.0E-18
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 14 105 4.0E-18
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 12 179 4.0E-18
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 14 128 4.0E-18
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 14 128 4.0E-18
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 23 179 4.0E-18
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 14 105 4.0E-18
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 2 128 4.0E-18
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 21 107 4.0E-18
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 14 127 4.0E-18
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 14 135 4.0E-18
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 14 126 4.0E-18
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 179 4.0E-18
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 14 107 4.0E-18
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 13 128 4.0E-18
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 9 127 4.0E-18
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 14 128 4.0E-18
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 14 127 4.0E-18
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 21 107 4.0E-18
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 14 128 4.0E-18
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 14 131 5.0E-18
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 13 134 5.0E-18
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 14 105 5.0E-18
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 40 128 5.0E-18
sp|Q8BZ89|ZN322_MOUSE Zinc finger protein 322 OS=Mus musculus GN=Znf322 PE=2 SV=1 21 128 5.0E-18
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 3 107 5.0E-18
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 13 117 5.0E-18
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 14 178 5.0E-18
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 2 128 5.0E-18
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 23 131 5.0E-18
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 11 126 5.0E-18
sp|Q5RB33|ZN620_PONAB Zinc finger protein 620 OS=Pongo abelii GN=ZNF620 PE=2 SV=1 14 128 5.0E-18
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 19 117 5.0E-18
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 12 179 5.0E-18
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 14 101 5.0E-18
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 24 227 5.0E-18
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 14 173 5.0E-18
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 12 128 5.0E-18
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 15 128 5.0E-18
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 14 105 6.0E-18
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 14 127 6.0E-18
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 14 179 6.0E-18
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 128 6.0E-18
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 1 100 6.0E-18
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 15 128 6.0E-18
sp|Q8NCK3|ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens GN=ZNF485 PE=2 SV=1 3 128 6.0E-18
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 12 179 6.0E-18
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 14 179 6.0E-18
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 25 128 6.0E-18
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 9 128 7.0E-18
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 3 144 7.0E-18
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 14 128 7.0E-18
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 25 179 7.0E-18
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 11 179 7.0E-18
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 14 128 7.0E-18
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 14 128 7.0E-18
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 14 104 7.0E-18
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 32 186 7.0E-18
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 21 127 7.0E-18
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 6 179 7.0E-18
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 14 128 7.0E-18
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 11 126 7.0E-18
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 14 128 7.0E-18
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 23 134 7.0E-18
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 23 174 8.0E-18
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 14 127 8.0E-18
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 13 128 8.0E-18
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 14 107 8.0E-18
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 14 127 8.0E-18
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 30 128 9.0E-18
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 14 128 9.0E-18
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 14 127 9.0E-18
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 14 131 9.0E-18
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 13 105 9.0E-18
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 14 117 9.0E-18
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 14 101 1.0E-17
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 14 106 1.0E-17
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 14 106 1.0E-17
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 14 106 1.0E-17
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 14 137 1.0E-17
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 14 101 1.0E-17
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 14 128 1.0E-17
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 20 194 1.0E-17
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 3 112 1.0E-17
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 14 179 1.0E-17
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 14 128 1.0E-17
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 19 128 1.0E-17
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 21 127 1.0E-17
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 14 102 1.0E-17
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 21 126 1.0E-17
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 14 103 1.0E-17
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 14 104 1.0E-17
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 15 128 1.0E-17
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 14 124 1.0E-17
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 19 192 1.0E-17
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 21 128 1.0E-17
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 14 107 1.0E-17
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 13 173 1.0E-17
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 14 126 1.0E-17
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 20 179 1.0E-17
sp|Q9UK13|ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens GN=ZNF221 PE=2 SV=3 14 127 1.0E-17
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 14 131 1.0E-17
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 14 105 2.0E-17
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 6 128 2.0E-17
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 14 105 2.0E-17
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 14 128 2.0E-17
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 14 104 2.0E-17
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 14 128 2.0E-17
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 14 104 2.0E-17
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 14 104 2.0E-17
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 14 104 2.0E-17
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 40 173 2.0E-17
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 25 128 2.0E-17
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 23 128 2.0E-17
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 127 2.0E-17
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 14 131 2.0E-17
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 14 128 2.0E-17
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 11 179 2.0E-17
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 14 116 2.0E-17
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 14 178 2.0E-17
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 14 101 2.0E-17
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 15 127 2.0E-17
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 14 128 2.0E-17
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 14 128 2.0E-17
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 19 179 2.0E-17
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 6 179 2.0E-17
sp|Q6ZNG0|ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens GN=ZNF620 PE=2 SV=1 14 133 2.0E-17
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 25 128 2.0E-17
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 14 128 2.0E-17
sp|A6NP11|ZN716_HUMAN Zinc finger protein 716 OS=Homo sapiens GN=ZNF716 PE=2 SV=4 21 127 2.0E-17
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 21 128 2.0E-17
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 14 128 3.0E-17
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 23 128 3.0E-17
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 14 128 3.0E-17
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 14 106 3.0E-17
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 14 100 3.0E-17
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 14 100 3.0E-17
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 14 179 3.0E-17
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 14 179 3.0E-17
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 14 104 3.0E-17
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 22 128 3.0E-17
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 128 3.0E-17
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 18 128 3.0E-17
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 14 103 3.0E-17
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 128 3.0E-17
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 14 128 3.0E-17
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 14 133 3.0E-17
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 6 129 3.0E-17
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 13 128 3.0E-17
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 21 128 3.0E-17
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 18 128 3.0E-17
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 43 128 3.0E-17
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 14 127 3.0E-17
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 43 128 3.0E-17
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 43 128 3.0E-17
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 43 128 3.0E-17
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 14 105 4.0E-17
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 14 129 4.0E-17
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 14 127 4.0E-17
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 14 128 4.0E-17
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 23 106 4.0E-17
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 15 128 4.0E-17
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 14 127 4.0E-17
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 14 128 4.0E-17
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 14 127 4.0E-17
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 14 128 4.0E-17
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 6 128 4.0E-17
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 14 128 4.0E-17
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 14 102 4.0E-17
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 13 107 4.0E-17
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 14 179 4.0E-17
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 23 128 4.0E-17
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 23 128 4.0E-17
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 14 134 4.0E-17
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 3 107 4.0E-17
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 3 107 4.0E-17
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 23 128 4.0E-17
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 20 179 4.0E-17
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 40 128 5.0E-17
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 14 128 5.0E-17
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 14 127 5.0E-17
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 19 128 5.0E-17
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 14 127 5.0E-17
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 40 128 5.0E-17
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 14 128 5.0E-17
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 14 101 5.0E-17
sp|Q8N9Z0|ZN610_HUMAN Zinc finger protein 610 OS=Homo sapiens GN=ZNF610 PE=2 SV=2 14 128 5.0E-17
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 13 107 5.0E-17
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 12 128 5.0E-17
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 14 128 5.0E-17
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 14 128 6.0E-17
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 44 131 6.0E-17
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 14 128 6.0E-17
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 6 111 6.0E-17
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 40 128 6.0E-17
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 25 128 6.0E-17
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 19 128 6.0E-17
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 14 179 7.0E-17
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 14 128 7.0E-17
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 23 128 7.0E-17
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 23 131 7.0E-17
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 3 107 7.0E-17
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 14 101 8.0E-17
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 14 101 8.0E-17
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 14 101 8.0E-17
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 14 108 8.0E-17
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 6 104 8.0E-17
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 127 8.0E-17
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 14 102 8.0E-17
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 16 127 8.0E-17
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 14 128 8.0E-17
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 14 128 8.0E-17
sp|Q8TAF7|ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens GN=ZNF461 PE=2 SV=2 23 179 9.0E-17
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 14 127 9.0E-17
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 14 131 9.0E-17
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 21 128 9.0E-17
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 6 128 1.0E-16
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 14 179 1.0E-16
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 14 103 1.0E-16
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 24 128 1.0E-16
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 14 101 1.0E-16
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 14 127 1.0E-16
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 14 127 1.0E-16
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 14 128 1.0E-16
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 3 104 1.0E-16
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 14 128 1.0E-16
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 25 179 1.0E-16
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 14 216 1.0E-16
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 14 128 1.0E-16
sp|Q8NCK3|ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens GN=ZNF485 PE=2 SV=1 13 109 1.0E-16
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 23 131 1.0E-16
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 13 176 1.0E-16
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 13 136 1.0E-16
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 32 186 1.0E-16
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 25 186 1.0E-16
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 20 128 2.0E-16
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 25 131 2.0E-16
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 4 104 2.0E-16
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 19 128 2.0E-16
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 127 2.0E-16
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 21 179 2.0E-16
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 15 100 2.0E-16
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 27 179 2.0E-16
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 21 128 2.0E-16
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 14 179 2.0E-16
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 13 107 2.0E-16
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 31 128 2.0E-16
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 14 128 2.0E-16
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 14 128 2.0E-16
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 14 128 2.0E-16
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 14 131 2.0E-16
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 38 128 2.0E-16
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 14 128 2.0E-16
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 14 107 2.0E-16
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 14 128 2.0E-16
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 14 128 2.0E-16
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 13 185 2.0E-16
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 23 128 2.0E-16
sp|Q8N9Z0|ZN610_HUMAN Zinc finger protein 610 OS=Homo sapiens GN=ZNF610 PE=2 SV=2 16 117 2.0E-16
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 14 128 2.0E-16
sp|Q9BS31|ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens GN=ZNF649 PE=1 SV=1 14 128 2.0E-16
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 14 105 3.0E-16
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 14 112 3.0E-16
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 4 128 3.0E-16
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 14 104 3.0E-16
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 14 102 3.0E-16
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 14 128 3.0E-16
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 14 128 3.0E-16
sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 10 126 3.0E-16
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 101 3.0E-16
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 128 3.0E-16
sp|P52743|ZN137_HUMAN Putative zinc finger protein 137 OS=Homo sapiens GN=ZNF137P PE=5 SV=1 14 128 3.0E-16
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 13 127 3.0E-16
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 3 107 3.0E-16
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 14 179 3.0E-16
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 14 128 3.0E-16
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 14 105 3.0E-16
sp|Q494X3|ZN404_HUMAN Zinc finger protein 404 OS=Homo sapiens GN=ZNF404 PE=1 SV=2 14 128 3.0E-16
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 3 101 4.0E-16
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 6 179 4.0E-16
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 14 107 4.0E-16
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 12 109 4.0E-16
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 24 179 4.0E-16
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 38 179 4.0E-16
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 14 112 4.0E-16
sp|Q494X3|ZN404_HUMAN Zinc finger protein 404 OS=Homo sapiens GN=ZNF404 PE=1 SV=2 6 127 4.0E-16
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 3 101 5.0E-16
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 3 101 5.0E-16
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 14 101 5.0E-16
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 25 128 5.0E-16
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 23 104 5.0E-16
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 23 104 5.0E-16
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 6 101 5.0E-16
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 15 104 5.0E-16
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 14 112 5.0E-16
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 14 101 5.0E-16
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 14 102 5.0E-16
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 14 133 5.0E-16
sp|Q5RB33|ZN620_PONAB Zinc finger protein 620 OS=Pongo abelii GN=ZNF620 PE=2 SV=1 14 133 5.0E-16
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 14 128 5.0E-16
sp|Q8NCK3|ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens GN=ZNF485 PE=2 SV=1 12 128 5.0E-16
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 23 179 5.0E-16
sp|A6NP11|ZN716_HUMAN Zinc finger protein 716 OS=Homo sapiens GN=ZNF716 PE=2 SV=4 14 107 5.0E-16
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 3 101 6.0E-16
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 14 104 6.0E-16
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 14 104 6.0E-16
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 11 128 6.0E-16
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 3 128 6.0E-16
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 14 127 6.0E-16
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 23 127 6.0E-16
sp|Q9H8G1|ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens GN=ZNF430 PE=1 SV=3 14 136 6.0E-16
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 14 176 6.0E-16
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 3 107 6.0E-16
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 14 179 6.0E-16
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 14 104 7.0E-16
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 13 100 7.0E-16
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 18 128 7.0E-16
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 23 131 7.0E-16
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 14 103 7.0E-16
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 14 127 7.0E-16
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 14 100 8.0E-16
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 3 179 8.0E-16
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 14 114 8.0E-16
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 14 106 8.0E-16
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 36 128 8.0E-16
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 43 128 8.0E-16
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 43 128 8.0E-16
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 23 127 9.0E-16
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 14 128 9.0E-16
sp|Q6ZNG0|ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens GN=ZNF620 PE=2 SV=1 23 128 9.0E-16
sp|Q494X3|ZN404_HUMAN Zinc finger protein 404 OS=Homo sapiens GN=ZNF404 PE=1 SV=2 14 127 9.0E-16
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 3 104 1.0E-15
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 14 104 1.0E-15
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 14 102 1.0E-15
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 14 128 1.0E-15
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 14 103 1.0E-15
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 15 128 1.0E-15
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 14 100 1.0E-15
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 14 102 1.0E-15
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 3 100 1.0E-15
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 14 127 1.0E-15
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 23 105 1.0E-15
sp|Q8N8Y5|ZFP41_HUMAN Zinc finger protein 41 homolog OS=Homo sapiens GN=ZFP41 PE=2 SV=1 14 105 1.0E-15
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 26 128 1.0E-15
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 14 102 1.0E-15
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 13 128 1.0E-15
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 23 186 1.0E-15
sp|Q5RB33|ZN620_PONAB Zinc finger protein 620 OS=Pongo abelii GN=ZNF620 PE=2 SV=1 25 128 1.0E-15
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 13 128 1.0E-15
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 14 128 1.0E-15
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 14 108 1.0E-15
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 14 105 1.0E-15
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 14 101 2.0E-15
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 15 128 2.0E-15
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 20 179 2.0E-15
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 14 100 2.0E-15
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 46 128 2.0E-15
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 14 104 2.0E-15
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 100 2.0E-15
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 14 109 2.0E-15
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 14 128 2.0E-15
sp|Q5RCX4|ZN547_PONAB Zinc finger protein 547 OS=Pongo abelii GN=ZNF547 PE=2 SV=1 14 128 2.0E-15
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 19 101 2.0E-15
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 13 179 2.0E-15
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 100 2.0E-15
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 12 128 2.0E-15
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 14 103 2.0E-15
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 14 107 2.0E-15
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 14 128 2.0E-15
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 23 128 2.0E-15
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 6 179 2.0E-15
sp|Q4R6J4|ZN684_MACFA Zinc finger protein 684 OS=Macaca fascicularis GN=ZNF684 PE=2 SV=1 14 101 2.0E-15
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 23 112 3.0E-15
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 3 100 3.0E-15
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 14 105 3.0E-15
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 14 127 3.0E-15
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 14 104 3.0E-15
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 14 103 3.0E-15
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 33 179 3.0E-15
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 14 102 3.0E-15
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 14 108 3.0E-15
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 19 128 3.0E-15
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 18 128 3.0E-15
sp|Q3TTC2|TYY2_MOUSE Transcription factor YY2 OS=Mus musculus GN=Yy2 PE=2 SV=1 23 104 3.0E-15
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 23 128 3.0E-15
sp|P0C6P6|TYY2_RAT Transcription factor YY2 OS=Rattus norvegicus GN=Yy2 PE=3 SV=1 23 104 3.0E-15
sp|Q2FAY8|TYY2_RATRT Transcription factor YY2 OS=Rattus rattus GN=Yy2 PE=3 SV=1 23 104 3.0E-15
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 14 98 3.0E-15
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 14 98 3.0E-15
sp|P18752|ZO72_XENLA Oocyte zinc finger protein XlCOF7.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 25 173 3.0E-15
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 12 127 3.0E-15
sp|Q9UK13|ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens GN=ZNF221 PE=2 SV=3 14 216 3.0E-15
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 22 128 3.0E-15
sp|P25490|TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens GN=YY1 PE=1 SV=2 23 100 3.0E-15
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 3 101 4.0E-15
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 51 128 4.0E-15
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 23 112 4.0E-15
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 14 100 4.0E-15
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 23 128 4.0E-15
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 14 128 4.0E-15
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 14 105 4.0E-15
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 3 100 4.0E-15
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 15 104 4.0E-15
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 15 127 4.0E-15
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 14 128 4.0E-15
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 26 128 4.0E-15
sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 14 98 4.0E-15
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 25 127 4.0E-15
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 23 112 5.0E-15
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 25 179 5.0E-15
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 10 128 5.0E-15
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 20 128 5.0E-15
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 23 128 5.0E-15
sp|Q91660|GLI3_XENLA Zinc finger protein GLI3 OS=Xenopus laevis GN=gli3 PE=2 SV=1 14 98 5.0E-15
sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 14 98 5.0E-15
sp|A6NP11|ZN716_HUMAN Zinc finger protein 716 OS=Homo sapiens GN=ZNF716 PE=2 SV=4 23 179 5.0E-15
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 2 100 6.0E-15
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 21 131 6.0E-15
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 14 100 6.0E-15
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 38 179 6.0E-15
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 26 128 6.0E-15
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 23 128 6.0E-15
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 18 105 6.0E-15
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 5 105 7.0E-15
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 14 103 7.0E-15
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 2 108 7.0E-15
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 14 103 7.0E-15
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 24 212 7.0E-15
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 14 102 7.0E-15
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 23 128 7.0E-15
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 19 128 7.0E-15
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 13 128 7.0E-15
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 14 105 8.0E-15
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 14 105 8.0E-15
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 14 128 8.0E-15
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 38 176 8.0E-15
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 14 101 9.0E-15
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 14 128 9.0E-15
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 23 103 9.0E-15
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 26 128 9.0E-15
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 25 131 9.0E-15
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 2 100 1.0E-14
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 26 128 1.0E-14
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 14 107 1.0E-14
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 14 107 1.0E-14
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 38 179 1.0E-14
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 23 103 1.0E-14
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 14 101 1.0E-14
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 14 127 1.0E-14
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 42 128 1.0E-14
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 14 179 1.0E-14
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 2 101 1.0E-14
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 32 127 1.0E-14
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 14 100 1.0E-14
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 46 128 1.0E-14
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 30 128 1.0E-14
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 26 128 1.0E-14
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 14 103 1.0E-14
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 14 100 1.0E-14
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 14 112 1.0E-14
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 26 128 1.0E-14
sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 26 128 1.0E-14
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 14 108 1.0E-14
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 14 108 1.0E-14
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 14 107 1.0E-14
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 11 128 1.0E-14
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 33 128 1.0E-14
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 31 185 1.0E-14
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 3 100 1.0E-14
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 14 101 1.0E-14
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 19 128 2.0E-14
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 14 103 2.0E-14
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 14 106 2.0E-14
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 19 128 2.0E-14
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 24 128 2.0E-14
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 14 104 2.0E-14
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 23 128 2.0E-14
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 42 128 2.0E-14
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 14 101 2.0E-14
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 2 128 2.0E-14
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 14 128 2.0E-14
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 39 128 2.0E-14
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 14 127 2.0E-14
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 14 127 2.0E-14
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 26 128 2.0E-14
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 15 112 2.0E-14
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 26 128 2.0E-14
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 14 98 2.0E-14
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 14 122 2.0E-14
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 25 179 2.0E-14
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 23 128 2.0E-14
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 19 128 3.0E-14
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 14 106 3.0E-14
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 21 128 3.0E-14
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 21 128 3.0E-14
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 14 100 3.0E-14
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 35 128 3.0E-14
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 39 128 3.0E-14
sp|Q8IVP9|ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens GN=ZNF547 PE=2 SV=2 14 128 3.0E-14
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 14 106 3.0E-14
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 14 106 3.0E-14
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 14 108 3.0E-14
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 18 128 3.0E-14
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 23 179 3.0E-14
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 14 100 3.0E-14
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 14 100 3.0E-14
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 38 128 3.0E-14
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 14 103 4.0E-14
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 23 112 4.0E-14
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 11 128 4.0E-14
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 39 128 4.0E-14
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 3 128 4.0E-14
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 14 128 4.0E-14
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 23 179 4.0E-14
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 41 179 4.0E-14
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 43 179 4.0E-14
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 26 128 4.0E-14
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 25 179 4.0E-14
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 14 101 4.0E-14
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 100 4.0E-14
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 27 128 4.0E-14
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 14 102 5.0E-14
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 21 128 5.0E-14
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 14 100 5.0E-14
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 14 105 5.0E-14
sp|Q494X3|ZN404_HUMAN Zinc finger protein 404 OS=Homo sapiens GN=ZNF404 PE=1 SV=2 14 136 5.0E-14
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 14 117 5.0E-14
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 2 100 6.0E-14
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 23 127 6.0E-14
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 14 127 6.0E-14
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 14 107 6.0E-14
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 35 128 6.0E-14
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 14 101 6.0E-14
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 21 128 6.0E-14
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 21 128 6.0E-14
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 14 105 6.0E-14
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 23 128 6.0E-14
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 128 6.0E-14
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 25 127 7.0E-14
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 14 100 7.0E-14
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 43 128 8.0E-14
sp|Q61467|ZIC4_MOUSE Zinc finger protein ZIC 4 OS=Mus musculus GN=Zic4 PE=1 SV=2 2 116 8.0E-14
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 25 179 8.0E-14
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 15 128 8.0E-14
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 14 128 8.0E-14
sp|Q4V8E9|NRIF1_RAT Neurotrophin receptor-interacting factor 1 OS=Rattus norvegicus GN=Nrif1 PE=2 SV=1 21 128 9.0E-14
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 14 103 9.0E-14
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 14 127 9.0E-14
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 16 179 9.0E-14
sp|Q8N9L1|ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens GN=ZIC4 PE=2 SV=3 2 100 1.0E-13
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 14 128 1.0E-13
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 14 105 1.0E-13
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 21 131 1.0E-13
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 14 111 1.0E-13
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 18 128 1.0E-13
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 21 104 1.0E-13
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 43 173 1.0E-13
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 14 100 1.0E-13
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 39 128 1.0E-13
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 39 128 1.0E-13
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 14 102 1.0E-13
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 14 112 1.0E-13
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 14 101 1.0E-13
sp|Q8N9Z0|ZN610_HUMAN Zinc finger protein 610 OS=Homo sapiens GN=ZNF610 PE=2 SV=2 12 107 1.0E-13
sp|Q9BS31|ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens GN=ZNF649 PE=1 SV=1 15 265 1.0E-13
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 23 128 1.0E-13
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 2 128 1.0E-13
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 43 128 2.0E-13
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 14 102 2.0E-13
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 14 102 2.0E-13
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 14 100 2.0E-13
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 14 107 2.0E-13
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 48 128 2.0E-13
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 43 173 2.0E-13
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 21 127 2.0E-13
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 32 128 2.0E-13
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 14 117 2.0E-13
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 39 128 2.0E-13
sp|P0C6P6|TYY2_RAT Transcription factor YY2 OS=Rattus norvegicus GN=Yy2 PE=3 SV=1 44 128 2.0E-13
sp|Q2FAY8|TYY2_RATRT Transcription factor YY2 OS=Rattus rattus GN=Yy2 PE=3 SV=1 44 128 2.0E-13
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 31 128 2.0E-13
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 14 101 2.0E-13
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 14 100 2.0E-13
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 25 179 2.0E-13
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 14 107 2.0E-13
sp|Q9UK13|ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens GN=ZNF221 PE=2 SV=3 14 112 2.0E-13
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 14 107 2.0E-13
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 41 128 3.0E-13
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 41 128 3.0E-13
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 7 128 3.0E-13
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 14 101 3.0E-13
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 6 101 3.0E-13
sp|Q6ZNG0|ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens GN=ZNF620 PE=2 SV=1 14 105 3.0E-13
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 35 127 3.0E-13
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 14 101 3.0E-13
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 27 128 4.0E-13
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 26 173 4.0E-13
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 14 100 4.0E-13
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 15 128 4.0E-13
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 14 101 4.0E-13
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 41 128 4.0E-13
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 15 128 4.0E-13
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 14 100 4.0E-13
sp|Q9VDZ3|SQZ_DROME Zinc finger protein squeeze OS=Drosophila melanogaster GN=sqz PE=1 SV=2 44 128 4.0E-13
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 5 100 4.0E-13
sp|Q293Q2|SQZ_DROPS Zinc finger protein squeeze OS=Drosophila pseudoobscura pseudoobscura GN=sqz PE=3 SV=2 44 128 4.0E-13
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 19 128 5.0E-13
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 14 128 5.0E-13
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 19 117 5.0E-13
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 13 179 5.0E-13
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 14 102 5.0E-13
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 14 98 5.0E-13
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 14 102 6.0E-13
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 25 128 6.0E-13
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 20 173 7.0E-13
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 14 142 7.0E-13
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 18 128 7.0E-13
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 14 106 7.0E-13
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 14 100 7.0E-13
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 19 128 8.0E-13
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 100 8.0E-13
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 14 100 8.0E-13
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 14 100 8.0E-13
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 39 128 9.0E-13
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 26 128 1.0E-12
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 14 108 1.0E-12
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 27 128 1.0E-12
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 6 173 1.0E-12
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 14 109 1.0E-12
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 2 100 1.0E-12
sp|Q7Z398|ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens GN=ZNF550 PE=1 SV=2 14 101 1.0E-12
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 14 128 1.0E-12
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 27 128 1.0E-12
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 14 112 1.0E-12
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 23 128 1.0E-12
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 14 106 1.0E-12
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 14 100 1.0E-12
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 14 100 1.0E-12
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 23 128 1.0E-12
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 41 128 2.0E-12
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 14 101 2.0E-12
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 25 179 2.0E-12
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 14 100 2.0E-12
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 14 104 2.0E-12
sp|Q6U7Q0|ZN322_HUMAN Zinc finger protein 322 OS=Homo sapiens GN=ZNF322 PE=1 SV=2 23 173 2.0E-12
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 14 128 2.0E-12
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 14 128 2.0E-12
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 23 128 2.0E-12
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 19 108 2.0E-12
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 53 128 2.0E-12
sp|Q3TTC2|TYY2_MOUSE Transcription factor YY2 OS=Mus musculus GN=Yy2 PE=2 SV=1 44 128 2.0E-12
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 14 127 2.0E-12
sp|Q9BS31|ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens GN=ZNF649 PE=1 SV=1 9 104 2.0E-12
sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 2 100 3.0E-12
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 25 173 3.0E-12
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 21 128 3.0E-12
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 13 185 3.0E-12
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 14 127 4.0E-12
sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 2 100 4.0E-12
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 14 101 4.0E-12
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 18 128 4.0E-12
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 38 128 4.0E-12
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 43 128 4.0E-12
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 100 4.0E-12
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 14 105 4.0E-12
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 14 128 5.0E-12
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 14 128 5.0E-12
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 7 104 5.0E-12
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 14 100 5.0E-12
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 28 179 5.0E-12
sp|Q4R7X8|ZN322_MACFA Zinc finger protein 322 OS=Macaca fascicularis GN=ZNF322 PE=2 SV=1 23 173 7.0E-12
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 35 128 7.0E-12
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 14 128 7.0E-12
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 25 131 7.0E-12
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 3 102 8.0E-12
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 14 111 9.0E-12
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 33 128 9.0E-12
sp|Q5RB33|ZN620_PONAB Zinc finger protein 620 OS=Pongo abelii GN=ZNF620 PE=2 SV=1 14 105 9.0E-12
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 21 103 1.0E-11
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 21 128 1.0E-11
sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 14 102 1.0E-11
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 14 102 1.0E-11
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 14 103 1.0E-11
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 12 128 1.0E-11
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 14 127 1.0E-11
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 13 128 1.0E-11
sp|Q8N9Z0|ZN610_HUMAN Zinc finger protein 610 OS=Homo sapiens GN=ZNF610 PE=2 SV=2 46 179 1.0E-11
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 14 109 1.0E-11
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 25 179 1.0E-11
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 14 100 1.0E-11
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 41 128 1.0E-11
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 6 128 2.0E-11
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 3 103 2.0E-11
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 14 100 2.0E-11
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 14 100 2.0E-11
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 19 128 2.0E-11
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 2 179 2.0E-11
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 21 128 2.0E-11
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 2 126 2.0E-11
sp|Q8NCK3|ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens GN=ZNF485 PE=2 SV=1 41 128 2.0E-11
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 53 128 2.0E-11
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 12 128 2.0E-11
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 45 128 2.0E-11
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 6 106 3.0E-11
sp|Q9UK13|ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens GN=ZNF221 PE=2 SV=3 3 107 3.0E-11
sp|P25490|TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens GN=YY1 PE=1 SV=2 38 128 3.0E-11
sp|P25490|TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens GN=YY1 PE=1 SV=2 14 77 3.0E-11
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 7 126 3.0E-11
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 13 185 4.0E-11
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 14 100 5.0E-11
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 26 128 5.0E-11
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 26 128 5.0E-11
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 25 128 5.0E-11
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 14 75 5.0E-11
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 14 105 5.0E-11
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 14 128 6.0E-11
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 14 179 6.0E-11
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 23 136 6.0E-11
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 14 102 6.0E-11
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 6 128 6.0E-11
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 14 104 7.0E-11
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 14 127 7.0E-11
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 14 104 8.0E-11
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 19 145 8.0E-11
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 59 185 9.0E-11
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 63 185 1.0E-10
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 3 104 1.0E-10
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 14 117 1.0E-10
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 45 128 1.0E-10
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 21 179 1.0E-10
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 13 179 1.0E-10
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 14 101 1.0E-10
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 25 179 2.0E-10
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 14 87 2.0E-10
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 18 128 2.0E-10
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 14 108 2.0E-10
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 1 128 2.0E-10
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 41 133 2.0E-10
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 14 105 3.0E-10
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 14 112 3.0E-10
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 14 105 3.0E-10
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 14 75 4.0E-10
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 14 75 4.0E-10
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 3 75 4.0E-10
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 38 128 4.0E-10
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 14 106 4.0E-10
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 21 183 5.0E-10
sp|P52743|ZN137_HUMAN Putative zinc finger protein 137 OS=Homo sapiens GN=ZNF137P PE=5 SV=1 23 100 6.0E-10
sp|Q494X3|ZN404_HUMAN Zinc finger protein 404 OS=Homo sapiens GN=ZNF404 PE=1 SV=2 24 128 6.0E-10
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 14 123 6.0E-10
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 25 127 7.0E-10
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 14 104 8.0E-10
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 14 128 8.0E-10
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 6 73 9.0E-10
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 1 103 9.0E-10
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 18 128 1.0E-09
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 14 127 1.0E-09
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 21 106 1.0E-09
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 23 179 1.0E-09
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 23 101 1.0E-09
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 16 126 1.0E-09
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 14 74 1.0E-09
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 53 179 1.0E-09
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 14 73 2.0E-09
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 14 114 2.0E-09
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 14 114 2.0E-09
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 34 128 2.0E-09
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 52 128 2.0E-09
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 52 128 2.0E-09
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 19 173 2.0E-09
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 35 128 2.0E-09
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 6 73 2.0E-09
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 14 77 2.0E-09
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 2 102 2.0E-09
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 45 128 2.0E-09
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 3 108 2.0E-09
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 43 179 2.0E-09
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 54 128 3.0E-09
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 59 186 3.0E-09
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 14 79 3.0E-09
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 31 128 3.0E-09
sp|Q5RB33|ZN620_PONAB Zinc finger protein 620 OS=Pongo abelii GN=ZNF620 PE=2 SV=1 54 128 3.0E-09
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 25 128 3.0E-09
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 21 128 4.0E-09
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 14 76 4.0E-09
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 14 82 4.0E-09
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 14 106 4.0E-09
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 14 100 4.0E-09
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 14 73 5.0E-09
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 14 73 5.0E-09
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 14 73 5.0E-09
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 14 73 5.0E-09
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 14 73 5.0E-09
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 23 101 5.0E-09
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 14 76 5.0E-09
sp|Q3TTC2|TYY2_MOUSE Transcription factor YY2 OS=Mus musculus GN=Yy2 PE=2 SV=1 14 77 5.0E-09
sp|P0C6P6|TYY2_RAT Transcription factor YY2 OS=Rattus norvegicus GN=Yy2 PE=3 SV=1 14 77 5.0E-09
sp|Q2FAY8|TYY2_RATRT Transcription factor YY2 OS=Rattus rattus GN=Yy2 PE=3 SV=1 14 77 5.0E-09
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 5 128 5.0E-09
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 68 179 6.0E-09
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 61 128 6.0E-09
sp|P18747|ZO28_XENLA Oocyte zinc finger protein XlCOF28 (Fragment) OS=Xenopus laevis PE=3 SV=1 44 185 6.0E-09
sp|Q494X3|ZN404_HUMAN Zinc finger protein 404 OS=Homo sapiens GN=ZNF404 PE=1 SV=2 27 127 6.0E-09
sp|Q6U7Q0|ZN322_HUMAN Zinc finger protein 322 OS=Homo sapiens GN=ZNF322 PE=1 SV=2 29 173 7.0E-09
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 6 94 8.0E-09
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 13 102 8.0E-09
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 13 102 8.0E-09
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 14 101 8.0E-09
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 6 74 1.0E-08
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 6 128 1.0E-08
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 26 128 1.0E-08
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 14 117 1.0E-08
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 14 76 1.0E-08
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 14 79 1.0E-08
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 14 76 1.0E-08
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 39 128 2.0E-08
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 63 128 2.0E-08
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 13 179 2.0E-08
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 20 127 2.0E-08
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 14 106 2.0E-08
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 41 127 2.0E-08
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 14 76 2.0E-08
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 14 76 3.0E-08
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 3 78 3.0E-08
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 14 76 3.0E-08
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 13 128 3.0E-08
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 38 128 3.0E-08
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 14 76 3.0E-08
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 14 76 4.0E-08
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 21 128 4.0E-08
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 26 128 4.0E-08
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 19 129 5.0E-08
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 31 128 5.0E-08
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 14 112 5.0E-08
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 25 179 6.0E-08
sp|Q8N9L1|ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens GN=ZIC4 PE=2 SV=3 47 126 6.0E-08
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 14 93 6.0E-08
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 39 179 6.0E-08
sp|Q4R7X8|ZN322_MACFA Zinc finger protein 322 OS=Macaca fascicularis GN=ZNF322 PE=2 SV=1 14 108 7.0E-08
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 14 94 7.0E-08
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 28 128 8.0E-08
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 25 179 8.0E-08
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 25 108 8.0E-08
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 52 128 9.0E-08
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 13 128 9.0E-08
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 54 128 9.0E-08
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 10 127 1.0E-07
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 14 79 1.0E-07
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 14 127 1.0E-07
sp|Q6U7Q0|ZN322_HUMAN Zinc finger protein 322 OS=Homo sapiens GN=ZNF322 PE=1 SV=2 14 107 1.0E-07
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 54 128 1.0E-07
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 35 179 1.0E-07
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 31 128 1.0E-07
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 40 131 1.0E-07
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 54 127 1.0E-07
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 5 128 1.0E-07
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 54 127 1.0E-07
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 14 95 1.0E-07
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 13 127 1.0E-07
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 46 128 2.0E-07
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 19 127 2.0E-07
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 14 93 2.0E-07
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 71 128 2.0E-07
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 71 128 2.0E-07
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 21 126 2.0E-07
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 14 74 2.0E-07
sp|Q8NEK5|ZN548_HUMAN Zinc finger protein 548 OS=Homo sapiens GN=ZNF548 PE=2 SV=2 41 128 2.0E-07
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 23 128 2.0E-07
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 14 73 2.0E-07
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 16 127 2.0E-07
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 57 179 2.0E-07
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 38 186 2.0E-07
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 11 128 2.0E-07
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 14 75 3.0E-07
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 38 128 3.0E-07
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 7 112 3.0E-07
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 5 128 3.0E-07
sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 54 127 3.0E-07
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 60 128 3.0E-07
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 54 128 3.0E-07
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 14 133 3.0E-07
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 54 128 4.0E-07
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 71 128 4.0E-07
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 14 73 4.0E-07
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 14 73 4.0E-07
sp|Q8NBF1|GLIS1_HUMAN Zinc finger protein GLIS1 OS=Homo sapiens GN=GLIS1 PE=2 SV=2 14 74 4.0E-07
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 54 127 4.0E-07
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 54 127 4.0E-07
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 14 173 4.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 14 75 5.0E-07
sp|Q8NEA6|GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens GN=GLIS3 PE=2 SV=5 14 74 5.0E-07
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 20 128 5.0E-07
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 14 106 5.0E-07
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 14 74 5.0E-07
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 41 128 5.0E-07
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 18 127 5.0E-07
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 54 128 6.0E-07
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 14 74 6.0E-07
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 14 73 6.0E-07
sp|Q6XP49|GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus GN=Glis3 PE=1 SV=2 14 74 7.0E-07
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 14 74 7.0E-07
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 54 128 8.0E-07
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 14 79 8.0E-07
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 41 173 8.0E-07
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 19 128 8.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 38 218 8.0E-07
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 14 75 9.0E-07
sp|Q8BZ89|ZN322_MOUSE Zinc finger protein 322 OS=Mus musculus GN=Znf322 PE=2 SV=1 14 106 9.0E-07
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 54 127 9.0E-07
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 46 128 1.0E-06
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 46 128 1.0E-06
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 24 179 1.0E-06
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 19 173 1.0E-06
sp|Q5RCX4|ZN547_PONAB Zinc finger protein 547 OS=Pongo abelii GN=ZNF547 PE=2 SV=1 68 179 1.0E-06
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 71 126 1.0E-06
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 19 179 1.0E-06
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 14 74 1.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 14 73 1.0E-06
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 54 179 1.0E-06
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 14 70 2.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 14 73 2.0E-06
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 14 76 2.0E-06
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 46 128 2.0E-06
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 54 128 2.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 14 73 2.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 14 73 2.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 14 73 2.0E-06
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 23 73 2.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 69 128 2.0E-06
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 15 105 2.0E-06
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 68 218 2.0E-06
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 2 128 2.0E-06
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 73 129 2.0E-06
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 73 129 2.0E-06
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 14 73 3.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 53 128 3.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 14 73 3.0E-06
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 14 71 3.0E-06
sp|Q6ZNG0|ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens GN=ZNF620 PE=2 SV=1 14 77 3.0E-06
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 19 128 3.0E-06
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 14 74 3.0E-06
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 14 75 4.0E-06
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 25 128 4.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 43 179 4.0E-06
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 35 127 4.0E-06
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 25 109 4.0E-06
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 23 74 4.0E-06
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 3 73 4.0E-06
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 11 112 4.0E-06
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 53 133 4.0E-06
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 23 73 4.0E-06
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 25 179 5.0E-06
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 14 74 5.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 71 179 5.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 70 179 6.0E-06
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 14 77 6.0E-06
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 63 179 7.0E-06
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 61 179 8.0E-06
sp|Q8IVP9|ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens GN=ZNF547 PE=2 SV=2 68 179 9.0E-06
sp|Q8TAW3|ZN671_HUMAN Zinc finger protein 671 OS=Homo sapiens GN=ZNF671 PE=2 SV=2 25 127 1.0E-05
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 14 82 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7349
MELLELVEYEPTTRPFQCDWDSCNKSFNRKSDLQRHYRIHTNERPYTCTTPGCGKSFIQRSALTVHIRTHTGEKP
HQCQHMGCGKRFSDSSSLARHRRIHTGKRPYKCAHDGCLKSFCRKTTMVKHQRRSHQRGLLSNDMLDDCTSDSES
GESPPTPTQSTMSWPAPSHLAPHPILSNGHAMHRAASFPDFQMGGYQAMAQQPRPGDGADFGHPAGQGPPPHGMP
VMQRSPGMQQHFYVIEQANPGIATMNTTTAAMQQPYHVPRQQVDRAAPMDMPYSAGSMTSMSSSPGSFSPASGHS
PTMPDGMYTHQAPQPGAYALPETSPAEPSHSMVPYPQSIGHSQPPPPPPPPQQQQHQQHQQQPTSHAEPEAWYPY
QAPVEVATIGQLPPFGSGVYDLYGGPKIEFDDPTMQLPSSRIETM*
Coding >Hirsu2|7349
ATGGAACTCCTCGAGCTTGTCGAGTACGAGCCCACGACTCGTCCCTTTCAGTGCGACTGGGATTCGTGCAACAAG
AGCTTCAACCGCAAGTCAGATCTCCAGCGACACTACAGGATACACACGAACGAGCGGCCGTACACGTGTACGACG
CCCGGCTGTGGCAAGAGCTTCATCCAACGCAGCGCCCTGACCGTTCACATCCGCACGCATACGGGCGAGAAGCCT
CATCAGTGCCAACATATGGGTTGCGGAAAGCGCTTCTCCGACTCGTCCAGTCTTGCCCGGCATCGCCGCATTCAC
ACCGGCAAGCGCCCTTACAAGTGCGCCCACGACGGCTGCCTCAAGAGCTTCTGTCGCAAGACGACCATGGTCAAG
CACCAGCGGAGATCGCACCAGCGCGGCCTCCTGTCCAACGACATGCTGGACGACTGCACGTCCGACTCGGAGAGC
GGCGAGTCGCCGCCGACGCCGACGCAGTCGACCATGTCGTGGCCGGCGCCGTCGCACCTGGCGCCGCACCCGATC
CTGTCCAACGGCCACGCGATGCACCGGGCCGCCTCCTTCCCCGACTTCCAGATGGGCGGCTACCAGGCCATGGCG
CAGCAGCCGCGGCCGGGCGACGGCGCCGACTTCGGCCACCCGGCCGGCCAGGGCCCGCCGCCGCACGGGATGCCG
GTGATGCAGCGCTCGCCCGGCATGCAGCAGCACTTCTACGTCATCGAGCAGGCCAACCCGGGCATCGCCACCATG
AACACGACGACGGCGGCGATGCAGCAGCCGTACCACGTGCCGCGGCAGCAGGTCGACCGCGCCGCGCCCATGGAC
ATGCCCTACTCGGCCGGCAGCATGACGTCGATGAGCAGCAGTCCGGGCAGCTTCTCGCCCGCCTCGGGCCACAGC
CCGACCATGCCGGACGGCATGTACACGCACCAGGCGCCCCAGCCCGGCGCCTACGCCCTGCCCGAGACGTCGCCG
GCCGAGCCGTCGCACTCCATGGTGCCCTACCCGCAGTCCATCGGCCACTCGCAGCCGCCGCCGCCGCCGCCGCCG
CCGCAGCAGCAGCAGCACCAACAGCACCAACAGCAGCCGACGTCGCACGCCGAGCCCGAGGCCTGGTACCCGTAT
CAGGCCCCCGTCGAGGTGGCCACCATCGGCCAGCTGCCGCCCTTCGGCTCCGGCGTCTACGACCTCTACGGCGGC
CCCAAGATCGAGTTCGACGACCCGACGATGCAGCTGCCCAGCAGTAGGATCGAGACCATGTGA
Transcript >Hirsu2|7349
ATGGAACTCCTCGAGCTTGTCGAGTACGAGCCCACGACTCGTCCCTTTCAGTGCGACTGGGATTCGTGCAACAAG
AGCTTCAACCGCAAGTCAGATCTCCAGCGACACTACAGGATACACACGAACGAGCGGCCGTACACGTGTACGACG
CCCGGCTGTGGCAAGAGCTTCATCCAACGCAGCGCCCTGACCGTTCACATCCGCACGCATACGGGCGAGAAGCCT
CATCAGTGCCAACATATGGGTTGCGGAAAGCGCTTCTCCGACTCGTCCAGTCTTGCCCGGCATCGCCGCATTCAC
ACCGGCAAGCGCCCTTACAAGTGCGCCCACGACGGCTGCCTCAAGAGCTTCTGTCGCAAGACGACCATGGTCAAG
CACCAGCGGAGATCGCACCAGCGCGGCCTCCTGTCCAACGACATGCTGGACGACTGCACGTCCGACTCGGAGAGC
GGCGAGTCGCCGCCGACGCCGACGCAGTCGACCATGTCGTGGCCGGCGCCGTCGCACCTGGCGCCGCACCCGATC
CTGTCCAACGGCCACGCGATGCACCGGGCCGCCTCCTTCCCCGACTTCCAGATGGGCGGCTACCAGGCCATGGCG
CAGCAGCCGCGGCCGGGCGACGGCGCCGACTTCGGCCACCCGGCCGGCCAGGGCCCGCCGCCGCACGGGATGCCG
GTGATGCAGCGCTCGCCCGGCATGCAGCAGCACTTCTACGTCATCGAGCAGGCCAACCCGGGCATCGCCACCATG
AACACGACGACGGCGGCGATGCAGCAGCCGTACCACGTGCCGCGGCAGCAGGTCGACCGCGCCGCGCCCATGGAC
ATGCCCTACTCGGCCGGCAGCATGACGTCGATGAGCAGCAGTCCGGGCAGCTTCTCGCCCGCCTCGGGCCACAGC
CCGACCATGCCGGACGGCATGTACACGCACCAGGCGCCCCAGCCCGGCGCCTACGCCCTGCCCGAGACGTCGCCG
GCCGAGCCGTCGCACTCCATGGTGCCCTACCCGCAGTCCATCGGCCACTCGCAGCCGCCGCCGCCGCCGCCGCCG
CCGCAGCAGCAGCAGCACCAACAGCACCAACAGCAGCCGACGTCGCACGCCGAGCCCGAGGCCTGGTACCCGTAT
CAGGCCCCCGTCGAGGTGGCCACCATCGGCCAGCTGCCGCCCTTCGGCTCCGGCGTCTACGACCTCTACGGCGGC
CCCAAGATCGAGTTCGACGACCCGACGATGCAGCTGCCCAGCAGTAGGATCGAGACCATGTGA
Gene >Hirsu2|7349
ATGGAACTCCTCGAGCTTGTCGAGTACGAGCCCACGACTCGTCCCTTTCAGTGCGACTGGGATTCGTGCAACAAG
GTAACCAAGGCTCCCCCCGTCTGAAGCAGCCGGCGACGAGCAGTTGTCCTAACAGACGGCGAGCAGAGCTTCAAC
CGCAAGTCAGATCTCCAGCGACACTACAGGATACACACGAACGAGCGGCCGTACACGTGTACGACGCCCGGCTGT
GGCAAGAGCTTCATCCAACGCAGCGCCCTGACCGTTCACATCCGCACGCATACGGGCGAGAAGCCTCATCAGTGC
CAACATATGGGTTGCGGAAAGCGCTTCTCCGACGTTGGTCCCCCCCCTTTTTTCACGTCCCATGGTCCGTCCTTT
CAGGAAGGGGGAGCATTCCAGACTGACTTGTGTTGCCTCCTCGCCAGTCGTCCAGTCTTGCCCGGCATCGCCGCA
TTCACACCGGCAAGCGCCCTTACAAGTGCGCCCACGACGGCTGCCTCAAGAGGTTCGTCTGCCCTGTTCCGAGCC
GGGGGATGGACGGCGGATGCTGACGTTGGCGCCTCCACAGCTTCTGTCGCAAGACGACCATGGTCAAGCACCAGC
GGAGATCGCACCAGCGCGGCCTCCTGTCCAACGACATGCTGGACGACTGCACGTCCGACTCGGAGAGCGGCGAGT
CGCCGCCGACGCCGACGCAGTCGACCATGTCGTGGCCGGCGCCGTCGCACCTGGCGCCGCACCCGATCCTGTCCA
ACGGCCACGCGATGCACCGGGCCGCCTCCTTCCCCGACTTCCAGATGGGCGGCTACCAGGCCATGGCGCAGCAGC
CGCGGCCGGGCGACGGCGCCGACTTCGGCCACCCGGCCGGCCAGGGCCCGCCGCCGCACGGGATGCCGGTGATGC
AGCGCTCGCCCGGCATGCAGCAGCACTTCTACGTCATCGAGCAGGCCAACCCGGGCATCGCCACCATGAACACGA
CGACGGCGGCGATGCAGCAGCCGTACCACGTGCCGCGGCAGCAGGTCGACCGCGCCGCGCCCATGGACATGCCCT
ACTCGGCCGGCAGCATGACGTCGATGAGCAGCAGTCCGGGCAGCTTCTCGCCCGCCTCGGGCCACAGCCCGACCA
TGCCGGACGGCATGTACACGCACCAGGCGCCCCAGCCCGGCGCCTACGCCCTGCCCGAGACGTCGCCGGCCGAGC
CGTCGCACTCCATGGTGCCCTACCCGCAGTCCATCGGCCACTCGCAGCCGCCGCCGCCGCCGCCGCCGCCGCAGC
AGCAGCAGCACCAACAGCACCAACAGCAGCCGACGTCGCACGCCGAGCCCGAGGCCTGGTACCCGTATCAGGCCC
CCGTCGAGGTGGCCACCATCGGCCAGCTGCCGCCCTTCGGCTCCGGCGTCTACGACCTCTACGGCGGCCCCAAGA
TCGAGTTCGACGACCCGACGATGCAGCTGCCCAGCAGTAGGATCGAGACCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail