Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7348
Gene name
LocationContig_421:16451..18763
Strand+
Gene length (bp)2312
Transcript length (bp)1995
Coding sequence length (bp)1995
Protein length (aa) 665

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01603 B56 Protein phosphatase 2A regulatory B subunit (B56 family) 1.2E-192 186 595

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q14738|2A5D_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens GN=PPP2R5D PE=1 SV=1 161 595 0.0E+00
sp|Q60996|2A5G_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Mus musculus GN=Ppp2r5c PE=1 SV=2 191 650 0.0E+00
sp|Q28651|2A5G_RABIT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Oryctolagus cuniculus GN=PPP2R5C PE=2 SV=1 191 633 0.0E+00
sp|Q13362|2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens GN=PPP2R5C PE=1 SV=3 191 640 0.0E+00
sp|P38903|2A5D_YEAST Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTS1 PE=1 SV=2 156 599 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q14738|2A5D_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens GN=PPP2R5D PE=1 SV=1 161 595 0.0E+00
sp|Q60996|2A5G_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Mus musculus GN=Ppp2r5c PE=1 SV=2 191 650 0.0E+00
sp|Q28651|2A5G_RABIT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Oryctolagus cuniculus GN=PPP2R5C PE=2 SV=1 191 633 0.0E+00
sp|Q13362|2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens GN=PPP2R5C PE=1 SV=3 191 640 0.0E+00
sp|P38903|2A5D_YEAST Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTS1 PE=1 SV=2 156 599 0.0E+00
sp|Q10428|2AD1_SCHPO Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta 1 isoform OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=par1 PE=1 SV=1 127 597 0.0E+00
sp|Q6PD03|2A5A_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Mus musculus GN=Ppp2r5a PE=1 SV=1 156 593 0.0E+00
sp|Q15172|2A5A_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens GN=PPP2R5A PE=1 SV=1 156 570 0.0E+00
sp|Q28653|2A5D_RABIT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Oryctolagus cuniculus GN=PPP2R5D PE=2 SV=1 161 595 0.0E+00
sp|Q28647|2A5B_RABIT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Oryctolagus cuniculus GN=PPP2R5B PE=2 SV=1 172 613 2.0E-180
sp|Q61151|2A5E_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Mus musculus GN=Ppp2r5e PE=1 SV=3 182 570 5.0E-179
sp|Q16537|2A5E_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens GN=PPP2R5E PE=1 SV=1 182 570 7.0E-179
sp|A4FV68|2A5E_BOVIN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Bos taurus GN=PPP2R5E PE=1 SV=1 182 570 7.0E-179
sp|Q15173|2A5B_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Homo sapiens GN=PPP2R5B PE=1 SV=1 172 613 2.0E-177
sp|P78759|2AD2_SCHPO Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta 2 isoform OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=par2 PE=1 SV=2 153 599 3.0E-176
sp|Q9LU89|2A5N_ARATH Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' eta isoform OS=Arabidopsis thaliana GN=B'ETA PE=2 SV=1 184 593 1.0E-161
sp|Q8LF36|2A5T_ARATH Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' theta isoform OS=Arabidopsis thaliana GN=B'THETA PE=2 SV=2 184 602 5.0E-158
sp|O04376|2A5B_ARATH Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' beta isoform OS=Arabidopsis thaliana GN=B'BETA PE=1 SV=1 183 609 2.0E-155
sp|Q8RW96|2A5G_ARATH Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' gamma isoform OS=Arabidopsis thaliana GN=B'GAMMA PE=1 SV=2 184 618 8.0E-154
sp|O04375|2A5A_ARATH Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' alpha isoform OS=Arabidopsis thaliana GN=B'ALPHA PE=1 SV=1 183 598 4.0E-150
sp|Q9LVE2|2A5Z_ARATH Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' zeta isoform OS=Arabidopsis thaliana GN=B'ZETA PE=2 SV=2 184 603 6.0E-150
sp|Q54VB6|PSRA_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit psrA OS=Dictyostelium discoideum GN=psrA PE=3 SV=1 168 567 2.0E-144
sp|Q93YV6|2A5I_ARATH Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' iota isoform OS=Arabidopsis thaliana GN=B'IOTA PE=2 SV=1 168 613 8.0E-142
sp|Q9ZQY6|2A5D_ARATH Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B' delta isoform OS=Arabidopsis thaliana GN=B'DELTA PE=1 SV=1 152 593 1.0E-138
sp|Q9SV41|2A5E_ARATH Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' epsilon isoform OS=Arabidopsis thaliana GN=B'EPSILON PE=2 SV=1 183 596 2.0E-135
sp|Q28654|2A5E_RABIT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform (Fragment) OS=Oryctolagus cuniculus GN=PPP2R5E PE=2 SV=1 182 306 2.0E-37
[Show less]

GO

GO Term Description Terminal node
GO:0019888 protein phosphatase regulator activity Yes
GO:0000159 protein phosphatase type 2A complex Yes
GO:0007165 signal transduction Yes
GO:0019208 phosphatase regulator activity No
GO:0098772 molecular function regulator No
GO:0050794 regulation of cellular process No
GO:0005575 cellular_component No
GO:0044424 intracellular part No
GO:0030234 enzyme regulator activity No
GO:1903293 phosphatase complex No
GO:0003674 molecular_function No
GO:0032991 protein-containing complex No
GO:0044464 cell part No
GO:0008287 protein serine/threonine phosphatase complex No
GO:0065007 biological regulation No
GO:1902494 catalytic complex No
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7348
MKRFSQRVLSRGKDPNKSSKKNKESKDGTSSPSSRDSSNQSPVLTPSSSTSTLNDIRNKPLPPNNAAHAGDHNAP
GQPSNLSNVTQQAHVPERLGSVGGTSSPNGGAANARLPPTVVISPTPGHVPPPGAAETMPHDLAPPKAGQKSLLI
HRGIDNRDAIPEGLRTPKRQHSSRFDISAHRELEKLPGFHEVPPNRRQELFMQKIDQCNVIFDFNDASGDMKAKE
IKRLALHELLDYVANNRQVITEPMYPRVVDMFAKNLFRPIPPPVNPQGEAFDPEEDEPVLEVAWPHIQVVYEFFL
RFIESQDFNTNIAKAYIDHSFVLQLLDLFDSEDPRERDFLKTTLHRIYGKFLNLRSFIRRSINNVFFQFTYETER
FNGIAELLEILGSIINGFALPLKEEHKIFLTRVLLPLHKPKSLSMYHPQLAYCIVQFLEKDASLTEEVVLGLLRY
WPKVNSTKEVMFLNEVEDIFEVMDPAEFAKVQEPLFQQLAKSVASPHFQVAERALYFWNNEYFCNLVSDNVEIIL
PIMFAPLYENSKGHWNRTIHGMVYNAMKLFMEINPQLFDDCSHEYTEQQNSAAEREALRERKWAALGERANQRRA
AASGGTATEAPARPQGGSLPRVEEVDPVSEDNQKRLDSLKLQDAAGRRPSGHERQSSAGSARSR*
Coding >Hirsu2|7348
ATGAAACGATTTAGCCAAAGAGTCCTCTCTCGAGGCAAGGACCCCAACAAGTCTTCTAAGAAGAACAAGGAGTCC
AAGGACGGCACCTCGTCGCCCTCGTCTCGTGATTCCTCCAACCAGTCCCCTGTCCTGACGCCCTCCTCCTCGACG
TCGACGCTCAACGACATTCGGAATAAGCCCCTCCCCCCCAACAACGCCGCCCATGCCGGCGATCACAACGCCCCC
GGCCAGCCCTCGAATCTCTCCAACGTCACCCAGCAGGCTCATGTTCCCGAGCGTCTAGGCTCCGTCGGCGGCACT
TCGAGCCCCAATGGCGGTGCCGCCAACGCTAGACTGCCTCCGACGGTCGTCATCAGCCCAACGCCAGGTCACGTT
CCTCCCCCCGGTGCTGCCGAGACGATGCCTCACGACCTGGCCCCGCCCAAGGCCGGCCAGAAATCGCTCCTGATC
CACAGGGGCATCGACAACCGCGACGCCATACCCGAGGGACTGCGGACGCCCAAGAGGCAGCACTCGTCTCGTTTC
GACATCTCGGCCCACCGGGAGCTCGAGAAGCTCCCCGGCTTCCACGAGGTGCCGCCTAACAGGCGACAGGAGCTG
TTCATGCAGAAGATTGACCAGTGCAACGTCATCTTCGACTTCAACGACGCGAGCGGCGATATGAAGGCGAAGGAG
ATCAAGCGGCTTGCCCTCCACGAGCTGCTCGACTACGTCGCCAACAACCGGCAGGTCATCACCGAGCCCATGTAT
CCCCGCGTTGTCGACATGTTCGCCAAGAACCTGTTTCGGCCCATACCCCCCCCCGTCAACCCCCAAGGCGAGGCC
TTCGATCCGGAGGAGGACGAGCCGGTGCTCGAGGTCGCCTGGCCGCACATCCAGGTCGTCTACGAGTTCTTCCTG
CGCTTCATCGAGAGCCAGGACTTCAACACCAACATCGCCAAGGCCTACATCGACCATAGCTTTGTCTTGCAGCTG
CTCGACCTCTTCGACTCGGAAGACCCCCGCGAGCGCGACTTCCTGAAGACGACACTCCATCGCATCTACGGCAAA
TTCCTCAACCTGCGATCCTTCATTCGGCGGTCCATCAACAACGTCTTCTTCCAATTCACGTACGAGACGGAGAGG
TTCAACGGCATCGCCGAGCTGCTCGAGATCCTCGGCTCCATCATCAACGGCTTCGCACTGCCGCTGAAAGAGGAG
CACAAGATCTTCCTGACGCGCGTGCTGCTGCCCCTCCACAAGCCCAAGAGCCTGAGCATGTATCATCCCCAGCTG
GCCTACTGCATCGTGCAGTTCCTGGAGAAGGACGCCTCTCTGACGGAAGAGGTTGTTCTGGGGCTGCTGCGTTAT
TGGCCCAAGGTCAACAGTACCAAGGAAGTCATGTTCCTGAACGAAGTCGAGGACATCTTCGAGGTCATGGACCCC
GCCGAGTTTGCCAAGGTCCAGGAGCCTCTGTTCCAGCAGCTGGCCAAGTCGGTCGCCAGCCCGCACTTCCAGGTC
GCCGAGCGCGCCCTGTACTTCTGGAACAACGAATACTTCTGCAACCTCGTGAGCGACAATGTGGAGATTATTCTC
CCCATCATGTTTGCGCCCCTGTACGAAAACTCCAAGGGCCACTGGAATAGGACAATCCACGGCATGGTATACAAC
GCCATGAAGCTCTTCATGGAGATCAACCCCCAGCTCTTCGACGACTGCTCGCACGAGTACACGGAGCAGCAGAAC
AGCGCCGCCGAGCGGGAGGCGCTGCGAGAACGCAAGTGGGCAGCCCTGGGCGAGAGGGCGAACCAACGGAGAGCG
GCGGCAAGCGGTGGCACTGCAACCGAGGCGCCCGCGCGCCCGCAGGGCGGCTCCCTCCCGCGGGTCGAAGAGGTC
GATCCCGTTAGCGAGGACAACCAGAAGCGGCTGGATTCCCTCAAGCTCCAGGACGCTGCTGGCCGGCGACCCAGC
GGCCACGAGCGACAGAGCTCGGCCGGCTCCGCCAGGAGTCGATGA
Transcript >Hirsu2|7348
ATGAAACGATTTAGCCAAAGAGTCCTCTCTCGAGGCAAGGACCCCAACAAGTCTTCTAAGAAGAACAAGGAGTCC
AAGGACGGCACCTCGTCGCCCTCGTCTCGTGATTCCTCCAACCAGTCCCCTGTCCTGACGCCCTCCTCCTCGACG
TCGACGCTCAACGACATTCGGAATAAGCCCCTCCCCCCCAACAACGCCGCCCATGCCGGCGATCACAACGCCCCC
GGCCAGCCCTCGAATCTCTCCAACGTCACCCAGCAGGCTCATGTTCCCGAGCGTCTAGGCTCCGTCGGCGGCACT
TCGAGCCCCAATGGCGGTGCCGCCAACGCTAGACTGCCTCCGACGGTCGTCATCAGCCCAACGCCAGGTCACGTT
CCTCCCCCCGGTGCTGCCGAGACGATGCCTCACGACCTGGCCCCGCCCAAGGCCGGCCAGAAATCGCTCCTGATC
CACAGGGGCATCGACAACCGCGACGCCATACCCGAGGGACTGCGGACGCCCAAGAGGCAGCACTCGTCTCGTTTC
GACATCTCGGCCCACCGGGAGCTCGAGAAGCTCCCCGGCTTCCACGAGGTGCCGCCTAACAGGCGACAGGAGCTG
TTCATGCAGAAGATTGACCAGTGCAACGTCATCTTCGACTTCAACGACGCGAGCGGCGATATGAAGGCGAAGGAG
ATCAAGCGGCTTGCCCTCCACGAGCTGCTCGACTACGTCGCCAACAACCGGCAGGTCATCACCGAGCCCATGTAT
CCCCGCGTTGTCGACATGTTCGCCAAGAACCTGTTTCGGCCCATACCCCCCCCCGTCAACCCCCAAGGCGAGGCC
TTCGATCCGGAGGAGGACGAGCCGGTGCTCGAGGTCGCCTGGCCGCACATCCAGGTCGTCTACGAGTTCTTCCTG
CGCTTCATCGAGAGCCAGGACTTCAACACCAACATCGCCAAGGCCTACATCGACCATAGCTTTGTCTTGCAGCTG
CTCGACCTCTTCGACTCGGAAGACCCCCGCGAGCGCGACTTCCTGAAGACGACACTCCATCGCATCTACGGCAAA
TTCCTCAACCTGCGATCCTTCATTCGGCGGTCCATCAACAACGTCTTCTTCCAATTCACGTACGAGACGGAGAGG
TTCAACGGCATCGCCGAGCTGCTCGAGATCCTCGGCTCCATCATCAACGGCTTCGCACTGCCGCTGAAAGAGGAG
CACAAGATCTTCCTGACGCGCGTGCTGCTGCCCCTCCACAAGCCCAAGAGCCTGAGCATGTATCATCCCCAGCTG
GCCTACTGCATCGTGCAGTTCCTGGAGAAGGACGCCTCTCTGACGGAAGAGGTTGTTCTGGGGCTGCTGCGTTAT
TGGCCCAAGGTCAACAGTACCAAGGAAGTCATGTTCCTGAACGAAGTCGAGGACATCTTCGAGGTCATGGACCCC
GCCGAGTTTGCCAAGGTCCAGGAGCCTCTGTTCCAGCAGCTGGCCAAGTCGGTCGCCAGCCCGCACTTCCAGGTC
GCCGAGCGCGCCCTGTACTTCTGGAACAACGAATACTTCTGCAACCTCGTGAGCGACAATGTGGAGATTATTCTC
CCCATCATGTTTGCGCCCCTGTACGAAAACTCCAAGGGCCACTGGAATAGGACAATCCACGGCATGGTATACAAC
GCCATGAAGCTCTTCATGGAGATCAACCCCCAGCTCTTCGACGACTGCTCGCACGAGTACACGGAGCAGCAGAAC
AGCGCCGCCGAGCGGGAGGCGCTGCGAGAACGCAAGTGGGCAGCCCTGGGCGAGAGGGCGAACCAACGGAGAGCG
GCGGCAAGCGGTGGCACTGCAACCGAGGCGCCCGCGCGCCCGCAGGGCGGCTCCCTCCCGCGGGTCGAAGAGGTC
GATCCCGTTAGCGAGGACAACCAGAAGCGGCTGGATTCCCTCAAGCTCCAGGACGCTGCTGGCCGGCGACCCAGC
GGCCACGAGCGACAGAGCTCGGCCGGCTCCGCCAGGAGTCGATGA
Gene >Hirsu2|7348
ATGAAACGATTTAGCCAAAGAGTCGTACGTAGCCAGCCGAACTCTCCCCCTCTTCCCCCAATGCTGCCCTTCGTG
TCGAGTCGCATCACTGACGCGGGCCCCGTCGCCCTGCCCTCTCTCCTCAACAGCTCTCTCGAGGCAAGGACCCCA
ACAAGTCTTCTAAGAAGAACAAGGAGTCCAAGGACGGCACCTCGTCGCCCTCGTCTCGTGATTCCTCCAACCAGT
CCCCTGTCCTGACGCCCTCCTCCTCGACGTCGACGCTCAACGACATTCGGAATAAGCCCCTCCCCCCCAACAACG
CCGCCCATGCCGGCGATCACAACGCCCCCGGCCAGCCCTCGAATCTCTCCAACGTCACCCAGCAGGCTCATGTTC
CCGAGCGTCTAGGCTCCGTCGGCGGCACTTCGAGCCCCAATGGCGGTGCCGCCAACGCTAGACTGCCTCCGACGG
TCGTCATCAGCCCAACGCCAGGTGTAGGTTGCGCCACCCCCGCATTGCAGCTGGCAGAGGCAGTCGCACGCGTCC
ACCCGCCTCATACTGATTTTGCCTGTCGCGACATAGCACGTTCCTCCCCCCGGTGCTGCCGAGACGATGCCTCAC
GACCTGGCCCCGCCCAAGGCCGGCCAGAAATCGCTCCTGATCCACAGGGGCATCGACAACCGCGACGCCATACCC
GAGGGACTGCGGACGCCCAAGAGGCAGCACTCGTCTCGTTTCGACATCTCGGCCCACCGGGAGCTCGAGAAGCTC
CCCGGCTTCCACGAGGTGCCGCCTAACAGGCGACAGGAGCTGTTCATGCAGAAGATTGACCAGTGCAACGTCATC
TTCGACTTCAACGACGCGAGCGGCGATATGAAGGCGAAGGAGATCAAGCGGCTTGCCCTCCACGAGCTGCTCGAC
TACGTCGCCAACAACCGGCAGGTCATCACCGAGCCCATGTATCCCCGCGTTGTCGACATGTTCGCCAAGAACCTG
TTTCGGCCCATACCCCCCCCCGTCAACCCCCAAGGCGAGGCCTTCGATCCGGAGGAGGACGAGCCGGTGCTCGAG
GTCGCCTGGCCGCACATCCAGGTCGTCTACGAGTTCTTCCTGCGCTTCATCGAGAGCCAGGACTTCAACACCAAC
ATCGCCAAGGCCTACATCGACCATAGCTTTGTCTTGCAGCTGCTCGACCTCTTCGACTCGGAAGACCCCCGCGAG
CGCGACTTCCTGAAGACGACACTCCATCGCATCTACGGCAAATTCCTCAACCTGCGATCCTTCATTCGGCGGTCC
ATCAACAACGTCTTCTTCCAATTCACGTACGAGACGGAGAGGTTCAACGGCATCGCCGAGCTGCTCGAGATCCTC
GGCTCCATCATCAACGGCTTCGCACTGCCGCTGAAAGAGGAGCACAAGATCTTCCTGACGCGCGTGCTGCTGCCC
CTCCACAAGCCCAAGAGCCTGAGCATGTATCATCCCCAGCTGGCCTACTGCATCGTGCAGTTCCTGGAGAAGGAC
GCCTCTCTGACGGAAGAGGTATGCCCACGCACACACGGCGCCGTCTTGGCCGCGGCTGGCCCTATGCTGACGTGA
AGCAGGTTGTTCTGGGGCTGCTGCGTTATTGGCCCAAGGTCAACAGTACCAAGGAAGTCATGTTCCTGAACGAAG
TCGAGGACATCTTCGAGGTCATGGACCCCGCCGAGTTTGCCAAGGTCCAGGAGCCTCTGTTCCAGCAGCTGGCCA
AGTCGGTCGCCAGCCCGCACTTCCAGGTCGCCGAGCGCGCCCTGTACTTCTGGAACAACGAATACTTCTGCAACC
TCGTGAGCGACAATGTGGAGATTATTCTCCCCATCATGTTTGCGCCCCTGTACGAAAACTCCAAGGGCCACTGGA
ATAGGTAAAAGGCTGCGGCCCCACCCCCGTTGCCGCGTGTCGAGAAGGAGACTGACAAAGGACAAAGGACAATCC
ACGGCATGGTATACAACGCCATGAAGCTCTTCATGGAGATCAACCCCCAGCTCTTCGACGACTGCTCGCACGAGT
ACACGGAGCAGCAGAACAGCGCCGCCGAGCGGGAGGCGCTGCGAGAACGCAAGTGGGCAGCCCTGGGCGAGAGGG
CGAACCAACGGAGAGCGGCGGCAAGCGGTGGCACTGCAACCGAGGCGCCCGCGCGCCCGCAGGGCGGCTCCCTCC
CGCGGGTCGAAGAGGTCGATCCCGTTAGCGAGGACAACCAGAAGCGGCTGGATTCCCTCAAGCTCCAGGACGCTG
CTGGCCGGCGACCCAGCGGCCACGAGCGACAGAGCTCGGCCGGCTCCGCCAGGAGTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail