Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7335
Gene name
LocationContig_42:51389..53642
Strand+
Gene length (bp)2253
Transcript length (bp)1611
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.2E-22 69 480
PF00083 Sugar_tr Sugar (and other) transporter 6.4E-10 96 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 15 529 1.0E-58
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 35 521 1.0E-49
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 44 522 3.0E-11
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 6 522 9.0E-11
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 43 521 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 15 529 1.0E-58
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 35 521 1.0E-49
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 44 522 3.0E-11
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 6 522 9.0E-11
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 43 521 1.0E-10
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 346 505 2.0E-10
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 43 530 7.0E-10
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 44 481 2.0E-09
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 42 457 2.0E-09
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 42 522 2.0E-09
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 43 521 3.0E-09
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 32 522 4.0E-09
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 2 531 2.0E-08
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 43 480 3.0E-07
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 84 262 3.0E-07
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 42 216 7.0E-07
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 27 533 5.0E-06
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 32 211 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 96 118 22
3 125 147 22
4 186 208 22
5 215 234 19
6 316 338 22
7 358 380 22
8 400 422 22
9 429 451 22
10 495 517 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7335
MDHNDRISPAEDVFRQPPGTVELLAHGHGAGDGQVTLIPTPSDDPNDPLRWPAWRKCLNYGLLVAMTTAIFTGLS
IQTLFWTQMLEDMDKVTQQDLANAQAVQLVGLAIGCVFFIPFAKKYGRRTVYILTIAIAAVSSWWSASMNTVTEL
FLSNMLLGVAGATNQTAIAMSINDIFFVHQRGTANAMFFGAIMFGSFLTPMAAGVQGIADGWRTSYASLATAMTV
LTVVFIGIFEETKFVPAVVRRPAKSVDDGDSIYKTDSLDAAAKASISVVELERGGAAPPKKGKFPRDMRLQLVTK
TDESLWKLTYYPIYSWWFPHVLFTSIQLGSGICWLVVTLTMTSIVFSAPPYNFDAAGLGYMNAGPCVGSVFGALY
GGYFVDKAIVWFSKRNGGWFEPEMRLWLYPLPAVAMSAGLIIFGVSADRGAHFVIPSIGGALFAFAFGSVSDIAT
ALVLDSFPDIVPQTFVAITFLRNAISMAGPFSVTPWLDHMSVTGMFILAGCISLGVNLLALPLVIWGKRARAAVA
PRYYRLSSQGL*
Coding >Hirsu2|7335
ATGGATCATAATGACAGGATCTCACCCGCGGAGGACGTCTTCCGCCAGCCTCCGGGCACGGTGGAGTTGCTCGCC
CATGGACATGGAGCGGGCGATGGCCAGGTCACGCTGATTCCGACCCCTTCTGACGACCCCAATGATCCCCTGAGG
TGGCCGGCATGGCGCAAGTGCCTGAACTACGGGCTGCTCGTCGCAATGACGACGGCCATCTTCACCGGGCTGTCG
ATCCAGACGCTCTTCTGGACCCAGATGCTCGAGGACATGGACAAGGTGACGCAGCAAGACCTGGCGAACGCGCAG
GCGGTACAGCTGGTCGGCCTCGCCATCGGCTGCGTCTTCTTCATCCCCTTCGCCAAGAAGTACGGCCGGCGGACG
GTGTACATCTTGACCATCGCCATCGCGGCCGTGTCATCCTGGTGGTCGGCCAGCATGAACACCGTGACGGAGCTG
TTCCTTTCCAACATGCTGCTGGGCGTCGCGGGCGCAACGAACCAGACGGCCATTGCCATGAGTATCAATGACATC
TTCTTCGTCCACCAAAGAGGCACGGCCAACGCCATGTTCTTCGGCGCCATCATGTTCGGCTCCTTCCTGACGCCC
ATGGCTGCCGGCGTGCAGGGCATCGCGGACGGATGGCGGACTTCGTACGCGTCGCTGGCGACGGCCATGACGGTC
CTGACCGTCGTCTTCATCGGCATCTTCGAGGAGACCAAGTTCGTGCCGGCGGTGGTGCGGCGGCCGGCCAAGAGC
GTCGACGATGGCGACAGCATCTACAAGACGGACTCGCTCGACGCCGCGGCCAAGGCGAGCATCTCGGTCGTCGAG
CTCGAGCGCGGAGGCGCGGCGCCGCCCAAGAAGGGCAAGTTCCCGCGCGACATGCGGCTGCAGCTGGTGACCAAG
ACGGACGAGTCGCTGTGGAAGCTCACCTACTACCCCATCTACTCCTGGTGGTTCCCGCACGTCCTCTTCACCTCG
ATCCAGCTCGGCTCCGGCATCTGCTGGCTGGTTGTCACCCTCACCATGACCTCCATCGTCTTCTCCGCGCCCCCC
TACAACTTCGACGCCGCCGGGCTCGGCTACATGAACGCCGGCCCCTGCGTCGGCTCCGTCTTCGGCGCCCTCTAC
GGCGGCTACTTCGTCGACAAGGCCATCGTCTGGTTCTCCAAGCGCAACGGCGGCTGGTTCGAGCCCGAGATGCGC
CTCTGGCTGTACCCGCTGCCGGCCGTGGCCATGTCGGCCGGCCTGATCATCTTTGGCGTGTCCGCCGATCGGGGT
GCGCACTTTGTCATCCCCAGCATAGGGGGTGCCTTATTCGCCTTTGCCTTTGGCTCCGTCTCCGACATTGCCACC
GCCTTGGTGCTTGACTCGTTCCCCGACATCGTCCCGCAAACCTTCGTCGCAATAACCTTCCTTCGAAATGCCATC
AGCATGGCCGGCCCCTTCTCCGTCACCCCCTGGCTCGACCATATGAGCGTGACCGGCATGTTCATCTTGGCAGGC
TGCATCAGCCTCGGCGTCAATCTCCTCGCTCTACCTCTTGTCATCTGGGGCAAGAGGGCCAGGGCGGCTGTCGCG
CCCCGCTACTACCGCCTGTCATCCCAGGGCTTGTAG
Transcript >Hirsu2|7335
ATGGATCATAATGACAGGATCTCACCCGCGGAGGACGTCTTCCGCCAGCCTCCGGGCACGGTGGAGTTGCTCGCC
CATGGACATGGAGCGGGCGATGGCCAGGTCACGCTGATTCCGACCCCTTCTGACGACCCCAATGATCCCCTGAGG
TGGCCGGCATGGCGCAAGTGCCTGAACTACGGGCTGCTCGTCGCAATGACGACGGCCATCTTCACCGGGCTGTCG
ATCCAGACGCTCTTCTGGACCCAGATGCTCGAGGACATGGACAAGGTGACGCAGCAAGACCTGGCGAACGCGCAG
GCGGTACAGCTGGTCGGCCTCGCCATCGGCTGCGTCTTCTTCATCCCCTTCGCCAAGAAGTACGGCCGGCGGACG
GTGTACATCTTGACCATCGCCATCGCGGCCGTGTCATCCTGGTGGTCGGCCAGCATGAACACCGTGACGGAGCTG
TTCCTTTCCAACATGCTGCTGGGCGTCGCGGGCGCAACGAACCAGACGGCCATTGCCATGAGTATCAATGACATC
TTCTTCGTCCACCAAAGAGGCACGGCCAACGCCATGTTCTTCGGCGCCATCATGTTCGGCTCCTTCCTGACGCCC
ATGGCTGCCGGCGTGCAGGGCATCGCGGACGGATGGCGGACTTCGTACGCGTCGCTGGCGACGGCCATGACGGTC
CTGACCGTCGTCTTCATCGGCATCTTCGAGGAGACCAAGTTCGTGCCGGCGGTGGTGCGGCGGCCGGCCAAGAGC
GTCGACGATGGCGACAGCATCTACAAGACGGACTCGCTCGACGCCGCGGCCAAGGCGAGCATCTCGGTCGTCGAG
CTCGAGCGCGGAGGCGCGGCGCCGCCCAAGAAGGGCAAGTTCCCGCGCGACATGCGGCTGCAGCTGGTGACCAAG
ACGGACGAGTCGCTGTGGAAGCTCACCTACTACCCCATCTACTCCTGGTGGTTCCCGCACGTCCTCTTCACCTCG
ATCCAGCTCGGCTCCGGCATCTGCTGGCTGGTTGTCACCCTCACCATGACCTCCATCGTCTTCTCCGCGCCCCCC
TACAACTTCGACGCCGCCGGGCTCGGCTACATGAACGCCGGCCCCTGCGTCGGCTCCGTCTTCGGCGCCCTCTAC
GGCGGCTACTTCGTCGACAAGGCCATCGTCTGGTTCTCCAAGCGCAACGGCGGCTGGTTCGAGCCCGAGATGCGC
CTCTGGCTGTACCCGCTGCCGGCCGTGGCCATGTCGGCCGGCCTGATCATCTTTGGCGTGTCCGCCGATCGGGGT
GCGCACTTTGTCATCCCCAGCATAGGGGGTGCCTTATTCGCCTTTGCCTTTGGCTCCGTCTCCGACATTGCCACC
GCCTTGGTGCTTGACTCGTTCCCCGACATCGTCCCGCAAACCTTCGTCGCAATAACCTTCCTTCGAAATGCCATC
AGCATGGCCGGCCCCTTCTCCGTCACCCCCTGGCTCGACCATATGAGCGTGACCGGCATGTTCATCTTGGCAGGC
TGCATCAGCCTCGGCGTCAATCTCCTCGCTCTACCTCTTGTCATCTGGGGCAAGAGGGCCAGGGCGGCTGTCGCG
CCCCGCTACTACCGCCTGTCATCCCAGGGCTTGTAG
Gene >Hirsu2|7335
ATGGATCATAATGACAGGATCTCACCCGCGGAGGACGTCTTCCGCCAGCCTCCGGGCACGGTGGAGTTGCTCGGT
AGGCCCCGACCGCGCTCCTCCCGTTTCCTCGCGACCCCGGAGACGATGACAAGCGAGGAGTCGGTTTTTGCTGAC
GGCGGTGGCGCATAGCCCATGGACATGGAGCGGGCGATGGCCAGGTCACGCTGATTCCGACCCCTTCTGACGACC
CCAATGATCCCCTGGTTAGTCCCCCACGCCGACTCCCAAGCCGTGGTCTCGAACAAGATGGGAGAAGAACAGGCG
GCCAGGAGACGTGCGTGCTGACCAAGTTGGCGCAGAGGTGGCCGGCATGGCGCAAGTGCCTGAACTACGGGCTGC
TCGTCGCAATGACGACGGCCATCTTCACCGGGTAAGCCACGAGAAGCACCCGTCCTCAGGGGAAAAGGGGGGGGG
AGGCAAAGGTGGCAGCAGGGAGAGAAAAGAGGCTGATTGGCGAGCCCCCTTGCACAGGCTGTCGATCCAGACGCT
CTTCTGGACCCAGATGCTCGAGGACATGGACAAGGTGACGCAGCAAGACCTGGCGAACGCGCAGGCGGTACAGCT
GGTCGGCCTCGCCATCGGCTGCGTCTTCTTCATCCCCTTCGCCAAGAAGTACGGCCGGCGGACGGTGTACATCTT
GACCATCGCCATCGCGGCCGTGTCATCCTGGTGGTCGGCCAGCATGAACACCGTGACGGAGCTGTTCCTTTCCAA
CATGCTGCTGGGCGTCGCGGGCGCAACGAACCAGACGGCCATTGCCATGAGTGTATGTTTCCTTCCTTGTTTCTT
TTCCTCCTCTCTTTTCTTCCCGTCTGCTTTTGCAGTTCTGACTCTCCGGGGGGGGGGCATATCAGATCAATGACA
TCTTCTTCGTCCACCAAAGAGGCACGGCCAACGCCATGTTCTTCGGCGCCATCATGTTCGGCTCCTTCCTGACGC
CCATGGCTGCCGGCGTGCAGGGCATCGCGGACGGATGGCGGACTTCGTACGCGTCGCTGGCGACGGCCATGACGG
TCCTGACCGTCGTCTTCATCGGCATCTTCGAGGAGACCAAGTTCGTGCCGGCGGTGGTGCGGCGGCCGGCCAAGA
GCGTCGACGATGGCGACAGCATCTACAAGACGGACTCGCTCGACGCCGCGGCCAAGGCGAGCATCTCGGTCGTCG
AGCTCGAGCGCGGAGGCGCGGCGCCGCCCAAGAAGGGCAAGTTCCCGCGCGACATGCGGCTGCAGCTGGTGACCA
AGACGGACGAGTCGCTGTGGAAGCTCACCTACTACCCCATCTACTCCTGGTGGTTCCCGCACGTCCTCTTCACCT
CGATCCAGCTCGGCTCCGGCATCTGCTGGCTGGTTGTCACCCTCACCATGACCTCCATCGTCTTCTCCGCGCCCC
CCTACAACTTCGACGCCGCCGGGCTCGGCTACATGAACGCCGGCCCCTGCGTCGGCTCCGTCTTCGGCGCCCTCT
ACGGCGGCTACTTCGTCGACAAGGCCATCGTCTGGTTCTCCAAGCGCAACGGCGGCTGGTTCGAGCCCGAGATGC
GCCTCTGGCTGTACCCGCTGCCGGCCGTGGCCATGTCGGCCGGCCTGATCATCTTTGGCGTGTCCGCCGATCGGG
TATGTCGCCTAGCTTCCCCATTCAGCAATTACCGACGCCCTCTCTTGTCGCCTGACATGCCCGAGCTCGAGTCGT
GTGTGGAAAAAAGGCCAAGACCAAGACTGACTGGTGCATGATTGCTGCTTGCTAGGGTGCGCACTTTGTCATCCC
CAGCATAGGGGGTGCCTTATTCGCCTTTGCCTTTGGCTCCGTCTCCGACATTGCCACCGCCTTGGTGCTTGACTC
GTTCCCCGACGTACGTGGCCCAGGGCCTCGCTCTCGAGCCTCTCCTCTCCCCCCTTTCCGCCCCCTCCTCTCAGA
CGTGTCTTGCCGAGTTGTCTCGTTTTCAATTCCCGGTGGAAAAAAGACTAACTCGAACGTTCGCGGCAGATCGTC
CCGCAAACCTTCGTCGCAATAACCTTCCTTCGAAATGCCATCAGCATGGCCGGCCCCTTCTCCGTCACCCCCTGG
CTCGACCATATGAGCGTGACCGGCATGTTCATCTTGGCAGGCTGCATCAGCCTCGGCGTCAATCTCCTCGCTCTA
CCTCTTGTCATCTGGGGCAAGAGGGCCAGGGCGGCTGTCGCGCCCCGCTACTACCGCCTGTCATCCCAGGGCTTG
TAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail