Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7334
Gene name
LocationContig_42:43655..44578
Strand+
Gene length (bp)923
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00487 FA_desaturase Fatty acid desaturase 1.7E-17 76 193

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P59668|FAD12_MORIS Delta(12) fatty acid desaturase OS=Mortierella isabellina PE=2 SV=1 26 256 5.0E-37
sp|Q9Y8H5|FAD12_MORAP Delta(12) fatty acid desaturase OS=Mortierella alpina PE=1 SV=2 3 256 6.0E-37
sp|Q6RS95|FAD21_DIMSI Acyl-lipid (9+3)-(E)-desaturase OS=Dimorphotheca sinuata PE=1 SV=1 6 255 1.0E-35
sp|P48630|FD6E1_SOYBN Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 1 OS=Glycine max GN=FAD2-1 PE=2 SV=1 15 255 7.0E-35
sp|P46313|FAD6E_ARATH Delta(12)-fatty-acid desaturase OS=Arabidopsis thaliana GN=FAD2 PE=1 SV=1 2 254 9.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P59668|FAD12_MORIS Delta(12) fatty acid desaturase OS=Mortierella isabellina PE=2 SV=1 26 256 5.0E-37
sp|Q9Y8H5|FAD12_MORAP Delta(12) fatty acid desaturase OS=Mortierella alpina PE=1 SV=2 3 256 6.0E-37
sp|Q6RS95|FAD21_DIMSI Acyl-lipid (9+3)-(E)-desaturase OS=Dimorphotheca sinuata PE=1 SV=1 6 255 1.0E-35
sp|P48630|FD6E1_SOYBN Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 1 OS=Glycine max GN=FAD2-1 PE=2 SV=1 15 255 7.0E-35
sp|P46313|FAD6E_ARATH Delta(12)-fatty-acid desaturase OS=Arabidopsis thaliana GN=FAD2 PE=1 SV=1 2 254 9.0E-35
sp|P48631|FD6E2_SOYBN Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 2 OS=Glycine max GN=FAD2-2 PE=2 SV=1 26 251 1.0E-34
sp|A3F5L3|DES2_SORBI Fatty acid desaturase DES2 OS=Sorghum bicolor GN=DES2 PE=2 SV=1 29 256 3.0E-34
sp|Q84VT2|FAD12_PUNGR Delta(12)-acyl-lipid-desaturase OS=Punica granatum GN=FAD12 PE=2 SV=2 26 254 6.0E-34
sp|Q8GZC3|FAD2_VERFO Delta(12)-fatty-acid desaturase FAD2 OS=Vernicia fordii GN=FAD2 PE=1 SV=1 7 254 4.0E-33
sp|Q6RS96|FAD22_DIMSI Delta(9) fatty acid conjugase-like enzyme OS=Dimorphotheca sinuata PE=2 SV=1 1 253 9.0E-33
sp|Q39287|FAD6E_BRAJU Omega-6 fatty acid desaturase, endoplasmic reticulum OS=Brassica juncea PE=2 SV=1 29 254 9.0E-33
sp|D2CPE1|FH12M_RICCO Phosphatidylcholine 12-monooxygenase OS=Ricinus communis GN=FAH12 PE=2 SV=1 26 253 6.0E-32
sp|Q41131|FH12_RICCO Phosphatidylcholine 12-monooxygenase OS=Ricinus communis GN=FAH12 PE=1 SV=1 26 253 8.0E-32
sp|O81931|FAD12_CREAL Delta(12) fatty acid dehydrogenase OS=Crepis alpina PE=1 SV=2 26 249 1.0E-31
sp|Q84UB8|FADX_PUNGR Bifunctional fatty acid conjugase/Delta(12)-oleate desaturase OS=Punica granatum GN=FADX PE=1 SV=1 6 255 2.0E-31
sp|Q8GZC2|FADX_VERFO Bifunctional desaturase/conjugase FADX OS=Vernicia fordii PE=1 SV=1 26 251 3.0E-31
sp|Q84UC0|FADX_TRIKI Bifunctional fatty acid conjugase/Delta(12)-oleate desaturase OS=Trichosanthes kirilowii GN=FAC PE=2 SV=1 26 251 6.0E-31
sp|Q84UB9|FAD12_TRIKI Delta(12)-oleate desaturase OS=Trichosanthes kirilowii GN=FAD2 PE=2 SV=1 26 251 4.0E-29
sp|Q9SP62|FADX_IMPBA Delta(12) acyl-lipid conjugase (11E,13E-forming) OS=Impatiens balsamina GN=FADX PE=1 SV=1 26 253 1.0E-28
sp|Q9SP61|FADX_MOMCH Delta(12) acyl-lipid conjugase (11E,13E-forming) OS=Momordica charantia GN=FADX PE=1 SV=1 26 243 1.0E-27
sp|P48626|FAD3E_TOBAC Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Nicotiana tabacum GN=FAD3 PE=2 SV=1 26 249 5.0E-25
sp|P32291|FAD3E_VIGRR Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Vigna radiata var. radiata GN=ARG1 PE=2 SV=1 26 238 1.0E-23
sp|P48619|FAD3C_RICCO Omega-3 fatty acid desaturase, chloroplastic OS=Ricinus communis GN=FAD7A-1 PE=2 SV=1 26 249 7.0E-22
sp|P48618|FAD3C_BRANA Omega-3 fatty acid desaturase, chloroplastic (Fragment) OS=Brassica napus GN=FAD7 PE=2 SV=1 2 256 1.0E-21
sp|P48622|FAD3D_ARATH Temperature-sensitive omega-3 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD8 PE=2 SV=1 4 249 2.0E-21
sp|P48620|FAD3C_SESIN Omega-3 fatty acid desaturase, chloroplastic OS=Sesamum indicum GN=FAD7 PE=2 SV=1 26 249 3.0E-21
sp|Q9NEQ0|FAT1_CAEEL Omega-3 fatty acid desaturase fat-1 OS=Caenorhabditis elegans GN=fat-1 PE=2 SV=1 12 147 9.0E-21
sp|P48624|FAD3E_BRANA Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Brassica napus GN=FAD3 PE=2 SV=1 15 249 9.0E-21
sp|P48625|FAD3E_SOYBN Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Glycine max GN=FAD3 PE=2 SV=1 26 238 1.0E-20
sp|P46310|FAD3C_ARATH Omega-3 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD7 PE=2 SV=1 25 249 2.0E-20
sp|P48623|FAD3E_ARATH Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Arabidopsis thaliana GN=FAD3 PE=2 SV=1 12 249 6.0E-19
sp|A3F5L2|DES1_SORBI Probable fatty acid desaturase DES1 OS=Sorghum bicolor GN=DES1 PE=2 SV=1 29 249 2.0E-18
sp|G5EGA5|FAT2_CAEEL Delta(12) fatty acid desaturase fat-2 OS=Caenorhabditis elegans GN=fat-2 PE=2 SV=1 24 147 1.0E-16
sp|Q594P3|DES3_SORBI Fatty acid desaturase DES3 OS=Sorghum bicolor GN=DES3 PE=1 SV=1 29 249 3.0E-16
sp|P48621|FAD3C_SOYBN Omega-3 fatty acid desaturase, chloroplastic OS=Glycine max GN=FAD7 PE=2 SV=1 25 249 1.0E-15
sp|Q54794|DESA_ARTPT Delta(12)-fatty-acid desaturase OS=Arthrospira platensis GN=desA PE=1 SV=1 76 154 1.0E-08
sp|P20388|DESA_SYNY3 Delta(12)-fatty-acid desaturase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=desA PE=1 SV=1 14 171 2.0E-07
sp|P48629|FAD6C_SPIOL Omega-6 fatty acid desaturase, chloroplastic OS=Spinacia oleracea GN=FAD6 PE=1 SV=1 54 152 1.0E-06
sp|P48628|FAD6C_SOYBN Omega-6 fatty acid desaturase, chloroplastic OS=Glycine max PE=2 SV=1 17 152 3.0E-06
sp|P46312|FAD6C_ARATH Omega-6 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD6 PE=1 SV=2 58 152 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 76 98 22
3 111 130 19
4 185 207 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7334
MASSPQEPALFRPPPNGQPRVAAPDLQALRRAIPQHCFRPSIAVSLRHIALDLSFALLLLAVTLYLPGAEPSPLR
WALLLAFSFLQGLVFMGLWVLGHECGHGALFPSRRLNDFFGFTLHSILLVPYFSFKYSHARHHRYTNHIDKDTVF
VPSRGSVDALHWQIVRLHRALGFAHDSPFVSLLQLLSQQLFAVPMYFLFYLSGGAGSGTEKPKFLFKSHFNPKSG
LFSPSEQPYILLSDAGVLLLLAALWKASSVLPSRI*
Coding >Hirsu2|7334
ATGGCATCGTCACCGCAAGAGCCTGCCTTGTTTCGTCCGCCGCCGAACGGACAGCCTCGCGTGGCCGCCCCCGAC
CTGCAGGCGCTTCGCCGGGCCATTCCACAGCACTGCTTCCGCCCAAGTATAGCCGTGTCTCTGCGGCACATCGCC
CTTGACCTCTCCTTTGCTCTACTCCTGCTCGCCGTGACGCTCTACCTGCCCGGCGCCGAGCCGTCACCCCTCCGC
TGGGCCTTGCTGTTAGCCTTTAGCTTTCTCCAGGGCCTAGTATTTATGGGCCTTTGGGTTCTGGGCCACGAATGT
GGCCACGGAGCCCTGTTCCCCTCGCGCAGACTCAACGACTTCTTCGGCTTCACCTTGCATAGTATCCTCCTCGTT
CCCTACTTCTCCTTTAAGTATAGTCACGCACGCCACCACCGCTACACAAACCACATTGACAAGGACACCGTCTTT
GTGCCCAGCCGGGGAAGCGTCGATGCGCTGCACTGGCAAATCGTGAGGCTTCACAGGGCCTTGGGCTTCGCCCAC
GACAGTCCCTTCGTCAGTCTCCTTCAGCTCCTGAGCCAGCAACTGTTCGCTGTGCCCATGTATTTCCTCTTCTAC
TTGAGTGGCGGCGCCGGCAGCGGCACTGAGAAGCCCAAGTTCCTGTTCAAAAGCCACTTCAACCCCAAAAGTGGC
CTGTTCTCACCGTCTGAGCAACCATACATCCTGCTGTCAGATGCCGGCGTCTTGCTCCTGCTCGCGGCGCTTTGG
AAAGCCTCGTCGGTTCTGCCATCTCGTATATGA
Transcript >Hirsu2|7334
ATGGCATCGTCACCGCAAGAGCCTGCCTTGTTTCGTCCGCCGCCGAACGGACAGCCTCGCGTGGCCGCCCCCGAC
CTGCAGGCGCTTCGCCGGGCCATTCCACAGCACTGCTTCCGCCCAAGTATAGCCGTGTCTCTGCGGCACATCGCC
CTTGACCTCTCCTTTGCTCTACTCCTGCTCGCCGTGACGCTCTACCTGCCCGGCGCCGAGCCGTCACCCCTCCGC
TGGGCCTTGCTGTTAGCCTTTAGCTTTCTCCAGGGCCTAGTATTTATGGGCCTTTGGGTTCTGGGCCACGAATGT
GGCCACGGAGCCCTGTTCCCCTCGCGCAGACTCAACGACTTCTTCGGCTTCACCTTGCATAGTATCCTCCTCGTT
CCCTACTTCTCCTTTAAGTATAGTCACGCACGCCACCACCGCTACACAAACCACATTGACAAGGACACCGTCTTT
GTGCCCAGCCGGGGAAGCGTCGATGCGCTGCACTGGCAAATCGTGAGGCTTCACAGGGCCTTGGGCTTCGCCCAC
GACAGTCCCTTCGTCAGTCTCCTTCAGCTCCTGAGCCAGCAACTGTTCGCTGTGCCCATGTATTTCCTCTTCTAC
TTGAGTGGCGGCGCCGGCAGCGGCACTGAGAAGCCCAAGTTCCTGTTCAAAAGCCACTTCAACCCCAAAAGTGGC
CTGTTCTCACCGTCTGAGCAACCATACATCCTGCTGTCAGATGCCGGCGTCTTGCTCCTGCTCGCGGCGCTTTGG
AAAGCCTCGTCGGTTCTGCCATCTCGTATATGA
Gene >Hirsu2|7334
ATGGCATCGTCACCGCAAGAGCCTGCCTTGTTTCGTCCGCCGCCGAACGGACAGCCTCGCGTGGCCGCCCCCGAC
CTGCAGGCGCTTCGCCGGGCCATTCCACAGCACTGCTTCCGCCCAAGTATAGCCGTGTCTCTGCGGCACATCGCC
CTTGACCTCTCCTTTGCTCTACTCCTGCTCGCCGTGACGCTCTACCTGCCCGGCGCCGAGCCGTCACCCCTCCGC
TGGGCCTTGCTGTTAGCCTTTAGCTTTCTCCAGGGCCTAGTATTTATGGGCCTTTGGGTTCTGGGCCACGAATGT
GGCCACGGAGCCCTGTTCCCCTCGCGCAGACTCAACGACTTCTTCGGCTTCACCTTGCATAGTATCCTCCTCGTT
CCCTACTTCTCCTTTAAGTATAGTCACGCACGCCACCACCGCTACACAAACCACATTGACAAGGACACCGTCTTT
GTGCCCAGCCGGGGAAGCGTCGATGCGCTGCACTGGCAAATCGTGAGGCTTCACAGGGCCTTGGGCTTCGCCCAC
GACAGTCCCTTCGTCAGTCTCCTTCAGCTCCTGAGCCAGCAACTGTTCGCTGTGCCCATGTATTTCCTCTTCTAC
TTGAGTGGCGGCGCCGGCAGCGGCACTGAGAAGCCCAAGTTCCTGTTCAAAAGCCACTTCAACCCCAAAAGTGGC
CTGTTCTCACCGTCTGAGCAACCATACATCCTGCTGTCAGATGCCGGCGTCTTGCTCCTGCTCGCGGCGCTTTGG
AAAGCCTCGTCGGTTGTAGGCTTCTCCACTATTGTTTGGGCTTACGGCCTTCCCTATTTCTGGATGAACCATTGG
CTTGGTACGTTCAATGTTCTATCCGGTCTCAACATCGTTGTCGTCATATTCATTTTCGTTGACGATTCTTTGTTC
CGCAGCTGCCATCTCGTATATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail