Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7333
Gene name
LocationContig_42:38352..39794
Strand+
Gene length (bp)1442
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01222 ERG4_ERG24 Ergosterol biosynthesis ERG4/ERG24 family 3.6E-10 67 164
PF01222 ERG4_ERG24 Ergosterol biosynthesis ERG4/ERG24 family 7.9E-17 180 291

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZXH1|DHCR7_XENLA 7-dehydrocholesterol reductase OS=Xenopus laevis GN=dhcr7 PE=2 SV=1 22 326 2.0E-42
sp|Q7SXF1|DHCR7_DANRE 7-dehydrocholesterol reductase OS=Danio rerio GN=dhcr7 PE=2 SV=1 17 326 3.0E-41
sp|Q6P4M0|DHCR7_XENTR 7-dehydrocholesterol reductase OS=Xenopus tropicalis GN=dhcr7 PE=2 SV=1 22 326 2.0E-40
sp|O88455|DHCR7_MOUSE 7-dehydrocholesterol reductase OS=Mus musculus GN=Dhcr7 PE=1 SV=1 22 326 1.0E-38
sp|Q9Z2Z8|DHCR7_RAT 7-dehydrocholesterol reductase OS=Rattus norvegicus GN=Dhcr7 PE=2 SV=1 22 326 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZXH1|DHCR7_XENLA 7-dehydrocholesterol reductase OS=Xenopus laevis GN=dhcr7 PE=2 SV=1 22 326 2.0E-42
sp|Q7SXF1|DHCR7_DANRE 7-dehydrocholesterol reductase OS=Danio rerio GN=dhcr7 PE=2 SV=1 17 326 3.0E-41
sp|Q6P4M0|DHCR7_XENTR 7-dehydrocholesterol reductase OS=Xenopus tropicalis GN=dhcr7 PE=2 SV=1 22 326 2.0E-40
sp|O88455|DHCR7_MOUSE 7-dehydrocholesterol reductase OS=Mus musculus GN=Dhcr7 PE=1 SV=1 22 326 1.0E-38
sp|Q9Z2Z8|DHCR7_RAT 7-dehydrocholesterol reductase OS=Rattus norvegicus GN=Dhcr7 PE=2 SV=1 22 326 1.0E-38
sp|Q5E9J5|DHCR7_BOVIN 7-dehydrocholesterol reductase OS=Bos taurus GN=DHCR7 PE=2 SV=1 22 326 9.0E-37
sp|Q9UBM7|DHCR7_HUMAN 7-dehydrocholesterol reductase OS=Homo sapiens GN=DHCR7 PE=1 SV=1 75 326 1.0E-36
sp|Q9LDU6|ST7R_ARATH 7-dehydrocholesterol reductase OS=Arabidopsis thaliana GN=DWF5 PE=1 SV=1 27 326 3.0E-29
sp|Q5UQI4|DHCR7_MIMIV Probable 7-dehydrocholesterol reductase OS=Acanthamoeba polyphaga mimivirus GN=DHCR7 PE=3 SV=1 13 327 2.0E-25
sp|Q54PP1|ERG24_DICDI Delta(14)-sterol reductase OS=Dictyostelium discoideum GN=erg24 PE=3 SV=1 66 335 1.0E-24
sp|P38670|ERG24_NEUCR Delta(14)-sterol reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-3 PE=3 SV=1 73 290 8.0E-15
sp|Q09195|ERG24_SCHPO Delta(14)-sterol reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg24 PE=2 SV=1 36 292 7.0E-14
sp|Q01447|ERG24_FUSSO Delta(14)-sterol reductase OS=Fusarium solani subsp. pisi PE=3 SV=1 18 290 2.0E-11
sp|Q71KT5|ERG24_MOUSE Delta(14)-sterol reductase OS=Mus musculus GN=Tm7sf2 PE=1 SV=2 104 326 2.0E-09
sp|P23913|LBR_CHICK Lamin-B receptor OS=Gallus gallus GN=LBR PE=1 SV=1 75 292 2.0E-08
sp|O76062|ERG24_HUMAN Delta(14)-sterol reductase OS=Homo sapiens GN=TM7SF2 PE=2 SV=3 82 326 2.0E-08
sp|Q9LDR4|ERG24_ARATH Delta(14)-sterol reductase OS=Arabidopsis thaliana GN=FK PE=1 SV=2 89 306 3.0E-08
sp|Q8WMV1|ERG24_BOVIN Delta(14)-sterol reductase OS=Bos taurus GN=TM7SF2 PE=1 SV=1 162 326 2.0E-07
sp|P32462|ERG24_YEAST Delta(14)-sterol reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG24 PE=1 SV=1 75 326 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.5

Transmembrane Domains

Domain # Start End Length
1 20 38 18
2 67 89 22
3 109 131 22
4 141 160 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7333
MYEPRSTDRTSILLDEAGSFCIIAVTPFFFFLFYWIAYNDFRAELSTAAGALFSEKSSFFADRMPYPTAVSVVGY
AIWVLVQAALYHGLPGHLHQAPRTPGGRRLLYRLNGMRAWIITVGIAAAASYLELIDAAFIARNWGALLATANLY
SLALVVIFYIKARVKPDNVGETLFTGKYRDLSFMALQYQLYGEVTNSMLIAIVFRAIIVGEYFLYEEWFFETLDG
AHERFSFYNIYGFAATMPQIWTLQTHYLVLHPVKLSNSEALAVVAAFAVGWSLNHYANEQKSRSRQTGGKMTIWG
REAQVLEATFGTADGKKHRTVLLCSGMDPSCHNLHKRVSKP*
Coding >Hirsu2|7333
ATGTACGAGCCACGATCGACGGACCGGACCAGCATCTTGCTCGACGAAGCCGGCAGCTTTTGCATCATCGCGGTC
ACTCCTTTTTTCTTCTTTCTGTTCTACTGGATCGCATACAATGACTTCAGAGCCGAGCTTTCAACAGCCGCAGGG
GCATTGTTTTCGGAGAAGTCGAGCTTCTTTGCGGACCGCATGCCGTATCCCACGGCGGTCTCGGTAGTGGGCTAT
GCGATCTGGGTTCTTGTCCAGGCGGCCCTGTACCACGGATTGCCTGGTCATCTTCATCAGGCACCGCGAACTCCG
GGCGGACGAAGACTGTTGTATCGACTGAATGGGATGCGGGCGTGGATCATCACGGTGGGAATCGCGGCTGCGGCG
TCGTACTTGGAGCTGATTGATGCGGCGTTCATAGCCAGGAATTGGGGAGCTTTGCTTGCGACTGCCAACCTTTAC
AGCCTGGCACTAGTCGTCATTTTCTACATCAAGGCTCGCGTAAAGCCTGACAATGTTGGCGAGACTCTATTTACA
GGCAAGTATCGTGACCTCTCGTTCATGGCCTTGCAGTATCAACTCTACGGCGAAGTGACCAATTCGATGCTTATT
GCGATAGTTTTCCGGGCCATCATTGTTGGCGAGTACTTTCTCTACGAAGAGTGGTTTTTCGAAACCCTCGATGGT
GCCCACGAACGATTCTCCTTCTATAACATATACGGATTCGCAGCCACCATGCCCCAAATATGGACTCTTCAGACG
CACTACTTAGTCCTCCACCCAGTGAAACTATCCAACTCAGAAGCTTTGGCCGTCGTGGCCGCATTCGCAGTCGGC
TGGTCGTTGAATCACTACGCAAACGAGCAAAAGAGTAGATCGCGGCAGACAGGCGGCAAGATGACCATCTGGGGA
CGGGAAGCCCAGGTCCTCGAGGCGACCTTTGGCACGGCCGACGGTAAAAAGCACCGGACAGTTCTCCTGTGCTCA
GGTATGGACCCGTCTTGTCACAATCTGCATAAGCGTGTCTCCAAGCCGTGA
Transcript >Hirsu2|7333
ATGTACGAGCCACGATCGACGGACCGGACCAGCATCTTGCTCGACGAAGCCGGCAGCTTTTGCATCATCGCGGTC
ACTCCTTTTTTCTTCTTTCTGTTCTACTGGATCGCATACAATGACTTCAGAGCCGAGCTTTCAACAGCCGCAGGG
GCATTGTTTTCGGAGAAGTCGAGCTTCTTTGCGGACCGCATGCCGTATCCCACGGCGGTCTCGGTAGTGGGCTAT
GCGATCTGGGTTCTTGTCCAGGCGGCCCTGTACCACGGATTGCCTGGTCATCTTCATCAGGCACCGCGAACTCCG
GGCGGACGAAGACTGTTGTATCGACTGAATGGGATGCGGGCGTGGATCATCACGGTGGGAATCGCGGCTGCGGCG
TCGTACTTGGAGCTGATTGATGCGGCGTTCATAGCCAGGAATTGGGGAGCTTTGCTTGCGACTGCCAACCTTTAC
AGCCTGGCACTAGTCGTCATTTTCTACATCAAGGCTCGCGTAAAGCCTGACAATGTTGGCGAGACTCTATTTACA
GGCAAGTATCGTGACCTCTCGTTCATGGCCTTGCAGTATCAACTCTACGGCGAAGTGACCAATTCGATGCTTATT
GCGATAGTTTTCCGGGCCATCATTGTTGGCGAGTACTTTCTCTACGAAGAGTGGTTTTTCGAAACCCTCGATGGT
GCCCACGAACGATTCTCCTTCTATAACATATACGGATTCGCAGCCACCATGCCCCAAATATGGACTCTTCAGACG
CACTACTTAGTCCTCCACCCAGTGAAACTATCCAACTCAGAAGCTTTGGCCGTCGTGGCCGCATTCGCAGTCGGC
TGGTCGTTGAATCACTACGCAAACGAGCAAAAGAGTAGATCGCGGCAGACAGGCGGCAAGATGACCATCTGGGGA
CGGGAAGCCCAGGTCCTCGAGGCGACCTTTGGCACGGCCGACGGTAAAAAGCACCGGACAGTTCTCCTGTGCTCA
GGTATGGACCCGTCTTGTCACAATCTGCATAAGCGTGTCTCCAAGCCGTGA
Gene >Hirsu2|7333
ATGTACGAGCCACGATCGACGGACCGGACCAGCATCTTGCTCGACGAAGCCGGCAGCTTTTGCATCATCGCGGTC
ACTCCTTTTTTCTTCTTTCTGTTCTACTGGATCGCATACAATGACTTCAGAGCCGAGCTTTCAACAGCCGCAGGG
GCATTGTTTTCGGAGAAGTCGAGCTTCTTTGCGGACCGCATGCCGTATCCCACGGCGGTCTCGGTAGTGGGCTAT
GCGATCTGGGTTCTTGTCCAGGCGGCCCTGTACCACGGATTGCCTGGTCATCTTCATCAGGCACCGCGAACTCCG
GGCGGACGAAGACTGTTGTATCGACTGAATGGGATGCGGGCGTGGATCATCACGGTGGGAATCGCGGCTGCGGCG
TCGTACTTGGAGCTGATTGATGCGGCGTTCATAGCCAGGAATTGGGGAGCTTTGCTTGCGACTGCCAACCTTTAC
AGCCTGGCACTAGTCGTCATTTTCTACATCAAGGCTCGCGTAAAGCCTGACAATGTTGGCGAGACTCTATTTACA
GGCAAGTATCGGTCTGGTTCCTGTTGAAAGAAGGTCTGTAGCTTCCGCAAGCATGGTCTGATTCAATAAGGGTAC
AGGCCATTTCTGGTATGATCTTTGCAACGGCGGCGAGCTTCATCCACGGACTGGACCACTATTCGACTGGAAGCA
CTTCAACGCCAGCCGAAATGGAGGGCTTATCGCGTGGACAGTCATGTTCGTACCCTTCGCTCCCCTCCTCTTCTC
GCCACCACTATATGTATCAGTCCGTGTTACGAAACAAAGGCCGAGTGATTTTGAGGTTGCGAGCAGAAGGGAGCT
GGAACATCATCAAAGACGAGGCTAACAGGGGCCAGTGACCTCTCGTTCATGGCCTTGCAGTATCAACTCTACGGC
GAAGTGACCAATTCGATGCTTATTGCGATAGTTTTCCGGGCCATCATTGTTGGCGAGTACTTTCTCTACGAAGAG
TGGTAAGCCCTCCACAGATGAGATTTTCACTTTCTCCATAGGGGAGTGCAGAGGCTTACACGTCGCTCACTCACC
TAACTCCAATGTCATCTAGGTTTTTCGAAACCCTCGATGGTGCCCACGAACGATTCTCCTTCTATAACATATACG
GATTCGCAGCCACCATGCCCCAAATATGGACTCTTCAGACGCACTACTTAGTCCTCCACCCAGTGAAACTATCCA
ACTCAGAAGCTTTGGCCGTCGTGGCCGCATTCGCAGTCGGCTGGTCGTTGAATCACTACGCAAACGAGCAAAAGA
GTAGATCGCGGCAGACAGGCGGCAAGATGACCATCTGGGGACGGGAAGCCCAGGTCCTCGAGGCGACCTTTGGCA
CGGCCGACGGTAAAAAGCACCGGACAGTTCTCCTGTGCTCAGGTATGGACCCGTCTTGTCACAATCTGCATAAGC
GTGTCTCCAAGCCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail