Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7331
Gene name
LocationContig_42:25962..28455
Strand-
Gene length (bp)2493
Transcript length (bp)2493
Coding sequence length (bp)2493
Protein length (aa) 831

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 6.7E-06 17 74
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 1.8E-12 401 585

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.4081 0.2669 0.467 0.298 0.328 0.1163 0.1378 0.1457 0.2592 0.0288

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup83
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1374
Ophiocordyceps australis 1348a (Ghana) OphauG2|4316
Ophiocordyceps australis map64 (Brazil) OphauB2|1748
Ophiocordyceps australis map64 (Brazil) OphauB2|3388
Ophiocordyceps australis map64 (Brazil) OphauB2|5960
Ophiocordyceps australis map64 (Brazil) OphauB2|7006
Ophiocordyceps camponoti-rufipedis Ophun1|3943
Ophiocordyceps subramaniannii Hirsu2|1949
Ophiocordyceps subramaniannii Hirsu2|556
Ophiocordyceps subramaniannii Hirsu2|7331 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8399
Ophiocordyceps subramaniannii Hirsu2|9233
Ophiocordyceps subramaniannii Hirsu2|9234

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7331
MFPLSESLDPDSNMIATEAAEFDALGGIRWDQVIGWNKFSIDANPEELQADKEFTANPKYSEKYDQYSASGPQPQ
LNEENTDPAKGKTAYDYAIDMLNSVGEAVGWTGSLPLFTSSDHAEVKAREEAAVNKAGEAADYCRKAVNEAKDLL
ETVKASTSVQQAAAGAERAAKAAIKASKFAKTVAALSEQYPMIGRKAYEEAVSDARDARQYAGKAVHTADTYVAK
AESKRIKGLKGTVEEMQKETERLTSMKEKYSEALLQKINTREEVEKLKEESEFVNSYEMEFDAKMSNLRQSISQA
TVWAPRWENALDALWREDDLLKMEIEYMRSTIDSISIALAEAEKGRTRTGNSQKDKAKEAAEKDATQDGEPQTVE
DAFAASEKEQKAGETVPKSAPVKHVFYGNYLWPHEVKQQGGFLTPADQLKEAPASAYNLRTHLFKERLPEEAKSF
YLSTSKNFGTAAKQAADSAAKATQGFGGVVYLVHATPNMIDVAQTLKEHGETYSKPAEQELAVAGGIEWPQVMGW
LQVPHDQALPSIGESVAGLKGSGKQGLKEHFARAFDERTDLFHRNEDYDRERFGDQTASGQGQAQLLDAKDPKRE
LQTFMKQAGDALRWSGDFPLFETPKKILPHESAEAKAVQAVPPPHEDVSWWSKAWSFIKSHALAIALLPAVAAAN
LIPGLGEVADGAEIALLGAEGASETLALATEGVAEGVAEGAAEGVAEGTAEGTTEGIVEKESADVAEKTLEEGQP
VKSVQELLDEAPDTPVEEPGESVEELLEKAPDPPTEEPGESVEQLLEKAPRPPKGAVREPGGRVKLPAQKNPRRR
RRSVK*
Coding >Hirsu2|7331
ATGTTTCCCCTGTCGGAGAGCCTGGATCCCGATAGCAACATGATAGCCACCGAGGCTGCGGAATTTGATGCCTTG
GGAGGCATTCGCTGGGACCAGGTCATTGGCTGGAACAAGTTCTCCATCGACGCTAATCCCGAAGAGCTCCAAGCC
GATAAGGAGTTCACGGCCAACCCGAAGTATTCCGAGAAATACGACCAATACTCGGCCAGTGGCCCGCAGCCTCAG
CTGAATGAAGAGAACACAGATCCAGCCAAGGGGAAAACGGCTTATGATTACGCCATAGATATGCTCAACAGCGTC
GGCGAGGCAGTTGGCTGGACCGGAAGTCTACCGTTATTCACGAGCTCCGACCATGCCGAAGTCAAGGCCAGGGAA
GAGGCGGCAGTCAACAAGGCCGGAGAGGCAGCCGACTACTGCCGAAAAGCCGTCAACGAGGCTAAAGACCTACTA
GAAACGGTCAAGGCGAGCACCTCGGTCCAGCAGGCCGCTGCTGGCGCGGAGAGGGCGGCTAAAGCGGCGATAAAG
GCATCGAAGTTCGCCAAGACGGTCGCCGCGCTGTCCGAACAATACCCTATGATTGGACGGAAAGCCTACGAGGAA
GCAGTAAGCGACGCCCGAGATGCTAGGCAGTATGCCGGAAAGGCTGTCCACACAGCAGACACGTATGTCGCCAAA
GCGGAGAGCAAAAGAATAAAAGGGCTCAAGGGCACCGTCGAGGAGATGCAGAAGGAAACGGAGAGACTCACTAGC
ATGAAGGAGAAGTATTCGGAAGCGCTACTTCAGAAAATCAACACGAGAGAGGAAGTGGAAAAGCTGAAGGAGGAG
TCGGAGTTTGTGAATTCCTATGAAATGGAGTTTGACGCCAAGATGAGCAACCTCAGGCAGAGCATCTCCCAAGCC
ACCGTTTGGGCGCCTCGTTGGGAGAATGCCCTCGATGCCCTGTGGCGGGAGGATGACCTTCTCAAGATGGAGATC
GAGTACATGAGATCGACGATTGACAGCATCTCGATCGCCCTCGCCGAAGCAGAAAAGGGACGTACCAGGACAGGC
AATAGCCAGAAGGACAAGGCGAAGGAAGCTGCCGAAAAAGATGCGACGCAAGATGGCGAGCCGCAGACGGTGGAG
GATGCATTCGCAGCCTCCGAGAAGGAGCAGAAGGCCGGCGAGACAGTGCCGAAGTCGGCACCGGTCAAGCATGTC
TTCTACGGGAACTATCTGTGGCCGCACGAGGTCAAGCAGCAGGGCGGATTCCTCACGCCGGCCGATCAGCTGAAG
GAGGCGCCGGCTTCGGCCTACAACCTGCGAACGCACCTGTTCAAAGAAAGGCTGCCCGAAGAGGCCAAGTCGTTC
TACCTCTCGACCTCCAAGAACTTCGGGACGGCGGCCAAGCAGGCGGCGGACAGCGCGGCCAAGGCGACCCAGGGC
TTCGGCGGCGTCGTCTATCTCGTCCACGCCACGCCCAACATGATCGACGTGGCGCAGACGCTGAAGGAGCACGGC
GAGACGTACTCCAAGCCGGCGGAGCAGGAGCTGGCCGTCGCGGGAGGCATCGAGTGGCCGCAGGTCATGGGCTGG
CTACAGGTGCCTCACGACCAGGCCCTGCCAAGCATCGGGGAGAGTGTCGCGGGTCTCAAGGGCAGCGGGAAGCAG
GGTCTCAAGGAGCACTTCGCGAGGGCGTTCGACGAAAGGACGGACTTGTTCCATCGAAACGAGGACTATGACCGC
GAAAGATTCGGCGACCAGACTGCCTCCGGCCAGGGACAAGCGCAGCTTCTAGACGCCAAGGACCCGAAAAGGGAG
CTCCAGACGTTCATGAAGCAGGCGGGAGACGCCTTACGCTGGAGCGGCGACTTCCCGCTCTTCGAGACGCCCAAG
AAGATCCTGCCGCACGAGTCTGCCGAGGCCAAGGCGGTGCAGGCGGTGCCGCCGCCGCACGAAGACGTGTCGTGG
TGGAGCAAGGCGTGGAGCTTCATCAAGAGCCACGCCCTGGCGATTGCGCTGCTGCCCGCCGTCGCTGCGGCGAAC
CTGATCCCCGGCTTGGGCGAGGTGGCCGACGGGGCCGAGATCGCGCTTCTGGGCGCCGAGGGCGCGTCGGAGACG
CTCGCGCTGGCGACCGAGGGCGTGGCCGAAGGCGTGGCCGAGGGCGCGGCTGAGGGGGTGGCCGAGGGCACCGCC
GAAGGGACGACGGAGGGCATCGTGGAGAAGGAGTCGGCGGACGTCGCCGAGAAGACGCTGGAGGAGGGTCAGCCG
GTCAAGTCGGTGCAGGAACTTCTGGACGAGGCCCCGGATACACCGGTCGAGGAGCCGGGGGAGTCTGTGGAGGAA
CTCCTGGAAAAGGCCCCGGATCCACCGACCGAGGAGCCGGGGGAGTCTGTAGAGCAACTCCTAGAAAAGGCCCCG
CGTCCGCCGAAAGGGGCGGTCCGGGAACCGGGTGGGCGCGTCAAGCTCCCTGCTCAGAAGAATCCGCGGCGAAGA
AGACGCAGCGTAAAGTAG
Transcript >Hirsu2|7331
ATGTTTCCCCTGTCGGAGAGCCTGGATCCCGATAGCAACATGATAGCCACCGAGGCTGCGGAATTTGATGCCTTG
GGAGGCATTCGCTGGGACCAGGTCATTGGCTGGAACAAGTTCTCCATCGACGCTAATCCCGAAGAGCTCCAAGCC
GATAAGGAGTTCACGGCCAACCCGAAGTATTCCGAGAAATACGACCAATACTCGGCCAGTGGCCCGCAGCCTCAG
CTGAATGAAGAGAACACAGATCCAGCCAAGGGGAAAACGGCTTATGATTACGCCATAGATATGCTCAACAGCGTC
GGCGAGGCAGTTGGCTGGACCGGAAGTCTACCGTTATTCACGAGCTCCGACCATGCCGAAGTCAAGGCCAGGGAA
GAGGCGGCAGTCAACAAGGCCGGAGAGGCAGCCGACTACTGCCGAAAAGCCGTCAACGAGGCTAAAGACCTACTA
GAAACGGTCAAGGCGAGCACCTCGGTCCAGCAGGCCGCTGCTGGCGCGGAGAGGGCGGCTAAAGCGGCGATAAAG
GCATCGAAGTTCGCCAAGACGGTCGCCGCGCTGTCCGAACAATACCCTATGATTGGACGGAAAGCCTACGAGGAA
GCAGTAAGCGACGCCCGAGATGCTAGGCAGTATGCCGGAAAGGCTGTCCACACAGCAGACACGTATGTCGCCAAA
GCGGAGAGCAAAAGAATAAAAGGGCTCAAGGGCACCGTCGAGGAGATGCAGAAGGAAACGGAGAGACTCACTAGC
ATGAAGGAGAAGTATTCGGAAGCGCTACTTCAGAAAATCAACACGAGAGAGGAAGTGGAAAAGCTGAAGGAGGAG
TCGGAGTTTGTGAATTCCTATGAAATGGAGTTTGACGCCAAGATGAGCAACCTCAGGCAGAGCATCTCCCAAGCC
ACCGTTTGGGCGCCTCGTTGGGAGAATGCCCTCGATGCCCTGTGGCGGGAGGATGACCTTCTCAAGATGGAGATC
GAGTACATGAGATCGACGATTGACAGCATCTCGATCGCCCTCGCCGAAGCAGAAAAGGGACGTACCAGGACAGGC
AATAGCCAGAAGGACAAGGCGAAGGAAGCTGCCGAAAAAGATGCGACGCAAGATGGCGAGCCGCAGACGGTGGAG
GATGCATTCGCAGCCTCCGAGAAGGAGCAGAAGGCCGGCGAGACAGTGCCGAAGTCGGCACCGGTCAAGCATGTC
TTCTACGGGAACTATCTGTGGCCGCACGAGGTCAAGCAGCAGGGCGGATTCCTCACGCCGGCCGATCAGCTGAAG
GAGGCGCCGGCTTCGGCCTACAACCTGCGAACGCACCTGTTCAAAGAAAGGCTGCCCGAAGAGGCCAAGTCGTTC
TACCTCTCGACCTCCAAGAACTTCGGGACGGCGGCCAAGCAGGCGGCGGACAGCGCGGCCAAGGCGACCCAGGGC
TTCGGCGGCGTCGTCTATCTCGTCCACGCCACGCCCAACATGATCGACGTGGCGCAGACGCTGAAGGAGCACGGC
GAGACGTACTCCAAGCCGGCGGAGCAGGAGCTGGCCGTCGCGGGAGGCATCGAGTGGCCGCAGGTCATGGGCTGG
CTACAGGTGCCTCACGACCAGGCCCTGCCAAGCATCGGGGAGAGTGTCGCGGGTCTCAAGGGCAGCGGGAAGCAG
GGTCTCAAGGAGCACTTCGCGAGGGCGTTCGACGAAAGGACGGACTTGTTCCATCGAAACGAGGACTATGACCGC
GAAAGATTCGGCGACCAGACTGCCTCCGGCCAGGGACAAGCGCAGCTTCTAGACGCCAAGGACCCGAAAAGGGAG
CTCCAGACGTTCATGAAGCAGGCGGGAGACGCCTTACGCTGGAGCGGCGACTTCCCGCTCTTCGAGACGCCCAAG
AAGATCCTGCCGCACGAGTCTGCCGAGGCCAAGGCGGTGCAGGCGGTGCCGCCGCCGCACGAAGACGTGTCGTGG
TGGAGCAAGGCGTGGAGCTTCATCAAGAGCCACGCCCTGGCGATTGCGCTGCTGCCCGCCGTCGCTGCGGCGAAC
CTGATCCCCGGCTTGGGCGAGGTGGCCGACGGGGCCGAGATCGCGCTTCTGGGCGCCGAGGGCGCGTCGGAGACG
CTCGCGCTGGCGACCGAGGGCGTGGCCGAAGGCGTGGCCGAGGGCGCGGCTGAGGGGGTGGCCGAGGGCACCGCC
GAAGGGACGACGGAGGGCATCGTGGAGAAGGAGTCGGCGGACGTCGCCGAGAAGACGCTGGAGGAGGGTCAGCCG
GTCAAGTCGGTGCAGGAACTTCTGGACGAGGCCCCGGATACACCGGTCGAGGAGCCGGGGGAGTCTGTGGAGGAA
CTCCTGGAAAAGGCCCCGGATCCACCGACCGAGGAGCCGGGGGAGTCTGTAGAGCAACTCCTAGAAAAGGCCCCG
CGTCCGCCGAAAGGGGCGGTCCGGGAACCGGGTGGGCGCGTCAAGCTCCCTGCTCAGAAGAATCCGCGGCGAAGA
AGACGCAGCGTAAAGTAG
Gene >Hirsu2|7331
ATGTTTCCCCTGTCGGAGAGCCTGGATCCCGATAGCAACATGATAGCCACCGAGGCTGCGGAATTTGATGCCTTG
GGAGGCATTCGCTGGGACCAGGTCATTGGCTGGAACAAGTTCTCCATCGACGCTAATCCCGAAGAGCTCCAAGCC
GATAAGGAGTTCACGGCCAACCCGAAGTATTCCGAGAAATACGACCAATACTCGGCCAGTGGCCCGCAGCCTCAG
CTGAATGAAGAGAACACAGATCCAGCCAAGGGGAAAACGGCTTATGATTACGCCATAGATATGCTCAACAGCGTC
GGCGAGGCAGTTGGCTGGACCGGAAGTCTACCGTTATTCACGAGCTCCGACCATGCCGAAGTCAAGGCCAGGGAA
GAGGCGGCAGTCAACAAGGCCGGAGAGGCAGCCGACTACTGCCGAAAAGCCGTCAACGAGGCTAAAGACCTACTA
GAAACGGTCAAGGCGAGCACCTCGGTCCAGCAGGCCGCTGCTGGCGCGGAGAGGGCGGCTAAAGCGGCGATAAAG
GCATCGAAGTTCGCCAAGACGGTCGCCGCGCTGTCCGAACAATACCCTATGATTGGACGGAAAGCCTACGAGGAA
GCAGTAAGCGACGCCCGAGATGCTAGGCAGTATGCCGGAAAGGCTGTCCACACAGCAGACACGTATGTCGCCAAA
GCGGAGAGCAAAAGAATAAAAGGGCTCAAGGGCACCGTCGAGGAGATGCAGAAGGAAACGGAGAGACTCACTAGC
ATGAAGGAGAAGTATTCGGAAGCGCTACTTCAGAAAATCAACACGAGAGAGGAAGTGGAAAAGCTGAAGGAGGAG
TCGGAGTTTGTGAATTCCTATGAAATGGAGTTTGACGCCAAGATGAGCAACCTCAGGCAGAGCATCTCCCAAGCC
ACCGTTTGGGCGCCTCGTTGGGAGAATGCCCTCGATGCCCTGTGGCGGGAGGATGACCTTCTCAAGATGGAGATC
GAGTACATGAGATCGACGATTGACAGCATCTCGATCGCCCTCGCCGAAGCAGAAAAGGGACGTACCAGGACAGGC
AATAGCCAGAAGGACAAGGCGAAGGAAGCTGCCGAAAAAGATGCGACGCAAGATGGCGAGCCGCAGACGGTGGAG
GATGCATTCGCAGCCTCCGAGAAGGAGCAGAAGGCCGGCGAGACAGTGCCGAAGTCGGCACCGGTCAAGCATGTC
TTCTACGGGAACTATCTGTGGCCGCACGAGGTCAAGCAGCAGGGCGGATTCCTCACGCCGGCCGATCAGCTGAAG
GAGGCGCCGGCTTCGGCCTACAACCTGCGAACGCACCTGTTCAAAGAAAGGCTGCCCGAAGAGGCCAAGTCGTTC
TACCTCTCGACCTCCAAGAACTTCGGGACGGCGGCCAAGCAGGCGGCGGACAGCGCGGCCAAGGCGACCCAGGGC
TTCGGCGGCGTCGTCTATCTCGTCCACGCCACGCCCAACATGATCGACGTGGCGCAGACGCTGAAGGAGCACGGC
GAGACGTACTCCAAGCCGGCGGAGCAGGAGCTGGCCGTCGCGGGAGGCATCGAGTGGCCGCAGGTCATGGGCTGG
CTACAGGTGCCTCACGACCAGGCCCTGCCAAGCATCGGGGAGAGTGTCGCGGGTCTCAAGGGCAGCGGGAAGCAG
GGTCTCAAGGAGCACTTCGCGAGGGCGTTCGACGAAAGGACGGACTTGTTCCATCGAAACGAGGACTATGACCGC
GAAAGATTCGGCGACCAGACTGCCTCCGGCCAGGGACAAGCGCAGCTTCTAGACGCCAAGGACCCGAAAAGGGAG
CTCCAGACGTTCATGAAGCAGGCGGGAGACGCCTTACGCTGGAGCGGCGACTTCCCGCTCTTCGAGACGCCCAAG
AAGATCCTGCCGCACGAGTCTGCCGAGGCCAAGGCGGTGCAGGCGGTGCCGCCGCCGCACGAAGACGTGTCGTGG
TGGAGCAAGGCGTGGAGCTTCATCAAGAGCCACGCCCTGGCGATTGCGCTGCTGCCCGCCGTCGCTGCGGCGAAC
CTGATCCCCGGCTTGGGCGAGGTGGCCGACGGGGCCGAGATCGCGCTTCTGGGCGCCGAGGGCGCGTCGGAGACG
CTCGCGCTGGCGACCGAGGGCGTGGCCGAAGGCGTGGCCGAGGGCGCGGCTGAGGGGGTGGCCGAGGGCACCGCC
GAAGGGACGACGGAGGGCATCGTGGAGAAGGAGTCGGCGGACGTCGCCGAGAAGACGCTGGAGGAGGGTCAGCCG
GTCAAGTCGGTGCAGGAACTTCTGGACGAGGCCCCGGATACACCGGTCGAGGAGCCGGGGGAGTCTGTGGAGGAA
CTCCTGGAAAAGGCCCCGGATCCACCGACCGAGGAGCCGGGGGAGTCTGTAGAGCAACTCCTAGAAAAGGCCCCG
CGTCCGCCGAAAGGGGCGGTCCGGGAACCGGGTGGGCGCGTCAAGCTCCCTGCTCAGAAGAATCCGCGGCGAAGA
AGACGCAGCGTAAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail