Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7327
Gene name
LocationContig_42:14729..17285
Strand-
Gene length (bp)2556
Transcript length (bp)2424
Coding sequence length (bp)2424
Protein length (aa) 808

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13637 Ank_4 Ankyrin repeats (many copies) 7.9E-09 377 418
PF13606 Ank_3 Ankyrin repeat 5.5E-04 523 551
PF00023 Ank Ankyrin repeat 1.3E-03 523 553

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P01129|CDC10_SCHPO Start control protein cdc10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc10 PE=1 SV=1 23 803 1.0E-97
sp|P09959|SWI6_YEAST Regulatory protein SWI6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI6 PE=1 SV=1 364 799 6.0E-59
sp|P40418|SWI6_KLULA Regulatory protein SWI6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWI6 PE=3 SV=1 364 799 2.0E-55
sp|P41412|RES2_SCHPO Cell division cycle-related protein res2/pct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res2 PE=1 SV=1 26 132 7.0E-35
sp|P33520|RES1_SCHPO Cell division cycle-related protein res1/sct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res1 PE=1 SV=1 25 123 2.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P01129|CDC10_SCHPO Start control protein cdc10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc10 PE=1 SV=1 23 803 1.0E-97
sp|P09959|SWI6_YEAST Regulatory protein SWI6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI6 PE=1 SV=1 364 799 6.0E-59
sp|P40418|SWI6_KLULA Regulatory protein SWI6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWI6 PE=3 SV=1 364 799 2.0E-55
sp|P41412|RES2_SCHPO Cell division cycle-related protein res2/pct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res2 PE=1 SV=1 26 132 7.0E-35
sp|P33520|RES1_SCHPO Cell division cycle-related protein res1/sct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res1 PE=1 SV=1 25 123 2.0E-30
sp|P39679|MBP1_KLULA Transcription factor MBP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MBP1 PE=3 SV=2 25 133 5.0E-28
sp|P39678|MBP1_YEAST Transcription factor MBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MBP1 PE=1 SV=1 25 133 7.0E-28
sp|P33520|RES1_SCHPO Cell division cycle-related protein res1/sct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res1 PE=1 SV=1 365 562 2.0E-24
sp|P41412|RES2_SCHPO Cell division cycle-related protein res2/pct1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=res2 PE=1 SV=1 372 554 4.0E-24
sp|P39678|MBP1_YEAST Transcription factor MBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MBP1 PE=1 SV=1 288 557 4.0E-23
sp|P39679|MBP1_KLULA Transcription factor MBP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MBP1 PE=3 SV=2 368 786 7.0E-23
sp|P25302|SWI4_YEAST Regulatory protein SWI4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI4 PE=1 SV=2 24 123 3.0E-21
sp|P25302|SWI4_YEAST Regulatory protein SWI4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI4 PE=1 SV=2 334 553 6.0E-13
sp|Q59P39|EFH1_CANAL Transcriptional regulator EFH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFH1 PE=2 SV=1 34 165 6.0E-10
sp|P36011|STUA_EMENI Cell pattern formation-associated protein stuA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stuA PE=2 SV=2 33 121 5.0E-09
sp|P43064|EFG1_CANAX Enhanced filamentous growth protein OS=Candida albicans GN=EFG1 PE=3 SV=1 36 125 1.0E-08
sp|Q59X67|EFG1_CANAL Enhanced filamentous growth protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EFG1 PE=1 SV=1 36 125 1.0E-08
sp|P53438|SOK2_YEAST Protein SOK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOK2 PE=1 SV=1 36 125 3.0E-08
sp|P36093|PHD1_YEAST Putative transcription factor PHD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHD1 PE=1 SV=1 36 125 6.0E-08
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 378 548 1.0E-07
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 373 569 4.0E-07
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 356 560 1.0E-06
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 371 569 1.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 370 548 3.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 378 563 4.0E-06
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 350 562 5.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 369 560 5.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 369 563 7.0E-06
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 330 560 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7327
MSQQSQPRHAASFHHGYNGAVEPPQIYSASYSGVDVYEMEVNSVAVMRRRQDSWLNATQILKVAGVDKGKRTKIL
EKEIQTGEHEKVQGGYGKYQGTWIKFERGVEVCRQYGVEDLLRPLLTYDMGQDGGVAGRGDFNTPTKEQAMAAQR
KRMYNSSADGRPNGLSGTFFKNISSTASHAVAAISKARFDSPGPRSRNGPTRPPSFSRQPSMQNGEEFPGNSQQS
YASDYSQQVDSAYSTQQQQPQQQQQQQGSASGMPDNEPPRKRQRVTMTPADSFGGYGQAMDMYAAAFPGSPTEPN
ESFIYSQGPPINDRTSGEEANGPLPPLPYEMSPDVESKRSMLMGLFMDSTASDTPKHDMLRTFTPAELDMPIDPQ
SHTALHWAATLARMPLLRALIAAGASPYRVNASGETALMRACLVTNSMDHGSFPDLLEVLGGTIEARDQKGRTVL
HHIAVTSAVKGRNAASRYYLESLLEWVVRQGSVPNSQSTQVNGSGPGGSQPLIPKMGIARFMSEIVNAQDSSGDT
ALNIAARIGNRSIISQLLEVGADPNIANRVGLRPVDFGIGGENAEEETNGETVAETNGVSGSSHRTRENSDDIIA
SITHLLNETGAAFQQEMKSKQASLDALHTTLRTTSTQLGEARRNLEHLTATLKRQQLARQKVSNLAHAREDEQLR
LMNEQSRSSQPNPSSSWETELAAMLEAAEESSASGGGFGSEGMLPSAAVLRARIRAIEGRRDVTRKMVQALKGRS
RDVEVKYRRVVALCTGVQEAEVDAVVDGLLKAVESEREELDIGRVRRFLGGVEGVVH*
Coding >Hirsu2|7327
ATGAGCCAACAATCCCAACCGAGGCATGCCGCCTCTTTTCACCATGGCTACAACGGCGCTGTCGAGCCCCCGCAG
ATCTACTCTGCCTCTTACTCCGGCGTCGACGTCTACGAAATGGAAGTCAATAGTGTTGCTGTGATGCGCCGTCGT
CAAGACTCATGGCTCAACGCCACCCAGATCCTCAAAGTTGCCGGTGTCGACAAGGGCAAGCGCACCAAGATCCTC
GAGAAGGAGATACAGACCGGCGAGCACGAAAAGGTACAGGGTGGCTACGGCAAATACCAGGGCACCTGGATCAAG
TTTGAACGTGGAGTCGAGGTCTGCCGTCAGTACGGAGTCGAGGATCTCCTGCGGCCCCTCCTGACCTACGACATG
GGCCAGGATGGAGGTGTGGCCGGCAGAGGCGACTTCAACACGCCGACCAAGGAGCAGGCCATGGCTGCCCAGCGA
AAGCGCATGTACAACTCCAGCGCCGACGGCCGGCCAAACGGTCTTTCGGGGACCTTCTTCAAGAATATTTCCAGC
ACAGCCTCCCACGCAGTTGCCGCCATCAGCAAAGCCCGCTTCGATTCCCCCGGGCCCAGGAGCCGCAACGGGCCG
ACCCGGCCGCCCAGTTTTAGCAGACAGCCCTCGATGCAAAACGGCGAAGAGTTTCCCGGCAATTCTCAACAGAGC
TATGCCTCCGACTACAGCCAGCAGGTCGATTCAGCCTATTCGACCCAACAGCAGCAACCACAACAGCAGCAGCAG
CAGCAGGGCAGTGCTTCTGGTATGCCAGACAATGAGCCTCCCCGAAAGCGGCAGCGGGTCACCATGACGCCAGCC
GATAGCTTCGGCGGCTACGGCCAGGCCATGGACATGTATGCCGCCGCCTTCCCCGGCTCCCCCACAGAGCCAAAT
GAATCCTTCATCTATTCGCAAGGCCCCCCGATCAACGACCGTACTTCCGGCGAGGAGGCCAACGGACCCCTTCCC
CCCCTGCCCTACGAGATGTCGCCGGATGTGGAATCGAAGCGCAGCATGCTCATGGGTCTCTTCATGGACTCCACC
GCGTCGGATACCCCTAAACATGACATGTTGCGGACTTTCACTCCTGCCGAGCTCGACATGCCCATCGATCCCCAA
AGTCACACCGCCCTCCACTGGGCAGCCACCCTGGCGCGCATGCCCCTGCTCCGCGCCCTCATCGCCGCAGGAGCA
TCTCCCTATCGAGTCAACGCCTCGGGCGAGACGGCACTCATGCGAGCCTGCCTCGTCACCAACTCCATGGACCAC
GGATCGTTTCCCGACCTGCTCGAGGTTCTGGGCGGCACGATCGAGGCGCGCGACCAGAAGGGCCGAACCGTGTTA
CACCACATCGCCGTCACCAGCGCCGTCAAGGGCCGCAACGCCGCCAGCCGATACTATCTCGAAAGCCTACTCGAA
TGGGTGGTGCGCCAGGGCAGCGTCCCCAACAGCCAGAGCACGCAGGTCAACGGCAGCGGACCGGGCGGCTCCCAG
CCCCTCATCCCCAAGATGGGCATTGCGCGCTTCATGTCCGAGATCGTCAATGCCCAGGACAGCTCTGGCGACACG
GCGCTGAACATTGCGGCCCGAATCGGCAACCGGAGCATCATCTCTCAACTTCTGGAAGTCGGCGCCGACCCCAAT
ATCGCCAATCGCGTCGGCCTGAGGCCGGTTGACTTTGGCATCGGCGGGGAGAATGCAGAGGAGGAGACGAATGGC
GAGACGGTGGCCGAGACGAATGGAGTGTCTGGATCGAGCCACCGCACCCGCGAAAACAGTGACGACATCATCGCA
TCCATCACCCATTTGCTGAACGAGACCGGGGCCGCTTTTCAACAAGAAATGAAGTCGAAACAGGCGTCCCTGGAT
GCCCTCCACACCACTCTCCGAACGACCTCGACCCAACTGGGTGAGGCCCGGCGCAACCTCGAACATCTCACGGCA
ACGCTGAAGAGGCAGCAGCTGGCCCGGCAAAAGGTGTCGAATCTGGCTCACGCCCGCGAAGACGAACAGCTCCGC
CTGATGAACGAGCAGTCGAGGTCGTCGCAGCCCAACCCGTCGTCGTCGTGGGAGACGGAGCTCGCGGCCATGCTT
GAGGCTGCCGAGGAGTCGTCGGCCTCGGGCGGAGGGTTCGGCAGCGAGGGGATGCTGCCCTCGGCGGCCGTGCTC
CGGGCCCGCATCCGCGCCATCGAGGGCCGCCGCGACGTCACGCGCAAGATGGTGCAGGCCCTCAAGGGCAGGAGC
CGCGACGTCGAGGTCAAGTACCGCCGCGTCGTGGCGCTGTGCACGGGTGTGCAGGAGGCCGAGGTTGACGCCGTC
GTCGACGGCCTGCTGAAGGCGGTCGAGAGCGAGCGGGAAGAGCTCGACATCGGGCGGGTAAGGCGCTTCCTCGGC
GGCGTCGAGGGCGTGGTTCACTAG
Transcript >Hirsu2|7327
ATGAGCCAACAATCCCAACCGAGGCATGCCGCCTCTTTTCACCATGGCTACAACGGCGCTGTCGAGCCCCCGCAG
ATCTACTCTGCCTCTTACTCCGGCGTCGACGTCTACGAAATGGAAGTCAATAGTGTTGCTGTGATGCGCCGTCGT
CAAGACTCATGGCTCAACGCCACCCAGATCCTCAAAGTTGCCGGTGTCGACAAGGGCAAGCGCACCAAGATCCTC
GAGAAGGAGATACAGACCGGCGAGCACGAAAAGGTACAGGGTGGCTACGGCAAATACCAGGGCACCTGGATCAAG
TTTGAACGTGGAGTCGAGGTCTGCCGTCAGTACGGAGTCGAGGATCTCCTGCGGCCCCTCCTGACCTACGACATG
GGCCAGGATGGAGGTGTGGCCGGCAGAGGCGACTTCAACACGCCGACCAAGGAGCAGGCCATGGCTGCCCAGCGA
AAGCGCATGTACAACTCCAGCGCCGACGGCCGGCCAAACGGTCTTTCGGGGACCTTCTTCAAGAATATTTCCAGC
ACAGCCTCCCACGCAGTTGCCGCCATCAGCAAAGCCCGCTTCGATTCCCCCGGGCCCAGGAGCCGCAACGGGCCG
ACCCGGCCGCCCAGTTTTAGCAGACAGCCCTCGATGCAAAACGGCGAAGAGTTTCCCGGCAATTCTCAACAGAGC
TATGCCTCCGACTACAGCCAGCAGGTCGATTCAGCCTATTCGACCCAACAGCAGCAACCACAACAGCAGCAGCAG
CAGCAGGGCAGTGCTTCTGGTATGCCAGACAATGAGCCTCCCCGAAAGCGGCAGCGGGTCACCATGACGCCAGCC
GATAGCTTCGGCGGCTACGGCCAGGCCATGGACATGTATGCCGCCGCCTTCCCCGGCTCCCCCACAGAGCCAAAT
GAATCCTTCATCTATTCGCAAGGCCCCCCGATCAACGACCGTACTTCCGGCGAGGAGGCCAACGGACCCCTTCCC
CCCCTGCCCTACGAGATGTCGCCGGATGTGGAATCGAAGCGCAGCATGCTCATGGGTCTCTTCATGGACTCCACC
GCGTCGGATACCCCTAAACATGACATGTTGCGGACTTTCACTCCTGCCGAGCTCGACATGCCCATCGATCCCCAA
AGTCACACCGCCCTCCACTGGGCAGCCACCCTGGCGCGCATGCCCCTGCTCCGCGCCCTCATCGCCGCAGGAGCA
TCTCCCTATCGAGTCAACGCCTCGGGCGAGACGGCACTCATGCGAGCCTGCCTCGTCACCAACTCCATGGACCAC
GGATCGTTTCCCGACCTGCTCGAGGTTCTGGGCGGCACGATCGAGGCGCGCGACCAGAAGGGCCGAACCGTGTTA
CACCACATCGCCGTCACCAGCGCCGTCAAGGGCCGCAACGCCGCCAGCCGATACTATCTCGAAAGCCTACTCGAA
TGGGTGGTGCGCCAGGGCAGCGTCCCCAACAGCCAGAGCACGCAGGTCAACGGCAGCGGACCGGGCGGCTCCCAG
CCCCTCATCCCCAAGATGGGCATTGCGCGCTTCATGTCCGAGATCGTCAATGCCCAGGACAGCTCTGGCGACACG
GCGCTGAACATTGCGGCCCGAATCGGCAACCGGAGCATCATCTCTCAACTTCTGGAAGTCGGCGCCGACCCCAAT
ATCGCCAATCGCGTCGGCCTGAGGCCGGTTGACTTTGGCATCGGCGGGGAGAATGCAGAGGAGGAGACGAATGGC
GAGACGGTGGCCGAGACGAATGGAGTGTCTGGATCGAGCCACCGCACCCGCGAAAACAGTGACGACATCATCGCA
TCCATCACCCATTTGCTGAACGAGACCGGGGCCGCTTTTCAACAAGAAATGAAGTCGAAACAGGCGTCCCTGGAT
GCCCTCCACACCACTCTCCGAACGACCTCGACCCAACTGGGTGAGGCCCGGCGCAACCTCGAACATCTCACGGCA
ACGCTGAAGAGGCAGCAGCTGGCCCGGCAAAAGGTGTCGAATCTGGCTCACGCCCGCGAAGACGAACAGCTCCGC
CTGATGAACGAGCAGTCGAGGTCGTCGCAGCCCAACCCGTCGTCGTCGTGGGAGACGGAGCTCGCGGCCATGCTT
GAGGCTGCCGAGGAGTCGTCGGCCTCGGGCGGAGGGTTCGGCAGCGAGGGGATGCTGCCCTCGGCGGCCGTGCTC
CGGGCCCGCATCCGCGCCATCGAGGGCCGCCGCGACGTCACGCGCAAGATGGTGCAGGCCCTCAAGGGCAGGAGC
CGCGACGTCGAGGTCAAGTACCGCCGCGTCGTGGCGCTGTGCACGGGTGTGCAGGAGGCCGAGGTTGACGCCGTC
GTCGACGGCCTGCTGAAGGCGGTCGAGAGCGAGCGGGAAGAGCTCGACATCGGGCGGGTAAGGCGCTTCCTCGGC
GGCGTCGAGGGCGTGGTTCACTAG
Gene >Hirsu2|7327
ATGAGCCAACAATCCCAACCGAGGCATGCCGCCTCTTTTCACCATGGCTACAACGGCGCTGTCGAGCCCCCGCAG
ATCTACTCTGTAGGATTCCCTGTCTGTCGTCGATGGAAAAGGGGGACGGTGGTTTATTGACGTCGTTATACCCTC
CTCACAGGCCTCTTACTCCGGCGTCGACGTCTACGAAATGGAAGTCAATAGTGTTGCTGTGATGCGCCGTCGTCA
AGACTCATGGCTCAACGCCACCCAGATCCTCAAAGTTGCCGGTGTCGACAAGGGCAAGCGCACCAAGATCCTCGA
GAAGGAGATACAGACCGGCGAGCACGAAAAGGTACAGGGTGGCTACGGCAAATACCAGGGCACCTGGATCAAGTT
TGAACGTGGAGTCGAGGTCTGCCGTCAGTACGGAGTCGAGGATCTCCTGCGGCCCCTCCTGACCTACGACATGGG
CCAGGATGGAGGTGTGGCCGGCAGAGGCGACTTCAACACGCCGACCAAGGAGCAGGCCATGGCTGCCCAGCGAAA
GCGCATGTACAACTCCAGCGCCGACGGCCGGCCAAACGGTCTTTCGGGGACCTTCTTCAAGAATATTTCCAGCAC
AGCCTCCCACGCAGTTGCCGCCATCAGCAAAGCCCGCTTCGATTCCCCCGGGCCCAGGAGCCGCAACGGGCCGAC
CCGGCCGCCCAGTTTTAGCAGACAGCCCTCGATGCAAAACGGCGAAGAGTTTCCCGGCAATTCTCAACAGAGCTA
TGCCTCCGACTACAGCCAGCAGGTCGATTCAGCCTATTCGACCCAACAGCAGCAACCACAACAGCAGCAGCAGCA
GCAGGGCAGTGCTTCTGGTATGCCAGACAATGAGCCTCCCCGAAAGCGGCAGCGGGTCACCATGACGCCAGCCGA
TAGCTTCGGCGGCTACGGCCAGGCCATGGACATGTATGCCGCCGCCTTCCCCGGCTCCCCCACAGAGCCAAATGA
ATCCTTCATCTATTCGCAAGGCCCCCCGATCAACGACCGTACTTCCGGCGAGGAGGCCAACGGACCCCTTCCCCC
CCTGCCCTACGAGATGTCGCCGGATGTGGAATCGAAGCGCAGCATGCTCATGGGTCTCTTCATGGACTCCACCGC
GTCGGATACCCCTAAACATGACATGTTGCGGACTTTCACTCCTGCCGAGCTCGACATGCCCATCGATCCCCAAAG
TCACACCGCCCTCCACTGGGCAGCCACCCTGGCGCGCATGCCCCTGCTCCGCGCCCTCATCGCCGCAGGAGCATC
TCCCTATCGAGTCAACGCCTCGGGCGAGACGGCACTCATGCGAGCCTGCCTCGTCACCAACTCCATGGACCACGG
ATCGTTTCCCGACCTGCTCGAGGTTCTGGGCGGCACGATCGAGGCGCGCGACCAGAAGGGCCGAACCGTGTTACA
CCACATCGCCGTCACCAGCGCCGTCAAGGGCCGCAACGCCGCCAGCCGATACTATCTCGAAAGCCTACTCGAATG
GGTGGTGCGCCAGGGCAGCGTCCCCAACAGCCAGAGCACGCAGGTCAACGGCAGCGGACCGGGCGGCTCCCAGCC
CCTCATCCCCAAGATGGGCATTGCGCGCTTCATGTCCGAGATCGTCAATGCCCAGGACAGCTCTGGCGACACGGC
GCTGAACATTGCGGCCCGAATCGGCAACCGGAGCATCATCTCTCAACTTCTGGAAGTCGGCGCCGACCCCAATAT
CGCCAATCGCGTCGGCCTGAGGCCGGTTGACTTTGGCATCGGCGGGGAGAATGCAGAGGAGGAGACGAATGGCGA
GACGGTGGCCGAGACGAATGGAGTGTCTGGATCGAGCCACCGCACCCGCGAAAACAGTGACGACATCATCGCATG
TGAGTCTTGCGCCCGCCTCAGACGGCCTGCTACCGAGCTCTTACTAACGAGACACAAGCCATCACCCATTTGCTG
AACGAGACCGGGGCCGCTTTTCAACAAGAAATGAAGTCGAAACAGGCGTCCCTGGATGCCCTCCACACCACTCTC
CGAACGACCTCGACCCAACTGGGTGAGGCCCGGCGCAACCTCGAACATCTCACGGCAACGCTGAAGAGGCAGCAG
CTGGCCCGGCAAAAGGTGTCGAATCTGGCTCACGCCCGCGAAGACGAACAGCTCCGCCTGATGAACGAGCAGTCG
AGGTCGTCGCAGCCCAACCCGTCGTCGTCGTGGGAGACGGAGCTCGCGGCCATGCTTGAGGCTGCCGAGGAGTCG
TCGGCCTCGGGCGGAGGGTTCGGCAGCGAGGGGATGCTGCCCTCGGCGGCCGTGCTCCGGGCCCGCATCCGCGCC
ATCGAGGGCCGCCGCGACGTCACGCGCAAGATGGTGCAGGCCCTCAAGGGCAGGAGCCGCGACGTCGAGGTCAAG
TACCGCCGCGTCGTGGCGCTGTGCACGGGTGTGCAGGAGGCCGAGGTTGACGCCGTCGTCGACGGCCTGCTGAAG
GCGGTCGAGAGCGAGCGGGAAGAGCTCGACATCGGGCGGGTAAGGCGCTTCCTCGGCGGCGTCGAGGGCGTGGTT
CACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail