Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7326
Gene name
LocationContig_42:12946..14059
Strand+
Gene length (bp)1113
Transcript length (bp)960
Coding sequence length (bp)960
Protein length (aa) 320

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11464 Rbsn Rabenosyn Rab binding domain 5.5E-15 257 298

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P32609|PEP7_YEAST Vacuolar segregation protein PEP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP7 PE=1 SV=2 20 304 6.0E-20

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5062 0.5447 0.0357 0.1037 0.1341 0.005 0.0695 0.4855 0.1912 0.0494

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup960
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5519
Ophiocordyceps australis map64 (Brazil) OphauB2|2188
Ophiocordyceps camponoti-floridani Ophcf2|05518
Ophiocordyceps camponoti-rufipedis Ophun1|3791
Ophiocordyceps kimflemingae Ophio5|5028
Ophiocordyceps subramaniannii Hirsu2|7325
Ophiocordyceps subramaniannii Hirsu2|7326 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7326
MGQKDTRKLLEQSVVPWEEDDAVTGCSSAVSLNVRSAAVCSEKTQANGATDQFGVDVRMCRDCNHTIFSYRDFTT
SIQHKPPDQKAYETLCQFERGISLLLPSFHRVLLALQPEKLGTGEIDLSKPPPTHAQILEAGKIRKRLIDSFGKY
GTAAKRMRGLRTDRETQKRLQEAVYTYASGFLHTNMLPLKSLPQVLRTRSAPSNSSRFLSTPTHSSSSLRHTEIA
GSDAGSQAPSEASTVVSQLESEEKDLKERLAVLQEQRLMVEDMIKMATGARRFEEVSALARNMDELDGEIRELGV
KVGDVEERWQGIYRNGAPT*
Coding >Hirsu2|7326
ATGGGGCAAAAGGACACGCGGAAGTTACTGGAGCAATCGGTCGTGCCGTGGGAGGAAGACGATGCGGTGACAGGC
TGCTCGTCGGCGGTGAGTCTGAACGTCAGGAGCGCGGCCGTATGCTCTGAAAAGACACAGGCCAATGGAGCCACA
GACCAATTCGGGGTCGACGTCAGAATGTGCCGGGATTGCAACCACACCATCTTCTCTTATCGCGACTTTACCACG
TCCATTCAACATAAACCCCCTGATCAAAAGGCGTACGAGACGTTGTGCCAATTTGAGCGCGGTATCAGCCTCCTT
CTGCCCTCATTTCATCGAGTCCTGCTTGCCTTGCAGCCAGAGAAGCTGGGCACCGGCGAGATCGACCTATCGAAG
CCTCCACCTACGCACGCGCAGATACTGGAGGCGGGCAAAATACGCAAACGTCTGATTGACAGCTTTGGCAAGTAC
GGAACGGCGGCGAAGCGAATGCGCGGTTTGAGGACGGACCGCGAGACGCAGAAGAGGCTCCAAGAGGCGGTATAT
ACGTACGCCAGCGGGTTCCTGCACACCAACATGCTCCCGCTCAAGAGCCTGCCGCAGGTGCTTCGCACCCGCTCC
GCCCCGTCCAACTCATCTCGCTTCCTGTCGACGCCGACGCACTCGTCGTCGAGCTTACGGCACACGGAGATCGCC
GGCTCCGACGCCGGTTCGCAAGCGCCGAGCGAGGCCAGCACCGTCGTCAGCCAGCTCGAGTCGGAGGAGAAGGAT
CTCAAGGAGCGGCTGGCGGTGCTGCAGGAGCAGCGGCTCATGGTGGAGGACATGATCAAGATGGCGACGGGCGCC
AGGCGCTTCGAGGAAGTGAGCGCCCTGGCGAGAAACATGGACGAGCTCGACGGCGAGATCCGCGAGCTGGGCGTC
AAGGTCGGCGACGTGGAGGAGCGCTGGCAGGGCATCTACCGCAACGGCGCGCCCACCTGA
Transcript >Hirsu2|7326
ATGGGGCAAAAGGACACGCGGAAGTTACTGGAGCAATCGGTCGTGCCGTGGGAGGAAGACGATGCGGTGACAGGC
TGCTCGTCGGCGGTGAGTCTGAACGTCAGGAGCGCGGCCGTATGCTCTGAAAAGACACAGGCCAATGGAGCCACA
GACCAATTCGGGGTCGACGTCAGAATGTGCCGGGATTGCAACCACACCATCTTCTCTTATCGCGACTTTACCACG
TCCATTCAACATAAACCCCCTGATCAAAAGGCGTACGAGACGTTGTGCCAATTTGAGCGCGGTATCAGCCTCCTT
CTGCCCTCATTTCATCGAGTCCTGCTTGCCTTGCAGCCAGAGAAGCTGGGCACCGGCGAGATCGACCTATCGAAG
CCTCCACCTACGCACGCGCAGATACTGGAGGCGGGCAAAATACGCAAACGTCTGATTGACAGCTTTGGCAAGTAC
GGAACGGCGGCGAAGCGAATGCGCGGTTTGAGGACGGACCGCGAGACGCAGAAGAGGCTCCAAGAGGCGGTATAT
ACGTACGCCAGCGGGTTCCTGCACACCAACATGCTCCCGCTCAAGAGCCTGCCGCAGGTGCTTCGCACCCGCTCC
GCCCCGTCCAACTCATCTCGCTTCCTGTCGACGCCGACGCACTCGTCGTCGAGCTTACGGCACACGGAGATCGCC
GGCTCCGACGCCGGTTCGCAAGCGCCGAGCGAGGCCAGCACCGTCGTCAGCCAGCTCGAGTCGGAGGAGAAGGAT
CTCAAGGAGCGGCTGGCGGTGCTGCAGGAGCAGCGGCTCATGGTGGAGGACATGATCAAGATGGCGACGGGCGCC
AGGCGCTTCGAGGAAGTGAGCGCCCTGGCGAGAAACATGGACGAGCTCGACGGCGAGATCCGCGAGCTGGGCGTC
AAGGTCGGCGACGTGGAGGAGCGCTGGCAGGGCATCTACCGCAACGGCGCGCCCACCTGA
Gene >Hirsu2|7326
ATGGGGCAAAAGGACACGCGGAAGTTACTGGAGCAATCGGTCGTGCCGTGGGAGGAAGACGATGCGGTGGTCAGT
TGTCCCTTCTGCCAACAAGAGTTCGGATCTTGGACGTTTAGGCGACATCACTGCCGGACATGTGGCCGTGTTGTC
TGTGCCGATCCCCAGACAGGCTGCTCGTCGGCGGTGAGTCTGAACGTCAGGAGCGGTAAGTGGTTCGCGGTGCTC
GAGCGTCAAGCCGTTCCAGGAGCTAACTTCCAATCAGCGGCCGTATGCTCTGAAAAGACACAGGCCAATGGAGCC
ACAGACCAATTCGGGGTCGACGTCAGAATGTGCCGGGATTGCAACCACACCATCTTCTCTTATCGCGACTTTACC
ACGTCCATTCAACATAAACCCCCTGATCAAAAGGCGTACGAGACGTTGTGCCAATTTGAGCGCGGTATCAGCCTC
CTTCTGCCCTCATTTCATCGAGTCCTGCTTGCCTTGCAGCCAGAGAAGCTGGGCACCGGCGAGATCGACCTATCG
AAGCCTCCACCTACGCACGCGCAGATACTGGAGGCGGGCAAAATACGCAAACGTCTGATTGACAGCTTTGGCAAG
TACGGAACGGCGGCGAAGCGAATGCGCGGTTTGAGGACGGACCGCGAGACGCAGAAGAGGCTCCAAGAGGCGGTA
TATACGTACGCCAGCGGGTTCCTGCACACCAACATGCTCCCGCTCAAGAGCCTGCCGCAGGTGCTTCGCACCCGC
TCCGCCCCGTCCAACTCATCTCGCTTCCTGTCGACGCCGACGCACTCGTCGTCGAGCTTACGGCACACGGAGATC
GCCGGCTCCGACGCCGGTTCGCAAGCGCCGAGCGAGGCCAGCACCGTCGTCAGCCAGCTCGAGTCGGAGGAGAAG
GATCTCAAGGAGCGGCTGGCGGTGCTGCAGGAGCAGCGGCTCATGGTGGAGGACATGATCAAGATGGCGACGGGC
GCCAGGCGCTTCGAGGAAGTGAGCGCCCTGGCGAGAAACATGGACGAGCTCGACGGCGAGATCCGCGAGCTGGGC
GTCAAGGTCGGCGACGTGGAGGAGCGCTGGCAGGGCATCTACCGCAACGGCGCGCCCACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail