Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7325
Gene name
LocationContig_42:11940..12668
Strand+
Gene length (bp)728
Transcript length (bp)615
Coding sequence length (bp)615
Protein length (aa) 205

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.5504 0.7524 0.0466 0.0354 0.0647 0.0192 0.0778 0.0316 0.1181 0.0401

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup960
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5519
Ophiocordyceps australis map64 (Brazil) OphauB2|2188
Ophiocordyceps camponoti-floridani Ophcf2|05518
Ophiocordyceps camponoti-rufipedis Ophun1|3791
Ophiocordyceps kimflemingae Ophio5|5028
Ophiocordyceps subramaniannii Hirsu2|7325 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7326

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7325
MSSRKLGGGRILGSGKGLAPPTPPAAPRAGSPFAPSESTVSLGSPSLSPPATGSLPDLGQDIGSSISVGAQAKGS
APNASGLVCPICSDEMVTLLQLNRHIDDNHQELPEEEQNEVKTWFDKQVLKAKRFQPLTLINQKLRGLEVFESNE
STPIQSQATGSGRPNLDGPMDPDDLITRSHWQRPTTSIAGNVADYSVKNIPCTR*
Coding >Hirsu2|7325
ATGTCGAGCCGGAAGCTCGGAGGTGGCCGCATCCTCGGCAGCGGCAAGGGCCTCGCACCTCCGACCCCCCCCGCG
GCGCCTCGAGCCGGCAGCCCCTTTGCTCCCTCGGAGAGCACCGTGTCCCTCGGCTCCCCGTCGCTTTCGCCGCCT
GCTACCGGTAGCTTGCCCGACCTTGGCCAGGATATAGGCTCGAGCATCAGCGTAGGGGCTCAGGCAAAGGGCAGC
GCGCCGAATGCATCTGGCCTCGTCTGTCCGATCTGCAGCGATGAAATGGTGACGCTGCTGCAGCTCAATCGGCAC
ATCGACGACAACCACCAGGAACTCCCCGAAGAGGAACAGAACGAGGTCAAGACTTGGTTCGACAAACAAGTCCTC
AAGGCCAAGCGATTTCAACCTCTGACTCTAATCAACCAGAAGCTTCGTGGCCTCGAGGTGTTCGAGTCCAACGAG
TCCACCCCCATCCAATCGCAGGCAACGGGCAGCGGCAGACCCAACCTGGACGGGCCCATGGATCCAGACGATCTT
ATAACGCGGAGCCACTGGCAGCGGCCGACCACATCAATTGCCGGAAATGTGGCCGATTATTCTGTGAAGAACATA
CCATGTACCAGATGA
Transcript >Hirsu2|7325
ATGTCGAGCCGGAAGCTCGGAGGTGGCCGCATCCTCGGCAGCGGCAAGGGCCTCGCACCTCCGACCCCCCCCGCG
GCGCCTCGAGCCGGCAGCCCCTTTGCTCCCTCGGAGAGCACCGTGTCCCTCGGCTCCCCGTCGCTTTCGCCGCCT
GCTACCGGTAGCTTGCCCGACCTTGGCCAGGATATAGGCTCGAGCATCAGCGTAGGGGCTCAGGCAAAGGGCAGC
GCGCCGAATGCATCTGGCCTCGTCTGTCCGATCTGCAGCGATGAAATGGTGACGCTGCTGCAGCTCAATCGGCAC
ATCGACGACAACCACCAGGAACTCCCCGAAGAGGAACAGAACGAGGTCAAGACTTGGTTCGACAAACAAGTCCTC
AAGGCCAAGCGATTTCAACCTCTGACTCTAATCAACCAGAAGCTTCGTGGCCTCGAGGTGTTCGAGTCCAACGAG
TCCACCCCCATCCAATCGCAGGCAACGGGCAGCGGCAGACCCAACCTGGACGGGCCCATGGATCCAGACGATCTT
ATAACGCGGAGCCACTGGCAGCGGCCGACCACATCAATTGCCGGAAATGTGGCCGATTATTCTGTGAAGAACATA
CCATGTACCAGATGA
Gene >Hirsu2|7325
ATGTCGAGCCGGAAGCTCGGAGGTGGCCGCATCCTCGGCAGCGGCAAGGGCCTCGCACCTCCGACCCCCCCCGCG
GCGCCTCGAGCCGGCAGCCCCTTTGCTCCCTCGGAGAGCACCGTGTCCCTCGGCTCCCCGTCGCTTTCGCCGCCT
GCTACCGGTAGCTTGCCCGACCTTGGCCAGGATATAGGCTCGAGCATCAGCGTAGGGGCTCAGGCAAAGGGCAGC
GCGCCGAATGCATCTGGCCTCGTCTGTCCGATCTGCAGCGATGAAATGGTGAGAGGCGGCGGCACGATCCCTATC
TTCTTCTGGCATCCTCTGACTCGACTAGGTGACGCTGCTGCAGCTCAATCGGCACATCGACGACAACCACCAGGA
ACTCCCCGAAGAGGAACAGAACGAGGTCAAGACTTGGTTCGACAAACAAGTCCTCAAGGCCAAGCGATTTCAACC
TCTGACTCTAATCAACCAGAAGCTTCGTGGCCTCGAGGTGTTCGAGTCCAACGAGTCCACCCCCATCCAATCGCA
GGCAACGGGCAGCGGCAGACCCAACCTGGACGGGCCCATGGATCCAGACGATCTTATAACGCGGAGCCACTGGCA
GCGGCCGACCAGTTACGATACATGCACCGACCCTGCCTGTGGGAAGGGGCTAGGCCCCATGAACGGCAGCATCAA
TTGCCGGAAATGTGGCCGATTATTCTGTGAAGAACATACCATGTACCAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail