Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7319
Gene name
LocationContig_419:18531..19038
Strand+
Gene length (bp)507
Transcript length (bp)429
Coding sequence length (bp)429
Protein length (aa) 143

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06726 BC10 Bladder cancer-related protein BC10 1.2E-17 1 55

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P6M5|YKS1_SCHPO Uncharacterized protein C652.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC652.01 PE=4 SV=1 1 69 5.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7319
MFCLRSWLPLLFIPTNASPAFIFLFFVCTYFLNRPCVYCSILLLILFLTSCNWSDRCFFDFGSNWFQPRPAASSA
ALADADSLFNSTLAQMANSTAKGLAGAVADNMAARRAEWTGLGMEWLRSLLGRREWRIECMDIYIRL*
Coding >Hirsu2|7319
ATGTTTTGCCTGCGAAGCTGGCTCCCGCTCCTCTTCATCCCCACCAACGCCTCGCCGGCCTTCATCTTCCTCTTC
TTCGTCTGCACCTACTTCCTCAACCGGCCCTGCGTCTACTGCTCCATCCTGCTGCTGATCCTCTTCCTGACGTCG
TGCAACTGGTCCGACCGCTGCTTCTTCGACTTCGGCAGCAACTGGTTCCAGCCCCGGCCCGCCGCCTCGTCGGCC
GCCCTCGCCGACGCCGACTCCCTCTTCAACTCCACCCTCGCCCAGATGGCCAACTCGACCGCCAAGGGCCTTGCC
GGCGCCGTCGCCGATAACATGGCCGCCCGAAGGGCCGAGTGGACCGGCCTGGGCATGGAGTGGCTGCGGAGCCTG
CTGGGCAGGCGGGAGTGGCGCATCGAGTGCATGGACATATACATCCGCCTGTGA
Transcript >Hirsu2|7319
ATGTTTTGCCTGCGAAGCTGGCTCCCGCTCCTCTTCATCCCCACCAACGCCTCGCCGGCCTTCATCTTCCTCTTC
TTCGTCTGCACCTACTTCCTCAACCGGCCCTGCGTCTACTGCTCCATCCTGCTGCTGATCCTCTTCCTGACGTCG
TGCAACTGGTCCGACCGCTGCTTCTTCGACTTCGGCAGCAACTGGTTCCAGCCCCGGCCCGCCGCCTCGTCGGCC
GCCCTCGCCGACGCCGACTCCCTCTTCAACTCCACCCTCGCCCAGATGGCCAACTCGACCGCCAAGGGCCTTGCC
GGCGCCGTCGCCGATAACATGGCCGCCCGAAGGGCCGAGTGGACCGGCCTGGGCATGGAGTGGCTGCGGAGCCTG
CTGGGCAGGCGGGAGTGGCGCATCGAGTGCATGGACATATACATCCGCCTGTGA
Gene >Hirsu2|7319
ATGTTTTGCCTGCGAAGGTCCGTCCCCTCTTTTCCCTCGAGATGGCGGAGTGAGCGAGTGAGCGGGCGGTGGCTA
ACGTCGTATCGCAACCGCAGCTGGCTCCCGCTCCTCTTCATCCCCACCAACGCCTCGCCGGCCTTCATCTTCCTC
TTCTTCGTCTGCACCTACTTCCTCAACCGGCCCTGCGTCTACTGCTCCATCCTGCTGCTGATCCTCTTCCTGACG
TCGTGCAACTGGTCCGACCGCTGCTTCTTCGACTTCGGCAGCAACTGGTTCCAGCCCCGGCCCGCCGCCTCGTCG
GCCGCCCTCGCCGACGCCGACTCCCTCTTCAACTCCACCCTCGCCCAGATGGCCAACTCGACCGCCAAGGGCCTT
GCCGGCGCCGTCGCCGATAACATGGCCGCCCGAAGGGCCGAGTGGACCGGCCTGGGCATGGAGTGGCTGCGGAGC
CTGCTGGGCAGGCGGGAGTGGCGCATCGAGTGCATGGACATATACATCCGCCTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail